Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
exon_skip_119182 | chr1 | 151054237:151054321:151055016:151055126:151055677:151055993 | 151055016:151055126 |
exon_skip_121377 | chr1 | 151055892:151055993:151056656:151056786:151059479:151059574 | 151056656:151056786 |
exon_skip_186986 | chr1 | 151055885:151055993:151056651:151056786:151059479:151059574 | 151056651:151056786 |
exon_skip_22681 | chr1 | 151054237:151054321:151055016:151055993:151059479:151059574 | 151055016:151055993 |
exon_skip_247168 | chr1 | 151055677:151055993:151056651:151056786:151059479:151059574 | 151056651:151056786 |
exon_skip_249845 | chr1 | 151055016:151055126:151055677:151055993:151059479:151059574 | 151055677:151055993 |
exon_skip_25920 | chr1 | 151055885:151055993:151056656:151056786:151059479:151059574 | 151056656:151056786 |
exon_skip_35289 | chr1 | 151055892:151055993:151056651:151056786:151059479:151059574 | 151056651:151056786 |
exon_skip_8024 | chr1 | 151055851:151055993:151056656:151056786:151059479:151059574 | 151056656:151056786 |
exon_skip_80556 | chr1 | 151055677:151055993:151056656:151056786:151059479:151059574 | 151056656:151056786 |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q9NRR8 | 18 | 54 | 19 | 79 | Alternative sequence | ID=VSP_033717;Note=In isoform 2. KKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL->VSLPTPHPNPKSSQLLCAVR;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11595176;Dbxref=PMID:11595176 |
Q9NRR8 | 18 | 54 | 19 | 79 | Alternative sequence | ID=VSP_033717;Note=In isoform 2. KKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL->VSLPTPHPNPKSSQLLCAVR;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11595176;Dbxref=PMID:11595176 |
Q9NRR8 | 18 | 54 | 19 | 79 | Alternative sequence | ID=VSP_033717;Note=In isoform 2. KKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL->VSLPTPHPNPKSSQLLCAVR;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11595176;Dbxref=PMID:11595176 |
Q9NRR8 | 18 | 54 | 1 | 79 | Chain | ID=PRO_0000334629;Note=CDC42 small effector protein 1 |
Q9NRR8 | 18 | 54 | 1 | 79 | Chain | ID=PRO_0000334629;Note=CDC42 small effector protein 1 |
Q9NRR8 | 18 | 54 | 1 | 79 | Chain | ID=PRO_0000334629;Note=CDC42 small effector protein 1 |
Q9NRR8 | 18 | 54 | 30 | 43 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
Q9NRR8 | 18 | 54 | 30 | 43 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
Q9NRR8 | 18 | 54 | 30 | 43 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
Q9NRR8 | 18 | 54 | 33 | 33 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-38 and A-41. P->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 33 | 33 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-38 and A-41. P->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 33 | 33 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-38 and A-41. P->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 38 | 38 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-41. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 38 | 38 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-41. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 38 | 38 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-41. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 41 | 41 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-38. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 41 | 41 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-38. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 41 | 41 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-38. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 19 | 24 | Region | Note=Mediates phosphoinositide-binding |
Q9NRR8 | 18 | 54 | 19 | 24 | Region | Note=Mediates phosphoinositide-binding |
Q9NRR8 | 18 | 54 | 19 | 24 | Region | Note=Mediates phosphoinositide-binding |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q9NRR8 | 18 | 54 | 19 | 79 | Alternative sequence | ID=VSP_033717;Note=In isoform 2. KKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL->VSLPTPHPNPKSSQLLCAVR;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11595176;Dbxref=PMID:11595176 |
Q9NRR8 | 18 | 54 | 19 | 79 | Alternative sequence | ID=VSP_033717;Note=In isoform 2. KKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL->VSLPTPHPNPKSSQLLCAVR;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11595176;Dbxref=PMID:11595176 |
Q9NRR8 | 18 | 54 | 19 | 79 | Alternative sequence | ID=VSP_033717;Note=In isoform 2. KKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL->VSLPTPHPNPKSSQLLCAVR;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11595176;Dbxref=PMID:11595176 |
Q9NRR8 | 18 | 54 | 1 | 79 | Chain | ID=PRO_0000334629;Note=CDC42 small effector protein 1 |
