ExonSkipAD: functional annotation of exon skipping event in human

Gene summary for PLXNB1

Gene summary

Gene information	Gene symbol	PLXNB1
	Gene ID	5364
	Gene name	plexin B1
	Synonyms	PLEXIN-B1\|PLXN5\|SEP
	Cytomap	3p21.31
	Type of gene	protein-coding
	Description	plexin-B1plexin 5semaphorin receptor SEP
	Modification date	20200313
	UniProtAcc	A0A0B6XK48, A1A4U0, O43157,
	Context	- 29908079(Targeted Brain Proteomics Uncover Multiple Pathways to Alzheimer's Dementia)

Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Gene	GO ID	GO term	PubMed ID
PLXNB1	GO:0007162	negative regulation of cell adhesion	15218527
PLXNB1	GO:0008360	regulation of cell shape	19843518
PLXNB1	GO:0051493	regulation of cytoskeleton organization	19843518
PLXNB1	GO:0071526	semaphorin-plexin signaling pathway	15218527\|19843518

Top

Gene structures and expression levels for PLXNB1

Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

ENSG00000164050

Differentially expressed gene analysis across multiple brain tissues between AD and control.

Tissue type

DEG direction

Base mean exp.

log2FC(AD/control)

P-value

Adj. p-value

Differentially expressed isoform analysis across multiple brain tissues between AD and control.

Tissue type	DEG direction	ENST	Transcript info.	Base mean exp.	log2FC(AD/control)	P-value	Adjc. p-value
PCC	UP	ENST00000485535.5	PLXNB1-218:retained_intron:PLXNB1	4.160613e+02	9.438088e-01	1.409141e-04	7.510184e-03
STG	UP	ENST00000296440.11	PLXNB1-201:protein_coding:PLXNB1	6.615441e+02	1.496380e+00	5.671553e-07	3.496107e-04
PG	UP	ENST00000483753.1	PLXNB1-216:retained_intron:PLXNB1	6.697849e+00	9.370105e-01	6.686611e-07	6.478792e-05

Landscape of isoform expressions across multiple brain tissues between AD and control.

Top

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for PLXNB1

Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap).

All exon skipping events in AD cohorts.

Exon skip ID	chr	Exons involved in exon skipping	Skipped exon
exon_skip_121602	chr3	48418917:48419039:48419244:48419366:48419577:48419674	48419244:48419366
exon_skip_1342	chr3	48409571:48409731:48409905:48410077:48410296:48410365	48409905:48410077
exon_skip_180446	chr3	48404509:48404590:48405724:48405798:48406823:48406898	48405724:48405798
exon_skip_184404	chr3	48418449:48418542:48418917:48419039:48419244:48419366	48418917:48419039
exon_skip_207137	chr3	48419244:48419366:48419577:48420257:48420665:48420773	48419577:48420257
exon_skip_210735	chr3	48419605:48419674:48420224:48420257:48420665:48420752	48420224:48420257
exon_skip_218004	chr3	48416031:48416167:48416346:48416451:48417911:48418062	48416346:48416451
exon_skip_234633	chr3	48417911:48418062:48418191:48418363:48418449:48418537	48418191:48418363
exon_skip_248220	chr3	48410015:48410077:48410296:48410380:48410455:48410493	48410296:48410380
exon_skip_248896	chr3	48411863:48412009:48412238:48412304:48412442:48412620	48412238:48412304
exon_skip_25687	chr3	48424568:48424617:48425281:48425333:48429253:48429463	48425281:48425333
exon_skip_259219	chr3	48418449:48418542:48418917:48419039:48419244:48419362	48418917:48419039
exon_skip_271886	chr3	48422123:48422205:48422331:48422459:48422765:48422947	48422331:48422459
exon_skip_286339	chr3	48419244:48419366:48419577:48419674:48420665:48420773	48419577:48419674
exon_skip_38145	chr3	48415212:48415347:48415583:48415759:48416031:48416167	48415583:48415759
exon_skip_50609	chr3	48420848:48420956:48421228:48421384:48421674:48421800	48421228:48421384
exon_skip_62376	chr3	48422105:48422205:48422331:48422459:48422765:48422947	48422331:48422459
exon_skip_73004	chr3	48423505:48424617:48425281:48425333:48429253:48429463	48425281:48425333
exon_skip_77806	chr3	48419577:48419674:48420665:48420773:48420848:48420956	48420665:48420773
exon_skip_86484	chr3	48407027:48407091:48409329:48409476:48409571:48409719	48409329:48409476
exon_skip_89506	chr3	48413069:48413169:48413670:48413818:48413895:48414006	48413670:48413818
exon_skip_93711	chr3	48417911:48418062:48418191:48418363:48418449:48418542	48418191:48418363
exon_skip_9985	chr3	48419577:48419674:48420224:48420257:48420665:48420773	48420224:48420257

Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control.

Exon skipping information

Tissue type

Avg(PSIs) in AD

Avg(PSIs) in control

Difference (PSI)

Adj. p-value

Top

Open reading frame (ORF) annotation in the exon skipping event for PLXNB1

Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000358536	48425281	48425333	3UTR-3UTR
ENST00000296440	48409329	48409476	Frame-shift
ENST00000358536	48409329	48409476	Frame-shift
ENST00000296440	48409905	48410077	Frame-shift
ENST00000358536	48409905	48410077	Frame-shift
ENST00000296440	48413670	48413818	Frame-shift
ENST00000358536	48413670	48413818	Frame-shift
ENST00000296440	48416346	48416451	Frame-shift
ENST00000358536	48416346	48416451	Frame-shift
ENST00000296440	48418191	48418363	Frame-shift
ENST00000358536	48418191	48418363	Frame-shift
ENST00000296440	48415583	48415759	In-frame
ENST00000358536	48415583	48415759	In-frame
ENST00000296440	48418917	48419039	In-frame
ENST00000358536	48418917	48419039	In-frame
ENST00000296440	48422331	48422459	In-frame
ENST00000358536	48422331	48422459	In-frame

Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000358536	48425281	48425333	3UTR-3UTR
ENST00000296440	48409905	48410077	Frame-shift
ENST00000358536	48409905	48410077	Frame-shift
ENST00000296440	48413670	48413818	Frame-shift
ENST00000358536	48413670	48413818	Frame-shift
ENST00000296440	48415583	48415759	In-frame
ENST00000358536	48415583	48415759	In-frame
ENST00000296440	48418917	48419039	In-frame
ENST00000358536	48418917	48419039	In-frame

Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000358536	48425281	48425333	3UTR-3UTR
ENST00000296440	48409329	48409476	Frame-shift
ENST00000358536	48409329	48409476	Frame-shift
ENST00000296440	48409905	48410077	Frame-shift
ENST00000358536	48409905	48410077	Frame-shift
ENST00000296440	48410296	48410380	Frame-shift
ENST00000358536	48410296	48410380	Frame-shift
ENST00000296440	48412238	48412304	Frame-shift
ENST00000358536	48412238	48412304	Frame-shift
ENST00000296440	48413670	48413818	Frame-shift
ENST00000358536	48413670	48413818	Frame-shift
ENST00000296440	48416346	48416451	Frame-shift
ENST00000358536	48416346	48416451	Frame-shift
ENST00000296440	48418191	48418363	Frame-shift
ENST00000358536	48418191	48418363	Frame-shift
ENST00000296440	48421228	48421384	Frame-shift
ENST00000358536	48421228	48421384	Frame-shift
ENST00000296440	48405724	48405798	In-frame
ENST00000358536	48405724	48405798	In-frame
ENST00000296440	48415583	48415759	In-frame
ENST00000358536	48415583	48415759	In-frame
ENST00000296440	48418917	48419039	In-frame
ENST00000358536	48418917	48419039	In-frame
ENST00000296440	48419244	48419366	In-frame
ENST00000358536	48419244	48419366	In-frame
ENST00000296440	48419577	48420257	In-frame
ENST00000358536	48419577	48420257	In-frame
ENST00000296440	48422331	48422459	In-frame
ENST00000358536	48422331	48422459	In-frame

