|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for SLC4A5 |
 Gene summary |
| Gene information | Gene symbol | SLC4A5 | Gene ID | 57835 |
| Gene name | solute carrier family 4 member 5 | |
| Synonyms | NBC4|NBCe2 | |
| Cytomap | 2p13.1 | |
| Type of gene | protein-coding | |
| Description | electrogenic sodium bicarbonate cotransporter 4solute carrier family 4 (sodium bicarbonate cotransporter), member 5 | |
| Modification date | 20200320 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for SLC4A5 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000188687
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| CB | UP | ENST00000377632.5 | SLC4A5-203:protein_coding:SLC4A5 | 3.348494e+00 | 1.085164e+00 | 1.515019e-02 | 4.863958e-02 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for SLC4A5 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_203250 | chr2 | 74314945:74315025:74328120:74328186:74334027:74334177 | 74328120:74328186 |
| exon_skip_26904 | chr2 | 74233402:74233563:74235101:74235214:74239335:74239535 | 74235101:74235214 |
| exon_skip_33205 | chr2 | 74285773:74285902:74304489:74304680:74314945:74315025 | 74304489:74304680 |
| exon_skip_74061 | chr2 | 74231236:74231308:74232469:74232647:74233402:74233563 | 74232469:74232647 |
| exon_skip_75350 | chr2 | 74221434:74221501:74222868:74222952:74224840:74224995 | 74222868:74222952 |
| exon_skip_89384 | chr2 | 74285773:74285902:74314945:74315025:74328120:74328186 | 74314945:74315025 |
| exon_skip_98625 | chr2 | 74226957:74227130:74227517:74227564:74227810:74227878 | 74227517:74227564 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for SLC4A5 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000346834 | 74328120 | 74328186 | 3UTR-3UTR |
| ENST00000377634 | 74328120 | 74328186 | 3UTR-3UTR |
| ENST00000346834 | 74232469 | 74232647 | Frame-shift |
| ENST00000377634 | 74232469 | 74232647 | Frame-shift |
| ENST00000346834 | 74235101 | 74235214 | In-frame |
| ENST00000377634 | 74235101 | 74235214 | In-frame |
| ENST00000346834 | 74304489 | 74304680 | In-frame |
| ENST00000377634 | 74304489 | 74304680 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000346834 | 74328120 | 74328186 | 3UTR-3UTR |
| ENST00000377634 | 74328120 | 74328186 | 3UTR-3UTR |
| ENST00000346834 | 74222868 | 74222952 | Frame-shift |
| ENST00000377634 | 74222868 | 74222952 | Frame-shift |
| ENST00000346834 | 74232469 | 74232647 | Frame-shift |
| ENST00000377634 | 74232469 | 74232647 | Frame-shift |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000346834 | 74328120 | 74328186 | 3UTR-3UTR |
| ENST00000377634 | 74328120 | 74328186 | 3UTR-3UTR |
| ENST00000346834 | 74222868 | 74222952 | Frame-shift |
| ENST00000377634 | 74222868 | 74222952 | Frame-shift |
| ENST00000346834 | 74232469 | 74232647 | Frame-shift |
| ENST00000377634 | 74232469 | 74232647 | Frame-shift |
| ENST00000346834 | 74227517 | 74227564 | In-frame |
| ENST00000377634 | 74227517 | 74227564 | In-frame |
| ENST00000346834 | 74235101 | 74235214 | In-frame |
| ENST00000377634 | 74235101 | 74235214 | In-frame |
| ENST00000346834 | 74304489 | 74304680 | In-frame |
| ENST00000377634 | 74304489 | 74304680 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for SLC4A5 |
p-ENSG00000188687_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000346834 | 6250 | 1137 | 74304489 | 74304680 | 316 | 506 | 26 | 90 |
