ExonSkipAD: functional annotation of exon skipping event in human

Gene summary for LGMN

Gene summary

Gene information	Gene symbol	LGMN
	Gene ID	5641
	Gene name	legumain
	Synonyms	AEP\|LGMN1\|PRSC1
	Cytomap	14q32.12
	Type of gene	protein-coding
	Description	legumainasparaginyl endopeptidasecysteine protease 1protease, cysteine 1protease, cysteine, 1 (legumain)
	Modification date	20200313
	UniProtAcc	G3V263, G3V2E9, G3V2T4, G3V3Z4, G3V4E4, G3V4P5, G3V5B2, H0YJN9, Q53XC6, Q6I9U9, Q99538,
	Context

Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Gene	GO ID	GO term	PubMed ID
LGMN	GO:0010447	response to acidic pH	18374643
LGMN	GO:0035729	cellular response to hepatocyte growth factor stimulus	21237226
LGMN	GO:0071277	cellular response to calcium ion	21237226
LGMN	GO:0090026	positive regulation of monocyte chemotaxis	18377911
LGMN	GO:0097202	activation of cysteine-type endopeptidase activity	9821970\|18374643
LGMN	GO:0097264	self proteolysis	9821970\|18374643
LGMN	GO:1904646	cellular response to amyloid-beta	25326800
LGMN	GO:2001028	positive regulation of endothelial cell chemotaxis	18377911

Top

Gene structures and expression levels for LGMN

Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

ENSG00000100600

Differentially expressed gene analysis across multiple brain tissues between AD and control.

Tissue type

DEG direction

Base mean exp.

log2FC(AD/control)

P-value

Adj. p-value

Differentially expressed isoform analysis across multiple brain tissues between AD and control.

Tissue type	DEG direction	ENST	Transcript info.	Base mean exp.	log2FC(AD/control)	P-value	Adjc. p-value
CB	DOWN	ENST00000555169.1	LGMN-210:protein_coding:LGMN	5.875788e+01	-1.711862e+00	1.975997e-07	3.779175e-06
TC	DOWN	ENST00000555169.1	LGMN-210:protein_coding:LGMN	1.101680e+02	-8.129178e-01	4.812663e-04	5.582819e-03

Landscape of isoform expressions across multiple brain tissues between AD and control.

Top

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for LGMN

Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap).

All exon skipping events in AD cohorts.

Exon skip ID	chr	Exons involved in exon skipping	Skipped exon
exon_skip_111809	chr14	92732728:92732815:92741062:92741179:92748489:92748512	92741062:92741179
exon_skip_11571	chr14	92704276:92704361:92704640:92704707:92709672:92709750	92704640:92704707
exon_skip_124907	chr14	92704293:92704361:92704640:92704707:92706483:92706653	92704640:92704707
exon_skip_128257	chr14	92732649:92732815:92741718:92741859:92748489:92748570	92741718:92741859
exon_skip_132396	chr14	92704276:92704361:92704640:92704707:92709672:92709741	92704640:92704707
exon_skip_135218	chr14	92732728:92732815:92741062:92741179:92748489:92748570	92741062:92741179
exon_skip_143480	chr14	92704640:92704707:92706483:92706653:92709672:92709750	92706483:92706653
exon_skip_143675	chr14	92732649:92732815:92741705:92741859:92748489:92748518	92741705:92741859
exon_skip_157867	chr14	92732649:92732815:92741705:92741859:92748489:92748627	92741705:92741859
exon_skip_161784	chr14	92732649:92732815:92741705:92741859:92748489:92748570	92741705:92741859
exon_skip_184609	chr14	92732728:92732815:92733682:92733810:92748489:92748627	92733682:92733810
exon_skip_18765	chr14	92714424:92714451:92716136:92716221:92717380:92717447	92716136:92716221
exon_skip_204600	chr14	92704296:92704361:92704640:92704707:92706483:92706653	92704640:92704707
exon_skip_214027	chr14	92704640:92704707:92706483:92706653:92709672:92709872	92706483:92706653
exon_skip_214159	chr14	92717380:92717461:92718774:92718844:92732649:92732815	92718774:92718844
exon_skip_215691	chr14	92732649:92732815:92741718:92741859:92748489:92748518	92741718:92741859
exon_skip_219969	chr14	92704276:92704361:92704640:92704707:92709672:92709872	92704640:92704707
exon_skip_241147	chr14	92732649:92732815:92741718:92741859:92748489:92748627	92741718:92741859
exon_skip_241278	chr14	92717380:92717461:92718747:92718844:92732649:92732815	92718747:92718844
exon_skip_278480	chr14	92704276:92704361:92704640:92704707:92706483:92706653	92704640:92704707
exon_skip_281601	chr14	92732649:92732815:92741718:92741859:92748489:92748512	92741718:92741859
exon_skip_28391	chr14	92732728:92732815:92741062:92741179:92748489:92748518	92741062:92741179
exon_skip_42673	chr14	92714376:92714451:92716136:92716221:92717380:92717461	92716136:92716221
exon_skip_439	chr14	92732649:92732815:92741062:92741179:92748489:92748627	92741062:92741179
exon_skip_60524	chr14	92704640:92704707:92706483:92706653:92709672:92709741	92706483:92706653
exon_skip_71646	chr14	92732649:92732815:92733682:92733810:92748489:92748627	92733682:92733810
exon_skip_86749	chr14	92711837:92711955:92712805:92712871:92713823:92713885	92712805:92712871
exon_skip_99346	chr14	92713852:92713885:92714376:92714451:92716136:92716221	92714376:92714451

Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control.

Exon skipping information	Tissue type	Avg(PSIs) in AD	Avg(PSIs) in control	Difference (PSI)	Adj. p-value
exon_skip_241278	Mayo_CB	8.030000e-01	9.205882e-01	-1.175882e-01	1.320117e-06

Top

Open reading frame (ORF) annotation in the exon skipping event for LGMN

Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000393218	92741062	92741179	3UTR-3UTR
ENST00000334869	92704640	92704707	Frame-shift
ENST00000393218	92704640	92704707	Frame-shift
ENST00000334869	92712805	92712871	Frame-shift
ENST00000393218	92712805	92712871	Frame-shift
ENST00000334869	92714376	92714451	Frame-shift
ENST00000393218	92714376	92714451	Frame-shift
ENST00000334869	92716136	92716221	Frame-shift
ENST00000393218	92716136	92716221	Frame-shift
ENST00000334869	92718747	92718844	Frame-shift
ENST00000393218	92718747	92718844	Frame-shift
ENST00000334869	92706483	92706653	In-frame
ENST00000393218	92706483	92706653	In-frame

Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000393218	92741062	92741179	3UTR-3UTR
ENST00000334869	92704640	92704707	Frame-shift
ENST00000393218	92704640	92704707	Frame-shift
ENST00000334869	92718747	92718844	Frame-shift
ENST00000393218	92718747	92718844	Frame-shift
ENST00000334869	92706483	92706653	In-frame
ENST00000393218	92706483	92706653	In-frame

Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000393218	92741062	92741179	3UTR-3UTR
ENST00000334869	92704640	92704707	Frame-shift
ENST00000393218	92704640	92704707	Frame-shift
ENST00000334869	92712805	92712871	Frame-shift
ENST00000393218	92712805	92712871	Frame-shift
ENST00000334869	92716136	92716221	Frame-shift
ENST00000393218	92716136	92716221	Frame-shift
ENST00000334869	92718747	92718844	Frame-shift
ENST00000393218	92718747	92718844	Frame-shift
ENST00000334869	92706483	92706653	In-frame
ENST00000393218	92706483	92706653	In-frame

Top

Infer the effects of exon skipping event on protein functional features for LGMN

p-ENSG00000100600_img4.png
boxplot

Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000334869	2072	433	92706483	92706653	1264	1433	340	396
ENST00000393218	2132	433	92706483	92706653	1359	1528	340	396

Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000334869	2072	433	92706483	92706653	1264	1433	340	396
ENST00000393218	2132	433	92706483	92706653	1359	1528	340	396

Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000334869	2072	433	92706483	92706653	1264	1433	340	396
ENST00000393218	2132	433	92706483	92706653	1359	1528	340	396

