|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for PLXNB3 |
 Gene summary |
| Gene information | Gene symbol | PLXNB3 | Gene ID | 5365 |
| Gene name | plexin B3 | |
| Synonyms | PLEXB3|PLEXR|PLXN6 | |
| Cytomap | Xq28 | |
| Type of gene | protein-coding | |
| Description | plexin-B3plexin 6 | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| PLXNB3 | GO:0007156 | homophilic cell adhesion via plasma membrane adhesion molecules | 16122393 |
| PLXNB3 | GO:0007162 | negative regulation of cell adhesion | 15218527 |
| PLXNB3 | GO:0010976 | positive regulation of neuron projection development | 16122393 |
| PLXNB3 | GO:0050918 | positive chemotaxis | 15218527 |
| PLXNB3 | GO:0060326 | cell chemotaxis | 15218527 |
| PLXNB3 | GO:0071526 | semaphorin-plexin signaling pathway | 15218527 |
Top |
Gene structures and expression levels for PLXNB3 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000198753
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| PCC | UP | ENST00000472415.1 | PLXNB3-206:lncRNA:PLXNB3 | 1.116325e+01 | 8.135449e-01 | 1.340558e-05 | 1.560699e-03 |
| STG | UP | ENST00000485980.1 | PLXNB3-208:lncRNA:PLXNB3 | 2.549503e+01 | 8.274386e-01 | 1.459269e-04 | 1.385362e-02 |
| STG | UP | ENST00000455214.1 | PLXNB3-204:protein_coding:PLXNB3 | 2.727973e+01 | 8.407768e-01 | 1.223246e-03 | 4.262126e-02 |
| PG | UP | ENST00000538966.5 | PLXNB3-209:protein_coding:PLXNB3 | 1.583556e+02 | 8.510610e-01 | 3.365115e-05 | 1.225907e-03 |
| TC | DOWN | ENST00000469190.1 | PLXNB3-205:lncRNA:PLXNB3 | 3.181624e+01 | -1.272377e+00 | 3.291008e-09 | 3.544027e-07 |
| TC | DOWN | ENST00000472415.1 | PLXNB3-206:lncRNA:PLXNB3 | 1.151759e+02 | -9.645095e-01 | 1.081972e-06 | 4.276775e-05 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for PLXNB3 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_10251 | chrX | 153775382:153775403:153775594:153775660:153775887:153775968 | 153775594:153775660 |
| exon_skip_113488 | chrX | 153771310:153771403:153771486:153771655:153771864:153772015 | 153771486:153771655 |
| exon_skip_175156 | chrX | 153765471:153765580:153766873:153767913:153768249:153768428 | 153766873:153767913 |
| exon_skip_185659 | chrX | 153770338:153770446:153770528:153770642:153770758:153770883 | 153770528:153770642 |
| exon_skip_205214 | chrX | 153771331:153771403:153771486:153771655:153771864:153772015 | 153771486:153771655 |
| exon_skip_206087 | chrX | 153765489:153765580:153766159:153766324:153766873:153767913 | 153766159:153766324 |
| exon_skip_221430 | chrX | 153772182:153772287:153772886:153773016:153773230:153773406 | 153772886:153773016 |
| exon_skip_222540 | chrX | 153768249:153768428:153768948:153769076:153769162:153769262 | 153768948:153769076 |
| exon_skip_237485 | chrX | 153775301:153775403:153775594:153775660:153775887:153775968 | 153775594:153775660 |
| exon_skip_245098 | chrX | 153773230:153773406:153773518:153773713:153773859:153774098 | 153773518:153773713 |
| exon_skip_279974 | chrX | 153765489:153765580:153766873:153767913:153768249:153768428 | 153766873:153767913 |
| exon_skip_286004 | chrX | 153770338:153770446:153770528:153770642:153770758:153770769 | 153770528:153770642 |
| exon_skip_55614 | chrX | 153774186:153774344:153774420:153774571:153774706:153774806 | 153774420:153774571 |
| exon_skip_62149 | chrX | 153770965:153771081:153771310:153771403:153771486:153771655 | 153771310:153771403 |
| exon_skip_84427 | chrX | 153765471:153765580:153766159:153766324:153766873:153767913 | 153766159:153766324 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
 |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
| exon_skip_279974 | Mayo_TC | 5.160976e-01 | 6.756579e-01 | -1.595603e-01 | 3.957849e-06 |
Top |
Open reading frame (ORF) annotation in the exon skipping event for PLXNB3 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000361971 | 153770528 | 153770642 | Frame-shift |
| ENST00000361971 | 153771310 | 153771403 | Frame-shift |
| ENST00000361971 | 153771486 | 153771655 | Frame-shift |
| ENST00000361971 | 153772886 | 153773016 | Frame-shift |
| ENST00000361971 | 153773518 | 153773713 | Frame-shift |
