|
Open reading frame (ORF) annotation in the exon skipping event | |
3'-UTR located exon skipping events lost miRNA binding sites | |
Splicing Quantitative Trait Loci (sQTLs) in the skipped exons | |
Gene summary for KIF21A |
Gene summary |
Gene information | Gene symbol | KIF21A | Gene ID | 55605 |
Gene name | kinesin family member 21A | |
Synonyms | CFEOM1|FEOM1|FEOM3A | |
Cytomap | 12q12 | |
Type of gene | protein-coding | |
Description | kinesin-like protein KIF21Akinesin-like protein KIF2renal carcinoma antigen NY-REN-62 | |
Modification date | 20200313 | |
UniProtAcc | ||
Context |
Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for KIF21A |
Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Differentially expressed gene analysis across multiple brain tissues between AD and control. |
Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
Landscape of isoform expressions across multiple brain tissues between AD and control. |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for KIF21A |
Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
All exon skipping events in AD cohorts. |
Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
exon_skip_103156 | chr12 | 39315932:39315970:39318073:39318201:39319906:39320013 | 39318073:39318201 |
exon_skip_113695 | chr12 | 39311417:39311553:39315229:39315243:39315932:39315970 | 39315229:39315243 |
exon_skip_126944 | chr12 | 39309752:39309766:39311415:39311553:39319906:39320013 | 39311415:39311553 |
exon_skip_139882 | chr12 | 39342034:39342124:39346466:39346504:39351777:39351980 | 39346466:39346504 |
exon_skip_140268 | chr12 | 39319990:39320013:39321348:39322882:39325839:39325893 | 39321348:39322882 |
exon_skip_144154 | chr12 | 39326264:39326324:39330242:39330262:39330746:39330911 | 39330242:39330262 |
exon_skip_145427 | chr12 | 39311417:39311553:39319906:39320013:39322668:39322882 | 39319906:39320013 |
exon_skip_185499 | chr12 | 39358178:39358373:39363098:39363213:39366350:39366517 | 39363098:39363213 |
exon_skip_187849 | chr12 | 39294424:39294517:39301480:39301679:39302965:39303135 | 39301480:39301679 |
exon_skip_194950 | chr12 | 39333037:39333107:39333212:39333280:39337096:39337203 | 39333212:39333280 |
exon_skip_203537 | chr12 | 39325839:39325893:39326264:39326324:39330242:39330262 | 39326264:39326324 |
exon_skip_212729 | chr12 | 39311417:39311553:39315229:39315240:39315932:39315970 | 39315229:39315240 |
exon_skip_215149 | chr12 | 39309752:39309766:39311417:39311553:39319906:39320013 | 39311417:39311553 |
exon_skip_221280 | chr12 | 39311417:39311553:39318073:39318201:39319906:39320013 | 39318073:39318201 |
exon_skip_260527 | chr12 | 39319990:39320013:39322668:39322882:39325839:39325893 | 39322668:39322882 |
exon_skip_31135 | chr12 | 39311417:39311553:39315932:39315970:39319906:39320013 | 39315932:39315970 |
exon_skip_38189 | chr12 | 39357251:39357437:39358178:39358373:39363098:39363213 | 39358178:39358373 |
exon_skip_4872 | chr12 | 39315940:39315970:39318073:39318201:39319906:39320013 | 39318073:39318201 |
exon_skip_5475 | chr12 | 39342034:39342124:39351777:39351980:39356832:39356895 | 39351777:39351980 |