Lost protein functional features of individual exon skipping events in ROSMAP.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q99538	340	396	341	397	Alternative sequence	ID=VSP_056454;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	341	397	Alternative sequence	ID=VSP_056454;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	341	372	Alternative sequence	ID=VSP_056455;Note=In isoform 3. ARHLIEKSVRKIVSLLAASEAEVEQLLSERAP->DKIVHGPRVPWSLLKSCLLEAFPSVSAPPTVC;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	341	372	Alternative sequence	ID=VSP_056455;Note=In isoform 3. ARHLIEKSVRKIVSLLAASEAEVEQLLSERAP->DKIVHGPRVPWSLLKSCLLEAFPSVSAPPTVC;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	373	433	Alternative sequence	ID=VSP_056456;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	373	433	Alternative sequence	ID=VSP_056456;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	378	412	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	378	412	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	390	429	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	390	429	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	324	433	Propeptide	ID=PRO_0000026503
Q99538	340	396	324	433	Propeptide	ID=PRO_0000026503

Lost protein functional features of individual exon skipping events in MSBB.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q99538	340	396	341	397	Alternative sequence	ID=VSP_056454;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	341	397	Alternative sequence	ID=VSP_056454;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	341	372	Alternative sequence	ID=VSP_056455;Note=In isoform 3. ARHLIEKSVRKIVSLLAASEAEVEQLLSERAP->DKIVHGPRVPWSLLKSCLLEAFPSVSAPPTVC;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	341	372	Alternative sequence	ID=VSP_056455;Note=In isoform 3. ARHLIEKSVRKIVSLLAASEAEVEQLLSERAP->DKIVHGPRVPWSLLKSCLLEAFPSVSAPPTVC;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	373	433	Alternative sequence	ID=VSP_056456;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	373	433	Alternative sequence	ID=VSP_056456;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	378	412	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	378	412	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	390	429	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	390	429	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	324	433	Propeptide	ID=PRO_0000026503
Q99538	340	396	324	433	Propeptide	ID=PRO_0000026503

Lost protein functional features of individual exon skipping events in Mayo.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q99538	340	396	341	397	Alternative sequence	ID=VSP_056454;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	341	397	Alternative sequence	ID=VSP_056454;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	341	372	Alternative sequence	ID=VSP_056455;Note=In isoform 3. ARHLIEKSVRKIVSLLAASEAEVEQLLSERAP->DKIVHGPRVPWSLLKSCLLEAFPSVSAPPTVC;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	341	372	Alternative sequence	ID=VSP_056455;Note=In isoform 3. ARHLIEKSVRKIVSLLAASEAEVEQLLSERAP->DKIVHGPRVPWSLLKSCLLEAFPSVSAPPTVC;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	373	433	Alternative sequence	ID=VSP_056456;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	373	433	Alternative sequence	ID=VSP_056456;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q99538	340	396	378	412	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	378	412	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	390	429	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	390	429	Disulfide bond	Ontology_term=ECO:0000250;evidence=ECO:0000250
Q99538	340	396	324	433	Propeptide	ID=PRO_0000026503
Q99538	340	396	324	433	Propeptide	ID=PRO_0000026503

Top

3'-UTR located exon skipping events that lost miRNA binding sites in LGMN

3'-UTR exon skipping evnets lost miRNA binding.