| ENST00000361971 | 153775594 | 153775660 | Frame-shift |
| ENST00000361971 | 153766873 | 153767913 | In-frame |
| ENST00000361971 | 153768948 | 153769076 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000361971 | 153770528 | 153770642 | Frame-shift |
| ENST00000361971 | 153771310 | 153771403 | Frame-shift |
| ENST00000361971 | 153771486 | 153771655 | Frame-shift |
| ENST00000361971 | 153775594 | 153775660 | Frame-shift |
| ENST00000361971 | 153766873 | 153767913 | In-frame |
| ENST00000361971 | 153768948 | 153769076 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000361971 | 153770528 | 153770642 | Frame-shift |
| ENST00000361971 | 153771310 | 153771403 | Frame-shift |
| ENST00000361971 | 153771486 | 153771655 | Frame-shift |
| ENST00000361971 | 153772886 | 153773016 | Frame-shift |
| ENST00000361971 | 153773518 | 153773713 | Frame-shift |
| ENST00000361971 | 153774420 | 153774571 | Frame-shift |
| ENST00000361971 | 153775594 | 153775660 | Frame-shift |
| ENST00000361971 | 153766873 | 153767913 | In-frame |
| ENST00000361971 | 153768948 | 153769076 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for PLXNB3 |
p-ENSG00000198753_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000361971 | 6163 | 1909 | 153766873 | 153767913 | 161 | 1200 | 15 | 362 |
| ENST00000361971 | 6163 | 1909 | 153768948 | 153769076 | 1382 | 1509 | 422 | 465 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000361971 | 6163 | 1909 | 153766873 | 153767913 | 161 | 1200 | 15 | 362 |
| ENST00000361971 | 6163 | 1909 | 153768948 | 153769076 | 1382 | 1509 | 422 | 465 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000361971 | 6163 | 1909 | 153766873 | 153767913 | 161 | 1200 | 15 | 362 |
| ENST00000361971 | 6163 | 1909 | 153768948 | 153769076 | 1382 | 1509 | 422 | 465 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9ULL4 | 15 | 362 | 1 | 15 | Alternative sequence | ID=VSP_044467;Note=In isoform 2. MCHAAQETPLLHHFM->MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPK;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9ULL4 | 15 | 362 | 45 | 1909 | Chain | ID=PRO_0000024674;Note=Plexin-B3 |
| Q9ULL4 | 15 | 362 | 98 | 107 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 132 | 140 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 267 | 370 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 283 | 315 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 333 | 357 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 45 | 471 | Domain | Note=Sema;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 51 | 51 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 15 | 362 | 231 | 231 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 15 | 362 | 126 | 126 | Natural variant | ID=VAR_050601;Note=A->T;Dbxref=dbSNP:rs34360382 |
| Q9ULL4 | 15 | 362 | 149 | 149 | Sequence conflict | Note=A->V;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9ULL4 | 15 | 362 | 300 | 300 | Sequence conflict | Note=L->P;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9ULL4 | 15 | 362 | 1 | 44 | Signal peptide | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 15 | 362 | 45 | 1255 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 422 | 465 | 45 | 1909 | Chain | ID=PRO_0000024674;Note=Plexin-B3 |
| Q9ULL4 | 422 | 465 | 45 | 471 | Domain | Note=Sema;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 422 | 465 | 45 | 1255 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9ULL4 | 15 | 362 | 1 | 15 | Alternative sequence | ID=VSP_044467;Note=In isoform 2. MCHAAQETPLLHHFM->MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPK;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9ULL4 | 15 | 362 | 45 | 1909 | Chain | ID=PRO_0000024674;Note=Plexin-B3 |
| Q9ULL4 | 15 | 362 | 98 | 107 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 132 | 140 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 267 | 370 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 283 | 315 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 333 | 357 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 45 | 471 | Domain | Note=Sema;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 51 | 51 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 15 | 362 | 231 | 231 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 15 | 362 | 126 | 126 | Natural variant | ID=VAR_050601;Note=A->T;Dbxref=dbSNP:rs34360382 |
