ExonSkipAD: functional annotation of exon skipping event in human

Gene summary for ANKS1B

Gene summary

Gene information	Gene symbol	ANKS1B
	Gene ID	56899
	Gene name	ankyrin repeat and sterile alpha motif domain containing 1B
	Synonyms	AIDA\|AIDA-1\|ANKS2\|EB-1\|EB1\|cajalin-2
	Cytomap	12q23.1
	Type of gene	protein-coding
	Description	ankyrin repeat and sterile alpha motif domain-containing protein 1BE2a-Pbx1-associated proteinamyloid-beta precursor protein intracellular domain associated protein 1cajalin 2
	Modification date	20200313
	UniProtAcc	B1VKB5, F8VR14, F8VVQ4, H0YI72, H0YJZ1, J3QSU0, Q7Z6G8, R4GMN5, R4GMQ4, R4GMS8, R4GN07, R4GN70, R4GN73, R4GN78, R4GNJ0,
	Context	- 29027019(Explorative results from multistep screening for potential genetic risk loci of Alzheimer's disease in the longitudinal VITA study cohort)

Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Gene

GO ID

GO term

PubMed ID

Top

Gene structures and expression levels for ANKS1B

Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

ENSG00000185046

Differentially expressed gene analysis across multiple brain tissues between AD and control.

Tissue type

DEG direction

Base mean exp.

log2FC(AD/control)

P-value

Adj. p-value

Differentially expressed isoform analysis across multiple brain tissues between AD and control.

Tissue type	DEG direction	ENST	Transcript info.	Base mean exp.	log2FC(AD/control)	P-value	Adjc. p-value
STG	UP	ENST00000550778.5	ANKS1B-221:protein_coding:ANKS1B	7.872399e+00	6.124971e+00	3.615655e-04	2.297378e-02
PG	UP	ENST00000549025.6	ANKS1B-213:protein_coding:ANKS1B	2.629065e+02	8.537671e-01	1.257779e-03	1.720712e-02
PG	DOWN	ENST00000547010.5	ANKS1B-208:protein_coding:ANKS1B	5.880739e+00	-1.735301e+00	3.103432e-03	3.259319e-02
PG	UP	ENST00000547362.5	ANKS1B-209:nonsense_mediated_decay:ANKS1B	3.222960e+01	1.020759e+00	3.240630e-03	3.363798e-02
CB	DOWN	ENST00000552245.5	ANKS1B-229:retained_intron:ANKS1B	2.119352e+01	-8.621742e-01	7.177562e-08	1.604453e-06
CB	UP	ENST00000546631.1	ANKS1B-206:lncRNA:ANKS1B	7.628925e+00	9.760524e-01	6.868870e-03	2.553639e-02

Landscape of isoform expressions across multiple brain tissues between AD and control.

Top

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for ANKS1B

Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap).

All exon skipping events in AD cohorts.