Tissue type	ENST	Exon skip start	Exon skip end	microRNA	Binding site by TargetScan	Binding type by TargetScan	Bdinding site by miRanda	Score of miRanda	Energy by miRanda
Mayo	ENST00000393218	92741062	92741179	hsa-miR-1976	chr14:92741091-92741098	8mer-1a	chr14:92741078-92741098	149.00	-24.39
Mayo	ENST00000393218	92741062	92741179	hsa-miR-6747-3p	chr14:92741089-92741096	8mer-1a	chr14:92741078-92741098	149.00	-24.39
Mayo	ENST00000393218	92741062	92741179	hsa-miR-3664-5p	chr14:92741167-92741174	8mer-1a	chr14:92741154-92741179	157.00	-24.80
Mayo	ENST00000393218	92741062	92741179	hsa-miR-6778-3p	chr14:92741112-92741119	8mer-1a	chr14:92741108-92741130	162.00	-21.71
Mayo	ENST00000393218	92741062	92741179	hsa-miR-367-5p	chr14:92741164-92741171	8mer-1a	chr14:92741154-92741179	157.00	-24.80
Mayo	ENST00000393218	92741062	92741179	hsa-miR-550b-3p	chr14:92741170-92741177	8mer-1a	chr14:92741154-92741179	157.00	-24.80
Mayo	ENST00000393218	92741062	92741179	hsa-miR-4284	chr14:92741129-92741136	8mer-1a	chr14:92741127-92741149	156.00	-19.33
Mayo	ENST00000393218	92741062	92741179	hsa-miR-504-3p	chr14:92741150-92741157	8mer-1a	chr14:92741136-92741157	166.00	-30.16
MSBB	ENST00000393218	92741062	92741179	hsa-miR-1976	chr14:92741091-92741098	8mer-1a	chr14:92741078-92741098	149.00	-24.39
MSBB	ENST00000393218	92741062	92741179	hsa-miR-6747-3p	chr14:92741089-92741096	8mer-1a	chr14:92741078-92741098	149.00	-24.39
MSBB	ENST00000393218	92741062	92741179	hsa-miR-3664-5p	chr14:92741167-92741174	8mer-1a	chr14:92741154-92741179	157.00	-24.80
MSBB	ENST00000393218	92741062	92741179	hsa-miR-6778-3p	chr14:92741112-92741119	8mer-1a	chr14:92741108-92741130	162.00	-21.71
MSBB	ENST00000393218	92741062	92741179	hsa-miR-367-5p	chr14:92741164-92741171	8mer-1a	chr14:92741154-92741179	157.00	-24.80
MSBB	ENST00000393218	92741062	92741179	hsa-miR-550b-3p	chr14:92741170-92741177	8mer-1a	chr14:92741154-92741179	157.00	-24.80
MSBB	ENST00000393218	92741062	92741179	hsa-miR-4284	chr14:92741129-92741136	8mer-1a	chr14:92741127-92741149	156.00	-19.33
MSBB	ENST00000393218	92741062	92741179	hsa-miR-504-3p	chr14:92741150-92741157	8mer-1a	chr14:92741136-92741157	166.00	-30.16
ROSMAP	ENST00000393218	92741062	92741179	hsa-miR-1976	chr14:92741091-92741098	8mer-1a	chr14:92741078-92741098	149.00	-24.39
ROSMAP	ENST00000393218	92741062	92741179	hsa-miR-6747-3p	chr14:92741089-92741096	8mer-1a	chr14:92741078-92741098	149.00	-24.39
ROSMAP	ENST00000393218	92741062	92741179	hsa-miR-3664-5p	chr14:92741167-92741174	8mer-1a	chr14:92741154-92741179	157.00	-24.80
ROSMAP	ENST00000393218	92741062	92741179	hsa-miR-6778-3p	chr14:92741112-92741119	8mer-1a	chr14:92741108-92741130	162.00	-21.71
ROSMAP	ENST00000393218	92741062	92741179	hsa-miR-367-5p	chr14:92741164-92741171	8mer-1a	chr14:92741154-92741179	157.00	-24.80
ROSMAP	ENST00000393218	92741062	92741179	hsa-miR-550b-3p	chr14:92741170-92741177	8mer-1a	chr14:92741154-92741179	157.00	-24.80
ROSMAP	ENST00000393218	92741062	92741179	hsa-miR-4284	chr14:92741129-92741136	8mer-1a	chr14:92741127-92741149	156.00	-19.33
ROSMAP	ENST00000393218	92741062	92741179	hsa-miR-504-3p	chr14:92741150-92741157	8mer-1a	chr14:92741136-92741157	166.00	-30.16

Top

SNVs in the skipped exons for LGMN

- Differential PSIs between mutated versus non-mutated samples.

- Depth of Coverage in the skipped exon of the mutated samples.