Q9NRR8 | 18 | 54 | 1 | 79 | Chain | ID=PRO_0000334629;Note=CDC42 small effector protein 1 |
Q9NRR8 | 18 | 54 | 1 | 79 | Chain | ID=PRO_0000334629;Note=CDC42 small effector protein 1 |
Q9NRR8 | 18 | 54 | 30 | 43 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
Q9NRR8 | 18 | 54 | 30 | 43 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
Q9NRR8 | 18 | 54 | 30 | 43 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
Q9NRR8 | 18 | 54 | 33 | 33 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-38 and A-41. P->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 33 | 33 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-38 and A-41. P->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 33 | 33 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-38 and A-41. P->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 38 | 38 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-41. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 38 | 38 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-41. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 38 | 38 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-41. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 41 | 41 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-38. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 41 | 41 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-38. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 41 | 41 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-38. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 19 | 24 | Region | Note=Mediates phosphoinositide-binding |
Q9NRR8 | 18 | 54 | 19 | 24 | Region | Note=Mediates phosphoinositide-binding |
Q9NRR8 | 18 | 54 | 19 | 24 | Region | Note=Mediates phosphoinositide-binding |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q9NRR8 | 18 | 54 | 19 | 79 | Alternative sequence | ID=VSP_033717;Note=In isoform 2. KKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL->VSLPTPHPNPKSSQLLCAVR;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11595176;Dbxref=PMID:11595176 |
Q9NRR8 | 18 | 54 | 19 | 79 | Alternative sequence | ID=VSP_033717;Note=In isoform 2. KKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL->VSLPTPHPNPKSSQLLCAVR;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11595176;Dbxref=PMID:11595176 |
Q9NRR8 | 18 | 54 | 19 | 79 | Alternative sequence | ID=VSP_033717;Note=In isoform 2. KKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL->VSLPTPHPNPKSSQLLCAVR;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11595176;Dbxref=PMID:11595176 |
Q9NRR8 | 18 | 54 | 1 | 79 | Chain | ID=PRO_0000334629;Note=CDC42 small effector protein 1 |
Q9NRR8 | 18 | 54 | 1 | 79 | Chain | ID=PRO_0000334629;Note=CDC42 small effector protein 1 |
Q9NRR8 | 18 | 54 | 1 | 79 | Chain | ID=PRO_0000334629;Note=CDC42 small effector protein 1 |
Q9NRR8 | 18 | 54 | 30 | 43 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
Q9NRR8 | 18 | 54 | 30 | 43 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
Q9NRR8 | 18 | 54 | 30 | 43 | Domain | Note=CRIB;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00057 |
Q9NRR8 | 18 | 54 | 33 | 33 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-38 and A-41. P->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 33 | 33 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-38 and A-41. P->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 33 | 33 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-38 and A-41. P->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 38 | 38 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-41. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 38 | 38 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-41. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 38 | 38 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-41. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 41 | 41 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-38. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 41 | 41 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-38. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 41 | 41 | Mutagenesis | Note=Abolishes interaction with CDC42%2C induces a decrease in blocking CDC42-induced JNK activation but does not affect targeting to the activated TCR%3B when associated with A-33 and A-38. H->A;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269| |
Q9NRR8 | 18 | 54 | 19 | 24 | Region | Note=Mediates phosphoinositide-binding |
Q9NRR8 | 18 | 54 | 19 | 24 | Region | Note=Mediates phosphoinositide-binding |
Q9NRR8 | 18 | 54 | 19 | 24 | Region | Note=Mediates phosphoinositide-binding |