Exon skip ID	chr	Exons involved in exon skipping	Skipped exon
exon_skip_100533	chr12	98782126:98782137:98798934:98799005:98800997:98801125	98798934:98799005
exon_skip_10065	chr12	99775548:99775661:99779871:99779972:99782022:99782093	99779871:99779972
exon_skip_102372	chr12	98801093:98801125:98807844:98807915:98829174:98829251	98807844:98807915
exon_skip_11644	chr12	99246831:99246864:99399631:99399811:99443673:99443809	99399631:99399811
exon_skip_117509	chr12	98807844:98807918:98829174:98829251:98832029:98832136	98829174:98829251
exon_skip_122902	chr12	98801093:98801125:98829174:98829353:98832029:98832136	98829174:98829353
exon_skip_124202	chr12	98807844:98807915:98829174:98829353:98832029:98832136	98829174:98829353
exon_skip_139792	chr12	98801093:98801125:98832029:98832136:99053157:99053248	98832029:98832136
exon_skip_145653	chr12	99812155:99812311:99825309:99825389:99984104:99984237	99825309:99825389
exon_skip_149785	chr12	98801093:98801125:98807844:98807918:98832029:98832136	98807844:98807918
exon_skip_157054	chr12	99782022:99782097:99806404:99806700:99812155:99812311	99806404:99806700
exon_skip_163272	chr12	99399631:99399811:99443673:99443809:99504476:99504641	99443673:99443809
exon_skip_166834	chr12	98801093:98801125:98807844:98807918:99053157:99053309	98807844:98807918
exon_skip_194839	chr12	98807844:98807915:98832029:98832136:99053157:99053304	98832029:98832136
exon_skip_198208	chr12	98801093:98801125:98807844:98807918:98829174:98829251	98807844:98807918
exon_skip_20495	chr12	99504598:99504641:99655067:99655210:99772922:99773088	99655067:99655210
exon_skip_208747	chr12	98801093:98801125:98832029:98832136:99053157:99053304	98832029:98832136
exon_skip_214127	chr12	98798934:98799005:98800997:98801125:98829174:98829251	98800997:98801125
exon_skip_220375	chr12	98801093:98801125:98807844:98807915:98832029:98832136	98807844:98807915
exon_skip_221708	chr12	98745400:98745846:98751355:98751522:98773042:98773179	98751355:98751522
exon_skip_225857	chr12	99779871:99779972:99782022:99782097:99806404:99806700	99782022:99782097
exon_skip_243098	chr12	98807853:98807915:98829174:98829353:98832029:98832136	98829174:98829353
exon_skip_248161	chr12	98798934:98799005:98800997:98801125:98832029:98832136	98800997:98801125
exon_skip_288411	chr12	99443673:99443809:99504476:99504641:99655067:99655210	99504476:99504641
exon_skip_41610	chr12	98801093:98801125:98832029:98832136:98894630:98894861	98832029:98832136
exon_skip_41621	chr12	98781117:98781203:98782126:98782137:98798934:98799005	98782126:98782137
exon_skip_43655	chr12	98735560:98735634:98751355:98751522:98773042:98773179	98751355:98751522
exon_skip_51584	chr12	98801093:98801125:98807844:98807918:99053157:99053304	98807844:98807918
exon_skip_71599	chr12	99655067:99655210:99772922:99773088:99775548:99775643	99772922:99773088
exon_skip_78007	chr12	99775646:99775661:99779871:99779972:99782022:99782097	99779871:99779972
exon_skip_83136	chr12	98745739:98745849:98751355:98751522:98773042:98773179	98751355:98751522
exon_skip_91749	chr12	98801093:98801125:98807844:98807918:99053157:99053248	98807844:98807918
exon_skip_93256	chr12	98773042:98773179:98781117:98781223:98798934:98799005	98781117:98781223
exon_skip_99660	chr12	99812155:99812311:99825309:99825389:99984104:99984135	99825309:99825389

Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control.

Exon skipping information	Tissue type	Avg(PSIs) in AD	Avg(PSIs) in control	Difference (PSI)	Adj. p-value
exon_skip_102372	MSBB_PG	4.773649e-01	6.292982e-01	-1.519334e-01	1.934666e-07
exon_skip_198208	MSBB_PG	3.431034e-01	4.921429e-01	-1.490394e-01	1.246725e-06
exon_skip_122902	MSBB_PG	5.324306e-01	4.265455e-01	1.058851e-01	7.377020e-05

Top

Open reading frame (ORF) annotation in the exon skipping event for ANKS1B

Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000547776	99399631	99399811	Frame-shift
ENST00000547776	99443673	99443809	Frame-shift
ENST00000547776	99772922	99773088	Frame-shift
ENST00000547776	99782022	99782097	Frame-shift
ENST00000547776	98751355	98751522	In-frame
ENST00000547776	98782126	98782137	In-frame
ENST00000547776	98800997	98801125	In-frame
ENST00000547776	98829174	98829353	In-frame
ENST00000547776	99779871	99779972	In-frame
ENST00000547776	99806404	99806700	In-frame
ENST00000547776	99825309	99825389	In-frame

Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000547776	99399631	99399811	Frame-shift
ENST00000547776	99504476	99504641	Frame-shift
ENST00000547776	99772922	99773088	Frame-shift
ENST00000547776	99782022	99782097	Frame-shift
ENST00000547776	98829174	98829353	In-frame
ENST00000547776	99779871	99779972	In-frame
ENST00000547776	99806404	99806700	In-frame
ENST00000547776	99825309	99825389	In-frame

Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000547776	99399631	99399811	Frame-shift
ENST00000547776	99443673	99443809	Frame-shift
ENST00000547776	99504476	99504641	Frame-shift
ENST00000547776	99772922	99773088	Frame-shift
ENST00000547776	99782022	99782097	Frame-shift
ENST00000547776	98782126	98782137	In-frame
ENST00000547776	98798934	98799005	In-frame
ENST00000547776	98800997	98801125	In-frame
ENST00000547776	98829174	98829353	In-frame
ENST00000547776	99655067	99655210	In-frame
ENST00000547776	99806404	99806700	In-frame
ENST00000547776	99825309	99825389	In-frame

Top

Infer the effects of exon skipping event on protein functional features for ANKS1B

p-ENSG00000185046_img4.png
boxplot

Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000547776	3902	1248	99825309	99825389	135	214	45	71
ENST00000547776	3902	1248	99806404	99806700	373	668	124	222
ENST00000547776	3902	1248	99779871	99779972	746	846	248	282
ENST00000547776	3902	1248	98829174	98829353	2887	3065	962	1021
ENST00000547776	3902	1248	98800997	98801125	3067	3194	1022	1064
ENST00000547776	3902	1248	98751355	98751522	3505	3671	1168	1223

Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000547776	3902	1248	99825309	99825389	135	214	45	71
ENST00000547776	3902	1248	99806404	99806700	373	668	124	222
ENST00000547776	3902	1248	99779871	99779972	746	846	248	282
ENST00000547776	3902	1248	98829174	98829353	2887	3065	962	1021

Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000547776	3902	1248	99825309	99825389	135	214	45	71
ENST00000547776	3902	1248	99806404	99806700	373	668	124	222
ENST00000547776	3902	1248	99655067	99655210	1129	1271	376	423
ENST00000547776	3902	1248	98829174	98829353	2887	3065	962	1021
ENST00000547776	3902	1248	98800997	98801125	3067	3194	1022	1064
ENST00000547776	3902	1248	98798934	98799005	3196	3266	1065	1088