| ENST00000377634 | 3831 | 1137 | 74304489 | 74304680 | 480 | 670 | 26 | 90 |
| ENST00000346834 | 6250 | 1137 | 74235101 | 74235214 | 2556 | 2668 | 773 | 810 |
| ENST00000377634 | 3831 | 1137 | 74235101 | 74235214 | 2720 | 2832 | 773 | 810 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000346834 | 6250 | 1137 | 74304489 | 74304680 | 316 | 506 | 26 | 90 |
| ENST00000377634 | 3831 | 1137 | 74304489 | 74304680 | 480 | 670 | 26 | 90 |
| ENST00000346834 | 6250 | 1137 | 74235101 | 74235214 | 2556 | 2668 | 773 | 810 |
| ENST00000377634 | 3831 | 1137 | 74235101 | 74235214 | 2720 | 2832 | 773 | 810 |
| ENST00000346834 | 6250 | 1137 | 74227517 | 74227564 | 3153 | 3199 | 972 | 987 |
| ENST00000377634 | 3831 | 1137 | 74227517 | 74227564 | 3317 | 3363 | 972 | 987 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9BY07 | 26 | 90 | 27 | 91 | Alternative sequence | ID=VSP_052770;Note=In isoform 7. ECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWGLRPDQPQQELTGPGSGASSQDSSMDLISRTR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9BY07 | 26 | 90 | 27 | 91 | Alternative sequence | ID=VSP_052770;Note=In isoform 7. ECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWGLRPDQPQQELTGPGSGASSQDSSMDLISRTR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9BY07 | 26 | 90 | 88 | 91 | Alternative sequence | ID=VSP_052771;Note=In isoform 5. SRTR->EHKG;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.9 |
| Q9BY07 | 26 | 90 | 88 | 91 | Alternative sequence | ID=VSP_052771;Note=In isoform 5. SRTR->EHKG;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.9 |
| Q9BY07 | 26 | 90 | 1 | 1137 | Chain | ID=PRO_0000328920;Note=Electrogenic sodium bicarbonate cotransporter 4 |
| Q9BY07 | 26 | 90 | 1 | 1137 | Chain | ID=PRO_0000328920;Note=Electrogenic sodium bicarbonate cotransporter 4 |
| Q9BY07 | 26 | 90 | 1 | 521 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 26 | 90 | 1 | 521 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 774 | 811 | Alternative sequence | ID=VSP_052772;Note=In isoform 6 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:12388414,ECO:0000303|PubMed:15489334;Dbxref=PMID:12388414,PMID:15489334 |
| Q9BY07 | 773 | 810 | 774 | 811 | Alternative sequence | ID=VSP_052772;Note=In isoform 6 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:12388414,ECO:0000303|PubMed:15489334;Dbxref=PMID:12388414,PMID:15489334 |
| Q9BY07 | 773 | 810 | 1 | 1137 | Chain | ID=PRO_0000328920;Note=Electrogenic sodium bicarbonate cotransporter 4 |
| Q9BY07 | 773 | 810 | 1 | 1137 | Chain | ID=PRO_0000328920;Note=Electrogenic sodium bicarbonate cotransporter 4 |
| Q9BY07 | 773 | 810 | 763 | 773 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 763 | 773 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 796 | 828 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 796 | 828 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 774 | 795 | Transmembrane | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 774 | 795 | Transmembrane | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9BY07 | 26 | 90 | 27 | 91 | Alternative sequence | ID=VSP_052770;Note=In isoform 7. ECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWGLRPDQPQQELTGPGSGASSQDSSMDLISRTR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9BY07 | 26 | 90 | 27 | 91 | Alternative sequence | ID=VSP_052770;Note=In isoform 7. ECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWGLRPDQPQQELTGPGSGASSQDSSMDLISRTR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9BY07 | 26 | 90 | 88 | 91 | Alternative sequence | ID=VSP_052771;Note=In isoform 5. SRTR->EHKG;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.9 |