exon_skip_57003 | chr12 | 39307565:39307729:39309586:39309766:39311417:39311553 | 39309586:39309766 |
exon_skip_6789 | chr12 | 39315932:39315970:39319906:39320013:39322668:39322882 | 39319906:39320013 |
exon_skip_73272 | chr12 | 39340165:39340364:39340906:39341094:39341505:39341622 | 39340906:39341094 |
exon_skip_81194 | chr12 | 39326264:39326324:39330242:39330262:39330746:39330902 | 39330242:39330262 |
Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
exon_skip_139882 | Mayo_CB | 2.800000e-01 | 3.815584e-01 | -1.015584e-01 | 3.499563e-08 |
Top |
Open reading frame (ORF) annotation in the exon skipping event for KIF21A |
Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
ENST | Start of skipped exon | End of skipped exon | ORF |
ENST00000361418 | 39301480 | 39301679 | Frame-shift |
ENST00000361418 | 39322668 | 39322882 | Frame-shift |
ENST00000361418 | 39358178 | 39358373 | Frame-shift |
ENST00000361418 | 39363098 | 39363213 | Frame-shift |
ENST00000361418 | 39315229 | 39315240 | In-frame |
ENST00000361418 | 39318073 | 39318201 | In-frame |
ENST00000361418 | 39330242 | 39330262 | In-frame |
ENST00000361418 | 39333212 | 39333280 | In-frame |
ENST00000361418 | 39340906 | 39341094 | In-frame |
ENST00000361418 | 39346466 | 39346504 | In-frame |
Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
ENST | Start of skipped exon | End of skipped exon | ORF |
ENST00000361418 | 39301480 | 39301679 | Frame-shift |
ENST00000361418 | 39309586 | 39309766 | Frame-shift |
ENST00000361418 | 39363098 | 39363213 | Frame-shift |
ENST00000361418 | 39315229 | 39315240 | In-frame |
ENST00000361418 | 39318073 | 39318201 | In-frame |
ENST00000361418 | 39330242 | 39330262 | In-frame |
ENST00000361418 | 39333212 | 39333280 | In-frame |
ENST00000361418 | 39346466 | 39346504 | In-frame |
Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
ENST | Start of skipped exon | End of skipped exon | ORF |
ENST00000361418 | 39301480 | 39301679 | Frame-shift |
ENST00000361418 | 39309586 | 39309766 | Frame-shift |
ENST00000361418 | 39322668 | 39322882 | Frame-shift |
ENST00000361418 | 39326264 | 39326324 | Frame-shift |
ENST00000361418 | 39358178 | 39358373 | Frame-shift |
ENST00000361418 | 39363098 | 39363213 | Frame-shift |
ENST00000361418 | 39315229 | 39315240 | In-frame |
ENST00000361418 | 39318073 | 39318201 | In-frame |
ENST00000361418 | 39330242 | 39330262 | In-frame |
ENST00000361418 | 39333212 | 39333280 | In-frame |
ENST00000361418 | 39346466 | 39346504 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for KIF21A |
p-ENSG00000139116_img4.png |
Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
ENST00000361418 | 5061 | 1674 | 39346466 | 39346504 | 1690 | 1727 | 558 | 570 |
ENST00000361418 | 5061 | 1674 | 39340906 | 39341094 | 1938 | 2125 | 640 | 703 |
ENST00000361418 | 5061 | 1674 | 39333212 | 39333280 | 2435 | 2502 | 806 | 828 |
ENST00000361418 | 5061 | 1674 | 39318073 | 39318201 | 3796 | 3923 | 1260 | 1302 |
Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
ENST00000361418 | 5061 | 1674 | 39346466 | 39346504 | 1690 | 1727 | 558 | 570 |
ENST00000361418 | 5061 | 1674 | 39333212 | 39333280 | 2435 | 2502 | 806 | 828 |