Lost protein functional features of individual exon skipping events in ROSMAP.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q7Z6G8	45	71	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	45	71	1	831	Alternative sequence	ID=VSP_032701;Note=In isoform 8. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	45	71	1	774	Alternative sequence	ID=VSP_032702;Note=In isoform 3%2C isoform 4%2C isoform 5%2C isoform 2 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:150
Q7Z6G8	45	71	1	420	Alternative sequence	ID=VSP_032703;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15004329;Dbxref=PMID:15004329
Q7Z6G8	45	71	3	807	Alternative sequence	ID=VSP_046415;Note=In isoform 10. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	45	71	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	45	71	58	87	Repeat	Note=ANK 2
Q7Z6G8	124	222	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	124	222	1	831	Alternative sequence	ID=VSP_032701;Note=In isoform 8. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	124	222	1	774	Alternative sequence	ID=VSP_032702;Note=In isoform 3%2C isoform 4%2C isoform 5%2C isoform 2 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:150
Q7Z6G8	124	222	1	420	Alternative sequence	ID=VSP_032703;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15004329;Dbxref=PMID:15004329
Q7Z6G8	124	222	3	807	Alternative sequence	ID=VSP_046415;Note=In isoform 10. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	124	222	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	124	222	127	156	Repeat	Note=ANK 4
Q7Z6G8	124	222	160	189	Repeat	Note=ANK 5
Q7Z6G8	124	222	193	222	Repeat	Note=ANK 6
Q7Z6G8	248	282	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	248	282	1	831	Alternative sequence	ID=VSP_032701;Note=In isoform 8. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	248	282	1	774	Alternative sequence	ID=VSP_032702;Note=In isoform 3%2C isoform 4%2C isoform 5%2C isoform 2 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:150
Q7Z6G8	248	282	1	420	Alternative sequence	ID=VSP_032703;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15004329;Dbxref=PMID:15004329
Q7Z6G8	248	282	3	807	Alternative sequence	ID=VSP_046415;Note=In isoform 10. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	248	282	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	248	282	225	254	Repeat	Note=ANK 7
Q7Z6G8	962	1021	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	962	1021	927	1022	Alternative sequence	ID=VSP_032706;Note=In isoform 8. VLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQ->QSSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	962	1021	963	1022	Alternative sequence	ID=VSP_032707;Note=In isoform 2%2C isoform 6%2C isoform 7 and isoform 10. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15004329,ECO:00
Q7Z6G8	962	1021	963	1022	Alternative sequence	ID=VSP_032708;Note=In isoform 5. EPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQ->SSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	962	1021	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	962	1021	974	974	Modified residue	Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q8BIZ1
Q7Z6G8	962	1021	1007	1007	Modified residue	Note=Phosphotyrosine;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q8BIZ1
Q7Z6G8	1022	1064	927	1022	Alternative sequence	ID=VSP_032706;Note=In isoform 8. VLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQ->QSSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	1022	1064	963	1022	Alternative sequence	ID=VSP_032707;Note=In isoform 2%2C isoform 6%2C isoform 7 and isoform 10. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15004329,ECO:00
Q7Z6G8	1022	1064	963	1022	Alternative sequence	ID=VSP_032708;Note=In isoform 5. EPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQ->SSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	1022	1064	1022	1022	Alternative sequence	ID=VSP_032709;Note=In isoform 3. Q->QSSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334
Q7Z6G8	1022	1064	1059	1074	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2M38
Q7Z6G8	1022	1064	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	1022	1064	1056	1213	Domain	Note=PID;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00148
Q7Z6G8	1022	1064	1056	1058	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2M38
Q7Z6G8	1168	1223	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	1168	1223	1056	1213	Domain	Note=PID;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00148
Q7Z6G8	1168	1223	1168	1186	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2M38

Lost protein functional features of individual exon skipping events in MSBB.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q7Z6G8	45	71	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	45	71	1	831	Alternative sequence	ID=VSP_032701;Note=In isoform 8. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	45	71	1	774	Alternative sequence	ID=VSP_032702;Note=In isoform 3%2C isoform 4%2C isoform 5%2C isoform 2 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:150
Q7Z6G8	45	71	1	420	Alternative sequence	ID=VSP_032703;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15004329;Dbxref=PMID:15004329
Q7Z6G8	45	71	3	807	Alternative sequence	ID=VSP_046415;Note=In isoform 10. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	45	71	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	45	71	58	87	Repeat	Note=ANK 2
Q7Z6G8	124	222	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	124	222	1	831	Alternative sequence	ID=VSP_032701;Note=In isoform 8. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	124	222	1	774	Alternative sequence	ID=VSP_032702;Note=In isoform 3%2C isoform 4%2C isoform 5%2C isoform 2 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:150
Q7Z6G8	124	222	1	420	Alternative sequence	ID=VSP_032703;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15004329;Dbxref=PMID:15004329
Q7Z6G8	124	222	3	807	Alternative sequence	ID=VSP_046415;Note=In isoform 10. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	124	222	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	124	222	127	156	Repeat	Note=ANK 4
Q7Z6G8	124	222	160	189	Repeat	Note=ANK 5
Q7Z6G8	124	222	193	222	Repeat	Note=ANK 6
Q7Z6G8	248	282	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	248	282	1	831	Alternative sequence	ID=VSP_032701;Note=In isoform 8. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	248	282	1	774	Alternative sequence	ID=VSP_032702;Note=In isoform 3%2C isoform 4%2C isoform 5%2C isoform 2 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:150
Q7Z6G8	248	282	1	420	Alternative sequence	ID=VSP_032703;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15004329;Dbxref=PMID:15004329
Q7Z6G8	248	282	3	807	Alternative sequence	ID=VSP_046415;Note=In isoform 10. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	248	282	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	248	282	225	254	Repeat	Note=ANK 7
Q7Z6G8	962	1021	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	962	1021	927	1022	Alternative sequence	ID=VSP_032706;Note=In isoform 8. VLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQ->QSSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	962	1021	963	1022	Alternative sequence	ID=VSP_032707;Note=In isoform 2%2C isoform 6%2C isoform 7 and isoform 10. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15004329,ECO:00
Q7Z6G8	962	1021	963	1022	Alternative sequence	ID=VSP_032708;Note=In isoform 5. EPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQ->SSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	962	1021	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	962	1021	974	974	Modified residue	Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q8BIZ1
Q7Z6G8	962	1021	1007	1007	Modified residue	Note=Phosphotyrosine;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q8BIZ1