| Q9BY07 | 26 | 90 | 88 | 91 | Alternative sequence | ID=VSP_052771;Note=In isoform 5. SRTR->EHKG;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.9 |
| Q9BY07 | 26 | 90 | 1 | 1137 | Chain | ID=PRO_0000328920;Note=Electrogenic sodium bicarbonate cotransporter 4 |
| Q9BY07 | 26 | 90 | 1 | 1137 | Chain | ID=PRO_0000328920;Note=Electrogenic sodium bicarbonate cotransporter 4 |
| Q9BY07 | 26 | 90 | 1 | 521 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 26 | 90 | 1 | 521 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 774 | 811 | Alternative sequence | ID=VSP_052772;Note=In isoform 6 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:12388414,ECO:0000303|PubMed:15489334;Dbxref=PMID:12388414,PMID:15489334 |
| Q9BY07 | 773 | 810 | 774 | 811 | Alternative sequence | ID=VSP_052772;Note=In isoform 6 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:12388414,ECO:0000303|PubMed:15489334;Dbxref=PMID:12388414,PMID:15489334 |
| Q9BY07 | 773 | 810 | 1 | 1137 | Chain | ID=PRO_0000328920;Note=Electrogenic sodium bicarbonate cotransporter 4 |
| Q9BY07 | 773 | 810 | 1 | 1137 | Chain | ID=PRO_0000328920;Note=Electrogenic sodium bicarbonate cotransporter 4 |
| Q9BY07 | 773 | 810 | 763 | 773 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 763 | 773 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 796 | 828 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 796 | 828 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 774 | 795 | Transmembrane | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 773 | 810 | 774 | 795 | Transmembrane | Note=Helical;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 972 | 987 | 866 | 993 | Alternative sequence | ID=VSP_052773;Note=In isoform 5. KAAGYHLDLFWVGILMALCSFMGLPWYVAATVISIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPILKCIPLPVLYGVFLYMGVASLNGIQMGTGGSEFKIQKKLTPFWERC->GTESNRHHRLHPDGNLCLPGSHPKVYPPAGAVRSLPLHGRGLPEWHPVLGTLQALPDASQAPAGPCLPAARAAAPDPPLHPGADPLPGGALD |
| Q9BY07 | 972 | 987 | 866 | 993 | Alternative sequence | ID=VSP_052773;Note=In isoform 5. KAAGYHLDLFWVGILMALCSFMGLPWYVAATVISIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPILKCIPLPVLYGVFLYMGVASLNGIQMGTGGSEFKIQKKLTPFWERC->GTESNRHHRLHPDGNLCLPGSHPKVYPPAGAVRSLPLHGRGLPEWHPVLGTLQALPDASQAPAGPCLPAARAAAPDPPLHPGADPLPGGALD |
| Q9BY07 | 972 | 987 | 950 | 1046 | Alternative sequence | ID=VSP_052775;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:12063394;Dbxref=PMID:12063394 |
| Q9BY07 | 972 | 987 | 950 | 1046 | Alternative sequence | ID=VSP_052775;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:12063394;Dbxref=PMID:12063394 |
| Q9BY07 | 972 | 987 | 973 | 988 | Alternative sequence | ID=VSP_052776;Note=In isoform 3%2C isoform 6 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:11788353,ECO:0000303|PubMed:11997242,ECO:0000303|PubMed:12388414,ECO:0000303|PubMed:15489334;Dbxr |
| Q9BY07 | 972 | 987 | 973 | 988 | Alternative sequence | ID=VSP_052776;Note=In isoform 3%2C isoform 6 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:11788353,ECO:0000303|PubMed:11997242,ECO:0000303|PubMed:12388414,ECO:0000303|PubMed:15489334;Dbxr |
| Q9BY07 | 972 | 987 | 1 | 1137 | Chain | ID=PRO_0000328920;Note=Electrogenic sodium bicarbonate cotransporter 4 |