| Q9ULL4 | 15 | 362 | 149 | 149 | Sequence conflict | Note=A->V;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9ULL4 | 15 | 362 | 300 | 300 | Sequence conflict | Note=L->P;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9ULL4 | 15 | 362 | 1 | 44 | Signal peptide | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 15 | 362 | 45 | 1255 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 422 | 465 | 45 | 1909 | Chain | ID=PRO_0000024674;Note=Plexin-B3 |
| Q9ULL4 | 422 | 465 | 45 | 471 | Domain | Note=Sema;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 422 | 465 | 45 | 1255 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9ULL4 | 15 | 362 | 1 | 15 | Alternative sequence | ID=VSP_044467;Note=In isoform 2. MCHAAQETPLLHHFM->MELTPASSLTCSLLSPRLPGSFPQLRRVPPCSRPWLPK;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9ULL4 | 15 | 362 | 45 | 1909 | Chain | ID=PRO_0000024674;Note=Plexin-B3 |
| Q9ULL4 | 15 | 362 | 98 | 107 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 132 | 140 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 267 | 370 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 283 | 315 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 333 | 357 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 45 | 471 | Domain | Note=Sema;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 15 | 362 | 51 | 51 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 15 | 362 | 231 | 231 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 15 | 362 | 126 | 126 | Natural variant | ID=VAR_050601;Note=A->T;Dbxref=dbSNP:rs34360382 |
| Q9ULL4 | 15 | 362 | 149 | 149 | Sequence conflict | Note=A->V;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9ULL4 | 15 | 362 | 300 | 300 | Sequence conflict | Note=L->P;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9ULL4 | 15 | 362 | 1 | 44 | Signal peptide | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 15 | 362 | 45 | 1255 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9ULL4 | 422 | 465 | 45 | 1909 | Chain | ID=PRO_0000024674;Note=Plexin-B3 |
| Q9ULL4 | 422 | 465 | 45 | 471 | Domain | Note=Sema;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00352 |
| Q9ULL4 | 422 | 465 | 45 | 1255 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in PLXNB3 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for PLXNB3 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for PLXNB3 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for PLXNB3 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for PLXNB3 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
| CB | SAMD4A | exon_skip_279974 | -4.429448e-01 | 7.862116e-09 |
| CB | PCBP4 | exon_skip_279974 | 4.307460e-01 | 2.210923e-08 |
| CB | RBM45 | exon_skip_279974 | 5.713502e-01 | 8.262536e-15 |
| CB | NUP42 | exon_skip_279974 | 4.923942e-01 | 7.639894e-11 |
| CB | RBM4 | exon_skip_279974 | -5.570922e-01 | 5.151736e-14 |
| CB | CNOT4 | exon_skip_221430 | -5.051861e-01 | 1.294341e-11 |
| CB | PCBP1 | exon_skip_221430 | -4.944104e-01 | 4.049275e-11 |
| CB | PCBP4 | exon_skip_221430 | 4.734556e-01 | 3.331020e-10 |
| CB | HNRNPA2B1 | exon_skip_221430 | -4.978848e-01 | 2.815483e-11 |
| CB | RBM45 | exon_skip_221430 | 4.751272e-01 | 2.830220e-10 |
| CB | HNRNPL | exon_skip_221430 | -4.218373e-01 | 3.387215e-08 |
| CB | HNRNPF | exon_skip_221430 | -4.397793e-01 | 7.408718e-09 |
| HCC | SAMD4A | exon_skip_279974 | -5.046217e-01 | 5.210909e-18 |
| TC | RBM4 | exon_skip_94708 | -4.872053e-01 | 1.186022e-09 |
| TC | RBM4B | exon_skip_94708 | -4.334684e-01 | 9.810013e-08 |
| TC | SAMD4A | exon_skip_279974 | -5.418013e-01 | 1.962802e-13 |
| TC | RBM4 | exon_skip_279974 | -4.703104e-01 | 4.515214e-10 |
Top |
RelatedDrugs for PLXNB3 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for PLXNB3 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|