Lost protein functional features of individual exon skipping events in Mayo.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q7Z6G8	45	71	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	45	71	1	831	Alternative sequence	ID=VSP_032701;Note=In isoform 8. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	45	71	1	774	Alternative sequence	ID=VSP_032702;Note=In isoform 3%2C isoform 4%2C isoform 5%2C isoform 2 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:150
Q7Z6G8	45	71	1	420	Alternative sequence	ID=VSP_032703;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15004329;Dbxref=PMID:15004329
Q7Z6G8	45	71	3	807	Alternative sequence	ID=VSP_046415;Note=In isoform 10. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	45	71	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	45	71	58	87	Repeat	Note=ANK 2
Q7Z6G8	124	222	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	124	222	1	831	Alternative sequence	ID=VSP_032701;Note=In isoform 8. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	124	222	1	774	Alternative sequence	ID=VSP_032702;Note=In isoform 3%2C isoform 4%2C isoform 5%2C isoform 2 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:150
Q7Z6G8	124	222	1	420	Alternative sequence	ID=VSP_032703;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15004329;Dbxref=PMID:15004329
Q7Z6G8	124	222	3	807	Alternative sequence	ID=VSP_046415;Note=In isoform 10. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	124	222	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	124	222	127	156	Repeat	Note=ANK 4
Q7Z6G8	124	222	160	189	Repeat	Note=ANK 5
Q7Z6G8	124	222	193	222	Repeat	Note=ANK 6
Q7Z6G8	376	423	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	376	423	1	831	Alternative sequence	ID=VSP_032701;Note=In isoform 8. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	376	423	1	774	Alternative sequence	ID=VSP_032702;Note=In isoform 3%2C isoform 4%2C isoform 5%2C isoform 2 and isoform 7. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:150
Q7Z6G8	376	423	1	420	Alternative sequence	ID=VSP_032703;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15004329;Dbxref=PMID:15004329
Q7Z6G8	376	423	3	807	Alternative sequence	ID=VSP_046415;Note=In isoform 10. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	376	423	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	962	1021	1	994	Alternative sequence	ID=VSP_046414;Note=In isoform 9. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q7Z6G8	962	1021	927	1022	Alternative sequence	ID=VSP_032706;Note=In isoform 8. VLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQ->QSSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	962	1021	963	1022	Alternative sequence	ID=VSP_032707;Note=In isoform 2%2C isoform 6%2C isoform 7 and isoform 10. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15004329,ECO:00
Q7Z6G8	962	1021	963	1022	Alternative sequence	ID=VSP_032708;Note=In isoform 5. EPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQ->SSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	962	1021	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	962	1021	974	974	Modified residue	Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q8BIZ1
Q7Z6G8	962	1021	1007	1007	Modified residue	Note=Phosphotyrosine;Ontology_term=ECO:0000250;evidence=ECO:0000250\|UniProtKB:Q8BIZ1
Q7Z6G8	1022	1064	927	1022	Alternative sequence	ID=VSP_032706;Note=In isoform 8. VLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQ->QSSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	1022	1064	963	1022	Alternative sequence	ID=VSP_032707;Note=In isoform 2%2C isoform 6%2C isoform 7 and isoform 10. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:10931946,ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15004329,ECO:00
Q7Z6G8	1022	1064	963	1022	Alternative sequence	ID=VSP_032708;Note=In isoform 5. EPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQ->SSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q7Z6G8	1022	1064	1022	1022	Alternative sequence	ID=VSP_032709;Note=In isoform 3. Q->QSSVCEIWTNQNAGFPFSAIHQVHN;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334
Q7Z6G8	1022	1064	1059	1074	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2M38
Q7Z6G8	1022	1064	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	1022	1064	1056	1213	Domain	Note=PID;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00148
Q7Z6G8	1022	1064	1056	1058	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2M38
Q7Z6G8	1065	1088	1059	1074	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2M38
Q7Z6G8	1065	1088	1	1248	Chain	ID=PRO_0000327259;Note=Ankyrin repeat and sterile alpha motif domain-containing protein 1B
Q7Z6G8	1065	1088	1056	1213	Domain	Note=PID;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00148
Q7Z6G8	1065	1088	1078	1091	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2M38