| Q9BY07 | 972 | 987 | 1 | 1137 | Chain | ID=PRO_0000328920;Note=Electrogenic sodium bicarbonate cotransporter 4 |
| Q9BY07 | 972 | 987 | 972 | 1016 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9BY07 | 972 | 987 | 972 | 1016 | Topological domain | Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in SLC4A5 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
| Mayo | ENST00000377634 | 74328120 | 74328186 | hsa-miR-3922-3p | chr2:74328163-74328170 | 8mer-1a | chr2:74328156-74328177 | 155.00 | -19.89 |
| Mayo | ENST00000377634 | 74328120 | 74328186 | hsa-miR-3176 | chr2:74328163-74328170 | 8mer-1a | chr2:74328156-74328177 | 155.00 | -19.89 |
| Mayo | ENST00000377634 | 74328120 | 74328186 | hsa-miR-3180-5p | chr2:74328135-74328142 | 8mer-1a | chr2:74328126-74328146 | 145.00 | -19.37 |
| Mayo | ENST00000377634 | 74328120 | 74328186 | hsa-miR-152-5p | chr2:74328167-74328174 | 8mer-1a | chr2:74328156-74328177 | 155.00 | -19.89 |
| Mayo | ENST00000377634 | 74328120 | 74328186 | hsa-miR-6791-5p | chr2:74328156-74328163 | 8mer-1a | chr2:74328147-74328167 | 159.00 | -19.37 |
| Mayo | ENST00000377634 | 74328120 | 74328186 | hsa-miR-4292 | chr2:74328156-74328163 | 8mer-1a | chr2:74328147-74328167 | 159.00 | -19.37 |
| MSBB | ENST00000377634 | 74328120 | 74328186 | hsa-miR-3922-3p | chr2:74328163-74328170 | 8mer-1a | chr2:74328156-74328177 | 155.00 | -19.89 |
| MSBB | ENST00000377634 | 74328120 | 74328186 | hsa-miR-3176 | chr2:74328163-74328170 | 8mer-1a | chr2:74328156-74328177 | 155.00 | -19.89 |
| MSBB | ENST00000377634 | 74328120 | 74328186 | hsa-miR-3180-5p | chr2:74328135-74328142 | 8mer-1a | chr2:74328126-74328146 | 145.00 | -19.37 |
| MSBB | ENST00000377634 | 74328120 | 74328186 | hsa-miR-152-5p | chr2:74328167-74328174 | 8mer-1a | chr2:74328156-74328177 | 155.00 | -19.89 |
| MSBB | ENST00000377634 | 74328120 | 74328186 | hsa-miR-6791-5p | chr2:74328156-74328163 | 8mer-1a | chr2:74328147-74328167 | 159.00 | -19.37 |
| MSBB | ENST00000377634 | 74328120 | 74328186 | hsa-miR-4292 | chr2:74328156-74328163 | 8mer-1a | chr2:74328147-74328167 | 159.00 | -19.37 |
| ROSMAP | ENST00000377634 | 74328120 | 74328186 | hsa-miR-3922-3p | chr2:74328163-74328170 | 8mer-1a | chr2:74328156-74328177 | 155.00 | -19.89 |
| ROSMAP | ENST00000377634 | 74328120 | 74328186 | hsa-miR-3176 | chr2:74328163-74328170 | 8mer-1a | chr2:74328156-74328177 | 155.00 | -19.89 |
| ROSMAP | ENST00000377634 | 74328120 | 74328186 | hsa-miR-3180-5p | chr2:74328135-74328142 | 8mer-1a | chr2:74328126-74328146 | 145.00 | -19.37 |
| ROSMAP | ENST00000377634 | 74328120 | 74328186 | hsa-miR-152-5p | chr2:74328167-74328174 | 8mer-1a | chr2:74328156-74328177 | 155.00 | -19.89 |
| ROSMAP | ENST00000377634 | 74328120 | 74328186 | hsa-miR-6791-5p | chr2:74328156-74328163 | 8mer-1a | chr2:74328147-74328167 | 159.00 | -19.37 |
| ROSMAP | ENST00000377634 | 74328120 | 74328186 | hsa-miR-4292 | chr2:74328156-74328163 | 8mer-1a | chr2:74328147-74328167 | 159.00 | -19.37 |
Top |
SNVs in the skipped exons for SLC4A5 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for SLC4A5 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for SLC4A5 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for SLC4A5 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for SLC4A5 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for SLC4A5 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|