ENST00000361418 | 5061 | 1674 | 39318073 | 39318201 | 3796 | 3923 | 1260 | 1302 |
Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
ENST00000361418 | 5061 | 1674 | 39346466 | 39346504 | 1690 | 1727 | 558 | 570 |
ENST00000361418 | 5061 | 1674 | 39333212 | 39333280 | 2435 | 2502 | 806 | 828 |
ENST00000361418 | 5061 | 1674 | 39318073 | 39318201 | 3796 | 3923 | 1260 | 1302 |
Lost protein functional features of individual exon skipping events in ROSMAP. |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q7Z4S6 | 558 | 570 | 558 | 570 | Alternative sequence | ID=VSP_010870;Note=In isoform 2%2C isoform 5 and isoform 6. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:10508479,ECO:0000303|PubMed:11214970,ECO:0000303|PubMed:14702 |
Q7Z4S6 | 558 | 570 | 1 | 1674 | Chain | ID=PRO_0000125462;Note=Kinesin-like protein KIF21A |
Q7Z4S6 | 558 | 570 | 365 | 575 | Coiled coil | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
Q7Z4S6 | 640 | 703 | 1 | 1674 | Chain | ID=PRO_0000125462;Note=Kinesin-like protein KIF21A |
Q7Z4S6 | 640 | 703 | 653 | 653 | Sequence conflict | Note=E->D;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
Q7Z4S6 | 806 | 828 | 807 | 829 | Alternative sequence | ID=VSP_046790;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.2 |
Q7Z4S6 | 806 | 828 | 1 | 1674 | Chain | ID=PRO_0000125462;Note=Kinesin-like protein KIF21A |
Q7Z4S6 | 806 | 828 | 813 | 813 | Sequence conflict | Note=E->G;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
Q7Z4S6 | 806 | 828 | 826 | 826 | Sequence conflict | Note=K->Q;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
Q7Z4S6 | 1260 | 1302 | 1260 | 1319 | Alternative sequence | ID=VSP_010871;Note=In isoform 3. HSDSGTSEASLSPPSSPPSRPRNELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHRSSR->QSDESDSSLSEVH;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:17974005;Dbxref=PMID:17974005 |
Q7Z4S6 | 1260 | 1302 | 1 | 1674 | Chain | ID=PRO_0000125462;Note=Kinesin-like protein KIF21A |
Lost protein functional features of individual exon skipping events in MSBB. |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q7Z4S6 | 558 | 570 | 558 | 570 | Alternative sequence | ID=VSP_010870;Note=In isoform 2%2C isoform 5 and isoform 6. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:10508479,ECO:0000303|PubMed:11214970,ECO:0000303|PubMed:14702 |
Q7Z4S6 | 558 | 570 | 1 | 1674 | Chain | ID=PRO_0000125462;Note=Kinesin-like protein KIF21A |
Q7Z4S6 | 558 | 570 | 365 | 575 | Coiled coil | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
Q7Z4S6 | 806 | 828 | 807 | 829 | Alternative sequence | ID=VSP_046790;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.2 |
Q7Z4S6 | 806 | 828 | 1 | 1674 | Chain | ID=PRO_0000125462;Note=Kinesin-like protein KIF21A |
Q7Z4S6 | 806 | 828 | 813 | 813 | Sequence conflict | Note=E->G;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
Q7Z4S6 | 806 | 828 | 826 | 826 | Sequence conflict | Note=K->Q;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
Q7Z4S6 | 1260 | 1302 | 1260 | 1319 | Alternative sequence | ID=VSP_010871;Note=In isoform 3. HSDSGTSEASLSPPSSPPSRPRNELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHRSSR->QSDESDSSLSEVH;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:17974005;Dbxref=PMID:17974005 |