Top

3'-UTR located exon skipping events that lost miRNA binding sites in ANKS1B

3'-UTR exon skipping evnets lost miRNA binding.

Tissue type

ENST

Exon skip start

Exon skip end

microRNA

Binding site by TargetScan

Binding type by TargetScan

Bdinding site by miRanda

Score of miRanda

Energy by miRanda

Top

SNVs in the skipped exons for ANKS1B

- Differential PSIs between mutated versus non-mutated samples.

- Depth of Coverage in the skipped exon of the mutated samples.

- Sashimi plot in the skipped exon of the mutated samples.

- Non-synonymous mutations located in the skipped exons.

Cancer type

Sample

ESID

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

- Non-synonymous mutations located in the skipped exons in CCLE.

Sample

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

Top

AD stage-associated exon skippint events for ANKS1B

Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR).

AD stage info

Cohort

Tissue

SE id

Coefficient

P-value

Chromosome

Strand

E1 start

E1 end

Skipped start

Skipped end

E2 start

E2 end

ADstage

MSBB

IFG

exon_skip_102372

-3.872007e-01

4.178582e-02

chr12

98801093

98801125

98807844

98807915

98829174

98829251

CDR

MSBB

STG

exon_skip_23272

-3.047600e-01

2.975578e-03

chr12

99772922

99773088

99774624

99774739

99775548

99775643

Top

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for ANKS1B

sQTL information located at the skipped exons.

Tissue type

Exon skip ID

SNP id

Location

P-value

FDR

Top

Correlation with RNA binding proteins (RBPs) for ANKS1B

Correlated RBP and related information.