- Sashimi plot in the skipped exon of the mutated samples.

- Non-synonymous mutations located in the skipped exons.

Cancer type

Sample

ESID

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

- Non-synonymous mutations located in the skipped exons in CCLE.

Sample

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

Top

AD stage-associated exon skippint events for LGMN

Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR).

AD stage info

Cohort

Tissue

SE id

Coefficient

P-value

Chromosome

Strand

E1 start

E1 end

Skipped start

Skipped end

E2 start

E2 end

Top

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for LGMN

sQTL information located at the skipped exons.

Tissue type	Exon skip ID	SNP id	Location	P-value	FDR
TC	exon_skip_132396	rs3783933	chr14:92711055	3.652477e-04	4.588459e-02
HCC	exon_skip_278480	rs1242118	chr14:92720273	1.658790e-04	1.393904e-02
HCC	exon_skip_278480	rs4904977	chr14:92705208	2.187130e-04	1.745943e-02
HCC	exon_skip_278480	rs1242119	chr14:92716121	5.448465e-04	3.629437e-02
HCC	exon_skip_278480	rs9791	chr14:92704648	5.977946e-04	3.899708e-02
HCC	exon_skip_278480	rs716097	chr14:92712122	7.984504e-04	4.900875e-02

Top

Correlation with RNA binding proteins (RBPs) for LGMN

Correlated RBP and related information.

Tissue type	RBP name	Exon skip ID	Correlation coeifficient	P-value
CB	PCBP4	exon_skip_167411	4.207772e-01	3.385801e-07
CB	RBM4	exon_skip_167411	-6.374614e-01	7.157668e-17
CB	RBM4B	exon_skip_167411	-4.452570e-01	5.589304e-08
CB	RBM4	exon_skip_214027	-6.245019e-01	2.340078e-18
CB	RBM4B	exon_skip_214027	-4.615828e-01	1.168617e-09
CB	TARDBP	exon_skip_63107	-4.270754e-01	5.031713e-08
CB	U2AF2	exon_skip_63107	-5.288196e-01	3.498004e-12
CB	CNOT4	exon_skip_63107	-4.431814e-01	1.351824e-08
CB	TRA2A	exon_skip_63107	-4.426852e-01	1.409134e-08
CB	TRA2A	exon_skip_241278	-5.737780e-01	2.481867e-14
CB	NUP42	exon_skip_241278	5.104988e-01	3.395269e-11
CB	RBM4	exon_skip_241278	-7.844413e-01	4.291404e-32
CB	RBM4B	exon_skip_241278	-5.555992e-01	2.312120e-13
IFG	TARDBP	exon_skip_278480	4.904353e-01	9.399817e-03
IFG	SAMD4A	exon_skip_278480	4.532246e-01	1.758817e-02
IFG	RBM3	exon_skip_278480	-4.751283e-01	1.226253e-02
IFG	ILF2	exon_skip_214027	4.287900e-01	2.563564e-02
TC	RBM4	exon_skip_276183	-4.827785e-01	3.935296e-10
TC	RBM4B	exon_skip_276183	-4.473026e-01	9.550746e-09

Top

RelatedDrugs for LGMN

Approved drugs targeting this gene.
(DrugBank Version 5.1.0 2018-04-02)

UniProtAcc

DrugBank ID

Drug name

Drug activity

Drug type

Drug status

Top

RelatedDiseases for LGMN

Diseases associated with this gene.
(DisGeNet 4.0)

Gene

Disease ID

Disease name

# pubmeds

Source

	Gene summary
	Gene structures and expression levels
	Exon skipping events with PSIs in RPSMAP, MSBB, and Mayo
	Open reading frame (ORF) annotation in the exon skipping event
	Exon skipping events in the canonical protein sequence
	3'-UTR located exon skipping events lost miRNA binding sites
	SNVs in the skipped exons with depth of coverage
	AD stage-associated exon skipping events
	Splicing Quantitative Trait Loci (sQTLs) in the skipped exons
	Correlation with RNA binding proteins (RBPs)
	Related drugs with this gene
	Related diseases with this gene

Home

Download

Statistics

Landscape

Help

Contact