Q7Z4S6 | 1260 | 1302 | 1 | 1674 | Chain | ID=PRO_0000125462;Note=Kinesin-like protein KIF21A |
Lost protein functional features of individual exon skipping events in Mayo. |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q7Z4S6 | 558 | 570 | 558 | 570 | Alternative sequence | ID=VSP_010870;Note=In isoform 2%2C isoform 5 and isoform 6. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:10508479,ECO:0000303|PubMed:11214970,ECO:0000303|PubMed:14702 |
Q7Z4S6 | 558 | 570 | 1 | 1674 | Chain | ID=PRO_0000125462;Note=Kinesin-like protein KIF21A |
Q7Z4S6 | 558 | 570 | 365 | 575 | Coiled coil | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
Q7Z4S6 | 806 | 828 | 807 | 829 | Alternative sequence | ID=VSP_046790;Note=In isoform 6. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.2 |
Q7Z4S6 | 806 | 828 | 1 | 1674 | Chain | ID=PRO_0000125462;Note=Kinesin-like protein KIF21A |
Q7Z4S6 | 806 | 828 | 813 | 813 | Sequence conflict | Note=E->G;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
Q7Z4S6 | 806 | 828 | 826 | 826 | Sequence conflict | Note=K->Q;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
Q7Z4S6 | 1260 | 1302 | 1260 | 1319 | Alternative sequence | ID=VSP_010871;Note=In isoform 3. HSDSGTSEASLSPPSSPPSRPRNELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHRSSR->QSDESDSSLSEVH;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:17974005;Dbxref=PMID:17974005 |
Q7Z4S6 | 1260 | 1302 | 1 | 1674 | Chain | ID=PRO_0000125462;Note=Kinesin-like protein KIF21A |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in KIF21A |
3'-UTR exon skipping evnets lost miRNA binding. |
Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for KIF21A |
- Differential PSIs between mutated versus non-mutated samples. |
- Depth of Coverage in the skipped exon of the mutated samples. |
- Sashimi plot in the skipped exon of the mutated samples. |
- Non-synonymous mutations located in the skipped exons. |
Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
- Non-synonymous mutations located in the skipped exons in CCLE. |
Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for KIF21A |
Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
ADstage | MSBB | IFG | exon_skip_144154 | -5.445931e-01 | 2.732713e-03 | chr12 | - | 39326264 | 39326324 | 39330242 | 39330262 | 39330746 | 39330911 |
ADstage | MSBB | IFG | exon_skip_103156 | -3.968781e-01 | 3.651986e-02 | chr12 | - | 39315932 | 39315970 | 39318073 | 39318201 | 39319906 | 39320013 |
CDR | MSBB | IFG | exon_skip_144154 | -5.980426e-01 | 7.761730e-04 | chr12 | - | 39326264 | 39326324 | 39330242 | 39330262 | 39330746 | 39330911 |
CDR | MSBB | IFG | exon_skip_103156 | -4.201371e-01 | 2.601713e-02 | chr12 | - | 39315932 | 39315970 | 39318073 | 39318201 | 39319906 | 39320013 |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for KIF21A |
sQTL information located at the skipped exons. |
Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for KIF21A |
Correlated RBP and related information. |
Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
CB | TIA1 | exon_skip_221280 | 4.136695e-01 | 1.733597e-07 |
CB | PCBP4 | exon_skip_221280 | 4.430688e-01 | 1.708943e-08 |
CB | TIA1 | exon_skip_4872 | 5.329000e-01 | 1.580784e-12 |
CB | PCBP4 | exon_skip_4872 | 4.490524e-01 | 6.528121e-09 |
CB | RALYL | exon_skip_4872 | 4.936095e-01 | 1.036384e-10 |
CB | SRSF9 | exon_skip_4872 | 4.614175e-01 | 2.193184e-09 |
CB | PABPN1 | exon_skip_139882 | -4.322536e-01 | 1.273700e-08 |
CB | CNOT4 | exon_skip_139882 | -4.481256e-01 | 3.157742e-09 |
DLPFC | G3BP2 | exon_skip_103156 | 6.570889e-01 | 4.364367e-38 |
DLPFC | CPEB1 | exon_skip_103156 | 5.893081e-01 | 3.676537e-29 |
DLPFC | G3BP2 | exon_skip_221280 | 5.957926e-01 | 6.964046e-31 |
DLPFC | CPEB1 | exon_skip_221280 | 4.962946e-01 | 1.704173e-20 |
FL | G3BP2 | exon_skip_221280 | 5.337054e-01 | 1.114617e-13 |
FL | RALYL | exon_skip_221280 | 4.146061e-01 | 2.541391e-08 |
FL | G3BP2 | exon_skip_103156 | 4.951434e-01 | 2.148012e-13 |
FL | KHDRBS3 | exon_skip_103156 | 4.267776e-01 | 5.460290e-10 |
FL | RALYL | exon_skip_103156 | 4.141731e-01 | 1.933873e-09 |
FL | MSI1 | exon_skip_144154 | -4.154694e-01 | 1.544404e-09 |
HCC | SFPQ | exon_skip_221280 | -4.386434e-01 | 3.592385e-14 |
HCC | RBM6 | exon_skip_221280 | -4.766054e-01 | 8.949809e-17 |
HCC | SFPQ | exon_skip_103156 | -4.406776e-01 | 3.689325e-14 |
HCC | RBM6 | exon_skip_103156 | -5.353295e-01 | 2.828991e-21 |
HCC | TIA1 | exon_skip_103156 | -4.485743e-01 | 1.132237e-14 |
HCC | TRNAU1AP | exon_skip_103156 | -4.434806e-01 | 2.434250e-14 |
HCC | PCBP4 | exon_skip_103156 | -4.937519e-01 | 7.080478e-18 |
HCC | KHDRBS3 | exon_skip_103156 | -4.885016e-01 | 1.766631e-17 |
HCC | DAZAP1 | exon_skip_144154 | -4.227756e-01 | 3.218413e-13 |
HCC | MSI1 | exon_skip_144154 | -5.239969e-01 | 1.388599e-20 |
IFG | G3BP2 | exon_skip_221280 | 5.033004e-01 | 6.330599e-03 |
IFG | KHDRBS3 | exon_skip_221280 | 4.642891e-01 | 1.281257e-02 |
IFG | RBM24 | exon_skip_221280 | 4.041239e-01 | 3.293655e-02 |
IFG | RALYL | exon_skip_221280 | 4.708826e-01 | 1.143623e-02 |
IFG | PTBP3 | exon_skip_221280 | 4.209398e-01 | 2.570412e-02 |
IFG | IGF2BP2 | exon_skip_103156 | -5.506357e-01 | 2.394862e-03 |
IFG | PCBP4 | exon_skip_103156 | -4.425858e-01 | 1.835141e-02 |
IFG | G3BP2 | exon_skip_103156 | 5.344589e-01 | 3.391362e-03 |
IFG | KHDRBS3 | exon_skip_103156 | 5.748940e-01 | 1.374287e-03 |
IFG | RALYL | exon_skip_103156 | 4.568894e-01 | 1.451861e-02 |
IFG | MSI1 | exon_skip_144154 | -5.201056e-01 | 4.553831e-03 |
IFG | TRA2A | exon_skip_139882 | 4.040088e-01 | 3.299115e-02 |
PCC | RBM6 | exon_skip_221280 | -4.597492e-01 | 2.511281e-12 |
PCC | G3BP2 | exon_skip_221280 | 7.017288e-01 | 2.597597e-32 |
PCC | RALYL | exon_skip_221280 | 4.487070e-01 | 9.509437e-12 |
PCC | CPEB1 | exon_skip_221280 | 4.971569e-01 | 1.902168e-14 |
PCC | SFPQ | exon_skip_4872 | -4.034614e-01 | 1.994008e-09 |
PCC | RBM6 | exon_skip_4872 | -5.485372e-01 | 1.678166e-17 |
PCC | TRNAU1AP | exon_skip_4872 | -4.064499e-01 | 1.475935e-09 |
PCC | PCBP4 | exon_skip_4872 | -4.773949e-01 | 4.575148e-13 |
PCC | G3BP2 | exon_skip_4872 | 6.110068e-01 | 2.278352e-22 |