Tissue type	RBP name	Exon skip ID	Correlation coeifficient	P-value
DLPFC	RC3H1	exon_skip_198208	4.525650e-01	7.417745e-17
DLPFC	RC3H1	exon_skip_102372	4.573423e-01	1.388300e-17
HCC	IGF2BP2	exon_skip_102372	-4.102183e-01	2.207168e-12
HCC	PCBP4	exon_skip_102372	-6.211381e-01	3.342602e-30
HCC	PUF60	exon_skip_102372	-4.204698e-01	5.427759e-13
HCC	PTBP1	exon_skip_102372	-7.000254e-01	4.477628e-41
HCC	PABPC1	exon_skip_102372	-4.485542e-01	9.039020e-15
HCC	PCBP4	exon_skip_198208	-5.672505e-01	2.160789e-24
HCC	SF1	exon_skip_198208	-4.810124e-01	4.853147e-17
HCC	PTBP1	exon_skip_198208	-6.800891e-01	5.265951e-38
HCC	PABPC1	exon_skip_198208	-4.188000e-01	6.843358e-13
HCC	RBM5	exon_skip_189541	-4.514625e-01	5.786268e-15
HCC	FUBP1	exon_skip_189541	-4.099627e-01	2.284353e-12
HCC	ENOX1	exon_skip_189541	-4.498673e-01	7.394119e-15
HCC	PTBP1	exon_skip_189541	-5.094504e-01	3.084113e-19
HCC	PABPC1	exon_skip_189541	-4.226262e-01	4.016251e-13
HCC	PABPN1	exon_skip_122902	4.462123e-01	1.152870e-14
HCC	RBM5	exon_skip_122902	5.857402e-01	2.346075e-26
HCC	IGF2BP2	exon_skip_122902	4.147127e-01	1.090270e-12
HCC	ANKHD1	exon_skip_122902	5.454924e-01	2.065117e-22
HCC	RBM45	exon_skip_122902	4.925602e-01	5.719866e-18
HCC	SRSF1	exon_skip_122902	4.127658e-01	1.422459e-12
HCC	RBM41	exon_skip_122902	4.373986e-01	4.319171e-14
HCC	RBM3	exon_skip_117509	-4.493208e-01	2.507702e-13
HCC	RBM3	exon_skip_282239	-4.683392e-01	4.930655e-15
IFG	IGF2BP2	exon_skip_102372	-5.860742e-01	1.048452e-03
IFG	RALYL	exon_skip_102372	4.729781e-01	1.102555e-02
IFG	PTBP1	exon_skip_102372	-4.868994e-01	8.598274e-03
IFG	ENOX1	exon_skip_220375	-5.549498e-01	2.660835e-03
IFG	PUF60	exon_skip_220375	-4.605310e-01	1.563345e-02
IFG	PTBP1	exon_skip_220375	-5.840356e-01	1.381551e-03
IFG	IGF2BP2	exon_skip_198208	-4.234846e-01	2.473204e-02
IFG	RBM47	exon_skip_198208	-4.638497e-01	1.290899e-02
IFG	RALYL	exon_skip_198208	4.361300e-01	2.033548e-02
IFG	PTBP1	exon_skip_198208	-4.594933e-01	1.389799e-02
IFG	PTBP3	exon_skip_198208	4.397538e-01	1.920121e-02
IFG	RBM47	exon_skip_149785	-5.092044e-01	6.673437e-03
IFG	RC3H1	exon_skip_149785	-4.118308e-01	3.280761e-02
IFG	SF1	exon_skip_149785	-4.381831e-01	2.224723e-02
IFG	PABPC1	exon_skip_149785	-4.138857e-01	3.186127e-02
IFG	RALYL	exon_skip_122902	-4.396936e-01	1.921962e-02
PCC	PCBP4	exon_skip_102372	-4.213250e-01	2.338113e-10
PCC	PTBP1	exon_skip_102372	-5.913475e-01	5.249468e-21
PCC	PCBP4	exon_skip_198208	-4.143114e-01	4.936464e-10
PCC	PTBP1	exon_skip_198208	-5.945706e-01	2.845212e-21
PCC	TRA2A	exon_skip_189541	-4.507245e-01	7.482470e-12
PCC	PTBP1	exon_skip_189541	-5.164962e-01	1.194787e-15
PCC	PABPC1	exon_skip_189541	-4.697127e-01	7.244531e-13
PG	FXR2	exon_skip_102372	5.324793e-01	2.082082e-16
PG	HNRNPD	exon_skip_102372	4.720790e-01	8.959843e-13
PG	RALYL	exon_skip_102372	6.881347e-01	4.237735e-30
PG	PTBP1	exon_skip_102372	-4.972865e-01	3.328930e-14
PG	CELF1	exon_skip_102372	5.156838e-01	2.523327e-15
PG	FXR2	exon_skip_198208	5.504720e-01	2.551841e-17
PG	ENOX1	exon_skip_198208	4.145114e-01	9.505992e-10
PG	HNRNPD	exon_skip_198208	4.633443e-01	4.317128e-12
PG	RALYL	exon_skip_198208	6.905030e-01	8.286280e-30
PG	PTBP1	exon_skip_198208	-4.138464e-01	1.017170e-09
PG	CELF1	exon_skip_198208	5.460872e-01	5.096802e-17
PG	PCBP4	exon_skip_189541	-4.435898e-01	4.246586e-11
PG	PTBP1	exon_skip_189541	-4.466181e-01	3.019574e-11
STG	FXR2	exon_skip_102372	4.005434e-01	8.348699e-05
STG	RALYL	exon_skip_102372	5.893208e-01	7.978148e-10
STG	CELF1	exon_skip_102372	4.049668e-01	6.841807e-05
STG	RALYL	exon_skip_198208	5.121613e-01	2.470965e-07
STG	RALYL	exon_skip_122902	-4.703877e-01	2.540824e-06
TC	FXR2	exon_skip_102372	4.577763e-01	1.156778e-09
TC	HNRNPD	exon_skip_102372	5.902423e-01	2.143879e-16
TC	RALYL	exon_skip_102372	8.609397e-01	3.075494e-48
TC	PTBP1	exon_skip_102372	-4.018272e-01	1.389765e-07
TC	PTBP3	exon_skip_102372	5.712423e-01	3.073418e-15
TC	CELF1	exon_skip_102372	5.596173e-01	1.443051e-14
TC	FXR2	exon_skip_198208	4.327398e-01	1.098095e-08
TC	HNRNPD	exon_skip_198208	5.350894e-01	3.116873e-13
TC	RALYL	exon_skip_198208	8.284398e-01	1.275611e-41
TC	PTBP1	exon_skip_198208	-4.693670e-01	3.831046e-10
TC	PTBP3	exon_skip_198208	4.842786e-01	8.687475e-11
TC	CELF1	exon_skip_198208	4.904097e-01	4.621605e-11
TC	NUP42	exon_skip_16785	4.204603e-01	3.430659e-08
TC	RALYL	exon_skip_16785	4.846857e-01	9.557224e-11

