|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for ZCWPW1 |
 Gene summary |
| Gene information | Gene symbol | ZCWPW1 | Gene ID | 55063 |
| Gene name | zinc finger CW-type and PWWP domain containing 1 | |
| Synonyms | ZCW1 | |
| Cytomap | 7q22.1 | |
| Type of gene | protein-coding | |
| Description | zinc finger CW-type PWWP domain protein 1zinc finger CW-type and PWWP domain 1zinc finger, CW-type with PWWP domain 1 | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context | - 26958812(ZCWPW1 Is Associated With Late-Onset Alzheimer's Disease in Han Chinese: A Replication Study and Meta-Analyses) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for ZCWPW1 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000078487
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| TC | DOWN | ENST00000479315.1 | ZCWPW1-206:retained_intron:ZCWPW1 | 3.234301e+01 | -9.525824e-01 | 3.244973e-09 | 3.500906e-07 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for ZCWPW1 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_100641 | chr7 | 100419630:100419813:100420622:100420678:100425030:100425136 | 100420622:100420678 |
| exon_skip_101978 | chr7 | 100401094:100401336:100402516:100402576:100403694:100403785 | 100402516:100402576 |
| exon_skip_114172 | chr7 | 100415975:100416097:100416305:100416456:100417066:100417183 | 100416305:100416456 |
| exon_skip_155021 | chr7 | 100406694:100406798:100407228:100407303:100408539:100408659 | 100407228:100407303 |
| exon_skip_180823 | chr7 | 100401889:100402041:100402516:100402576:100403694:100403785 | 100402516:100402576 |
| exon_skip_190427 | chr7 | 100417066:100417183:100419002:100419189:100419630:100419813 | 100419002:100419189 |
| exon_skip_198101 | chr7 | 100401094:100401336:100401889:100402041:100402516:100402576 | 100401889:100402041 |
| exon_skip_198785 | chr7 | 100400855:100401336:100401889:100402041:100402516:100402576 | 100401889:100402041 |
| exon_skip_230864 | chr7 | 100417066:100417183:100419111:100419189:100419630:100419813 | 100419111:100419189 |
| exon_skip_231799 | chr7 | 100419146:100419189:100419630:100419883:100420622:100420678 | 100419630:100419883 |
| exon_skip_244847 | chr7 | 100408539:100408659:100409428:100409544:100415975:100416094 | 100409428:100409544 |
| exon_skip_264996 | chr7 | 100419146:100419189:100419630:100419813:100420622:100420678 | 100419630:100419813 |
| exon_skip_270822 | chr7 | 100416305:100416456:100417066:100417183:100419111:100419189 | 100417066:100417183 |
| exon_skip_58419 | chr7 | 100401094:100401336:100403694:100403785:100404178:100404244 | 100403694:100403785 |
| exon_skip_86673 | chr7 | 100400855:100401336:100402516:100402576:100403694:100403785 | 100402516:100402576 |
| exon_skip_94891 | chr7 | 100404178:100404244:100405013:100405093:100406694:100406798 | 100405013:100405093 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for ZCWPW1 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000398027 | 100402516 | 100402576 | Frame-shift |
| ENST00000398027 | 100407228 | 100407303 | Frame-shift |
| ENST00000398027 | 100417066 | 100417183 | Frame-shift |
| ENST00000398027 | 100419630 | 100419883 | Frame-shift |
| ENST00000398027 | 100401889 | 100402041 | In-frame |
| ENST00000398027 | 100405013 | 100405093 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000398027 | 100407228 | 100407303 | Frame-shift |
| ENST00000398027 | 100405013 | 100405093 | In-frame |
| ENST00000398027 | 100409428 | 100409544 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000398027 | 100402516 | 100402576 | Frame-shift |
| ENST00000398027 | 100407228 | 100407303 | Frame-shift |
| ENST00000398027 | 100417066 | 100417183 | Frame-shift |
| ENST00000398027 | 100419111 | 100419189 | Frame-shift |
| ENST00000398027 | 100419630 | 100419883 | Frame-shift |
| ENST00000398027 | 100401889 | 100402041 | In-frame |
| ENST00000398027 | 100405013 | 100405093 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for ZCWPW1 |