PCC | CPEB1 | exon_skip_4872 | 4.662043e-01 | 1.858087e-12 |
PG | G3BP2 | exon_skip_221280 | 5.361801e-01 | 4.586659e-13 |
PG | KHDRBS3 | exon_skip_221280 | 4.023692e-01 | 1.751980e-07 |
PG | RALYL | exon_skip_221280 | 4.611967e-01 | 1.211302e-09 |
PG | PCBP1 | exon_skip_103156 | 4.636694e-01 | 5.564538e-11 |
PG | G3BP2 | exon_skip_103156 | 5.570226e-01 | 4.647749e-16 |
PG | KHDRBS3 | exon_skip_103156 | 4.488205e-01 | 2.632282e-10 |
PG | RALYL | exon_skip_103156 | 5.127024e-01 | 1.868462e-13 |
PG | CPEB1 | exon_skip_103156 | 4.493804e-01 | 2.485829e-10 |
STG | G3BP2 | exon_skip_103156 | 4.447191e-01 | 2.529992e-05 |
STG | RALYL | exon_skip_103156 | 4.399068e-01 | 3.165621e-05 |
STG | MSI1 | exon_skip_144154 | -5.043332e-01 | 5.447802e-07 |
TC | RBM25 | exon_skip_212729 | 4.747540e-01 | 3.345381e-10 |
TC | CNOT4 | exon_skip_212729 | 5.242222e-01 | 1.839088e-12 |
TC | ILF2 | exon_skip_212729 | 6.080191e-01 | 3.041977e-17 |
TC | SRSF9 | exon_skip_212729 | 4.790934e-01 | 2.189578e-10 |
TC | RBM25 | exon_skip_113695 | 4.699463e-01 | 4.676118e-10 |
TC | CNOT4 | exon_skip_113695 | 5.217593e-01 | 2.068050e-12 |
TC | ILF2 | exon_skip_113695 | 6.121099e-01 | 1.286582e-17 |
TC | SRSF9 | exon_skip_113695 | 4.895954e-01 | 6.655621e-11 |
TC | NOVA1 | exon_skip_113695 | 6.464424e-01 | 4.580635e-20 |
TC | RBM6 | exon_skip_221280 | -4.985500e-01 | 5.447406e-11 |
TC | HNRNPK | exon_skip_221280 | 4.729811e-01 | 6.672662e-10 |
TC | G3BP2 | exon_skip_221280 | 6.780570e-01 | 6.129307e-22 |
TC | KHDRBS3 | exon_skip_221280 | 6.042839e-01 | 1.339340e-16 |
TC | RBM24 | exon_skip_221280 | 5.943128e-01 | 5.564284e-16 |
TC | RALYL | exon_skip_221280 | 6.872673e-01 | 1.022020e-22 |
TC | PTBP3 | exon_skip_221280 | 4.468618e-01 | 7.031058e-09 |
TC | CELF1 | exon_skip_221280 | 4.680181e-01 | 1.060007e-09 |
TC | CPEB1 | exon_skip_221280 | 5.535528e-01 | 1.161780e-13 |
TC | NOVA1 | exon_skip_221280 | 5.832684e-01 | 2.547137e-15 |
TC | CNOT4 | exon_skip_4872 | 5.149868e-01 | 3.784293e-12 |
TC | PCBP1 | exon_skip_4872 | 4.527840e-01 | 2.068397e-09 |
TC | HNRNPK | exon_skip_4872 | 5.275319e-01 | 9.030470e-13 |
TC | G3BP2 | exon_skip_4872 | 8.324582e-01 | 4.203210e-42 |
TC | KHDRBS3 | exon_skip_4872 | 8.116542e-01 | 1.719815e-38 |
TC | RBM24 | exon_skip_4872 | 7.814636e-01 | 5.588194e-34 |
TC | KHSRP | exon_skip_4872 | 4.460889e-01 | 3.791817e-09 |
TC | RALYL | exon_skip_4872 | 8.703564e-01 | 3.628702e-50 |
TC | PTBP3 | exon_skip_4872 | 6.095183e-01 | 1.513881e-17 |
TC | HNRNPL | exon_skip_4872 | 4.357124e-01 | 9.456142e-09 |
TC | CELF1 | exon_skip_4872 | 6.882940e-01 | 1.191824e-23 |
TC | RBM23 | exon_skip_4872 | 4.001660e-01 | 1.730918e-07 |
TC | CPEB1 | exon_skip_4872 | 6.600237e-01 | 3.005805e-21 |
TC | SRSF9 | exon_skip_4872 | 5.316150e-01 | 5.592447e-13 |
TC | SRSF5 | exon_skip_4872 | 4.392300e-01 | 6.960937e-09 |
TC | NOVA1 | exon_skip_4872 | 6.203015e-01 | 2.790325e-18 |
TC | HNRNPA0 | exon_skip_144154 | 4.771115e-01 | 1.788551e-10 |
Top |
RelatedDrugs for KIF21A |
Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for KIF21A |
Diseases associated with this gene. (DisGeNet 4.0) |
Gene | Disease ID | Disease name | # pubmeds | Source |