Top

RelatedDrugs for ANKS1B

Approved drugs targeting this gene.
(DrugBank Version 5.1.0 2018-04-02)

UniProtAcc

DrugBank ID

Drug name

Drug activity

Drug type

Drug status

Top

RelatedDiseases for ANKS1B

Diseases associated with this gene.
(DisGeNet 4.0)

Gene

Disease ID

Disease name

# pubmeds

Source

	Gene summary
	Gene structures and expression levels
	Exon skipping events with PSIs in RPSMAP, MSBB, and Mayo
	Open reading frame (ORF) annotation in the exon skipping event
	Exon skipping events in the canonical protein sequence
	3'-UTR located exon skipping events lost miRNA binding sites
	SNVs in the skipped exons with depth of coverage
	AD stage-associated exon skipping events
	Splicing Quantitative Trait Loci (sQTLs) in the skipped exons
	Correlation with RNA binding proteins (RBPs)
	Related drugs with this gene
	Related diseases with this gene

Home

Download

Statistics

Landscape

Help

Contact

Gene summary for ANKS1B

Gene structures and expression levels for ANKS1B

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for ANKS1B

Open reading frame (ORF) annotation in the exon skipping event for ANKS1B

Infer the effects of exon skipping event on protein functional features for ANKS1B

3'-UTR located exon skipping events that lost miRNA binding sites in ANKS1B

SNVs in the skipped exons for ANKS1B

AD stage-associated exon skippint events for ANKS1B

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for ANKS1B

Correlation with RNA binding proteins (RBPs) for ANKS1B

RelatedDrugs for ANKS1B

RelatedDiseases for ANKS1B