p-ENSG00000078487_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000398027 | 2373 | 648 | 100405013 | 100405093 | 1419 | 1498 | 390 | 416 |
| ENST00000398027 | 2373 | 648 | 100401889 | 100402041 | 1720 | 1871 | 490 | 541 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000398027 | 2373 | 648 | 100409428 | 100409544 | 1000 | 1115 | 250 | 289 |
| ENST00000398027 | 2373 | 648 | 100405013 | 100405093 | 1419 | 1498 | 390 | 416 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000398027 | 2373 | 648 | 100405013 | 100405093 | 1419 | 1498 | 390 | 416 |
| ENST00000398027 | 2373 | 648 | 100401889 | 100402041 | 1720 | 1871 | 490 | 541 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9H0M4 | 390 | 416 | 1 | 648 | Chain | ID=PRO_0000066567;Note=Zinc finger CW-type PWWP domain protein 1 |
| Q9H0M4 | 490 | 541 | 467 | 648 | Alternative sequence | ID=VSP_035590;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9H0M4 | 490 | 541 | 471 | 523 | Alternative sequence | ID=VSP_011436;Note=In isoform 3 and isoform 5. DPILPIRKRVKIQTQKTKPRGLGGDAGTADGRGRTLQRKIMKRSLGRKSTAPP->ALRKNLKLPRARPWQPAFQREKKLEQCQRTWAYQRVRGPAPHLRKKSPDTGNP;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9H0M4 | 490 | 541 | 491 | 541 | Alternative sequence | ID=VSP_035591;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9H0M4 | 490 | 541 | 524 | 648 | Alternative sequence | ID=VSP_035592;Note=In isoform 3 and isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9H0M4 | 490 | 541 | 1 | 648 | Chain | ID=PRO_0000066567;Note=Zinc finger CW-type PWWP domain protein 1 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9H0M4 | 250 | 289 | 289 | 289 | Alternative sequence | ID=VSP_011433;Note=In isoform 2. T->TA;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9H0M4 | 250 | 289 | 256 | 258 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2E61 |
| Q9H0M4 | 250 | 289 | 267 | 269 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2E61 |
| Q9H0M4 | 250 | 289 | 1 | 648 | Chain | ID=PRO_0000066567;Note=Zinc finger CW-type PWWP domain protein 1 |
| Q9H0M4 | 250 | 289 | 285 | 287 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2E61 |
| Q9H0M4 | 250 | 289 | 262 | 264 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2E61 |
| Q9H0M4 | 250 | 289 | 276 | 278 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2E61 |
| Q9H0M4 | 250 | 289 | 250 | 304 | Zinc finger | Note=CW-type;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00454 |
| Q9H0M4 | 390 | 416 | 1 | 648 | Chain | ID=PRO_0000066567;Note=Zinc finger CW-type PWWP domain protein 1 |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9H0M4 | 390 | 416 | 1 | 648 | Chain | ID=PRO_0000066567;Note=Zinc finger CW-type PWWP domain protein 1 |
| Q9H0M4 | 490 | 541 | 467 | 648 | Alternative sequence | ID=VSP_035590;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9H0M4 | 490 | 541 | 471 | 523 | Alternative sequence | ID=VSP_011436;Note=In isoform 3 and isoform 5. DPILPIRKRVKIQTQKTKPRGLGGDAGTADGRGRTLQRKIMKRSLGRKSTAPP->ALRKNLKLPRARPWQPAFQREKKLEQCQRTWAYQRVRGPAPHLRKKSPDTGNP;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9H0M4 | 490 | 541 | 491 | 541 | Alternative sequence | ID=VSP_035591;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9H0M4 | 490 | 541 | 524 | 648 | Alternative sequence | ID=VSP_035592;Note=In isoform 3 and isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9H0M4 | 490 | 541 | 1 | 648 | Chain | ID=PRO_0000066567;Note=Zinc finger CW-type PWWP domain protein 1 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in ZCWPW1 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for ZCWPW1 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for ZCWPW1 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for ZCWPW1 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for ZCWPW1 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for ZCWPW1 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for ZCWPW1 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|