Top

Infer the effects of exon skipping event on protein functional features for PLXNB1

p-ENSG00000164050_img4.png
boxplot

Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000296440	7160	2135	48422331	48422459	1394	1521	430	472
ENST00000358536	7325	2135	48422331	48422459	1561	1688	430	472
ENST00000296440	7160	2135	48418917	48419039	2936	3057	944	984
ENST00000358536	7325	2135	48418917	48419039	3103	3224	944	984
ENST00000296440	7160	2135	48415583	48415759	3721	3896	1206	1264
ENST00000358536	7325	2135	48415583	48415759	3888	4063	1206	1264

Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000296440	7160	2135	48418917	48419039	2936	3057	944	984
ENST00000358536	7325	2135	48418917	48419039	3103	3224	944	984
ENST00000296440	7160	2135	48415583	48415759	3721	3896	1206	1264
ENST00000358536	7325	2135	48415583	48415759	3888	4063	1206	1264

Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000296440	7160	2135	48422331	48422459	1394	1521	430	472
ENST00000358536	7325	2135	48422331	48422459	1561	1688	430	472
ENST00000296440	7160	2135	48419577	48420257	2132	2811	676	902
ENST00000358536	7325	2135	48419577	48420257	2299	2978	676	902
ENST00000296440	7160	2135	48419244	48419366	2813	2934	903	943
ENST00000358536	7325	2135	48419244	48419366	2980	3101	903	943
ENST00000296440	7160	2135	48418917	48419039	2936	3057	944	984
ENST00000358536	7325	2135	48418917	48419039	3103	3224	944	984
ENST00000296440	7160	2135	48415583	48415759	3721	3896	1206	1264
ENST00000358536	7325	2135	48415583	48415759	3888	4063	1206	1264
ENST00000296440	7160	2135	48405724	48405798	6332	6405	2076	2100
ENST00000358536	7325	2135	48405724	48405798	6499	6572	2076	2100

Lost protein functional features of individual exon skipping events in ROSMAP.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
O43157	430	472	426	432	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	426	432	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	434	436	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3OL2
O43157	430	472	434	436	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3OL2
O43157	430	472	442	448	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	442	448	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	463	469	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	463	469	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	430	472	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	430	472	20	479	Domain	Note=Sema;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00352
O43157	430	472	20	479	Domain	Note=Sema;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00352
O43157	430	472	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	430	472	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	944	984	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	944	984	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	944	984	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	944	984	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	944	984	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	944	984	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	1206	1264	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	1206	1264	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	1206	1264	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	1206	1264	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	1206	1264	1162	1249	Domain	Note=IPT/TIG 2
O43157	1206	1264	1162	1249	Domain	Note=IPT/TIG 2
O43157	1206	1264	1252	1375	Domain	Note=IPT/TIG 3
O43157	1206	1264	1252	1375	Domain	Note=IPT/TIG 3
O43157	1206	1264	1253	1253	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269,ECO:0000269,ECO:0000269;evidence=ECO:0000269\|PubMed:16335952,ECO:0000269\|PubMed:19159218,ECO:0000269\|PubMed:19349973;Dbxref=PMID:16335952,PMID:19159218,PMID:19349973
O43157	1206	1264	1253	1253	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269,ECO:0000269,ECO:0000269;evidence=ECO:0000269\|PubMed:16335952,ECO:0000269\|PubMed:19159218,ECO:0000269\|PubMed:19349973;Dbxref=PMID:16335952,PMID:19159218,PMID:19349973
O43157	1206	1264	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	1206	1264	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255

Lost protein functional features of individual exon skipping events in MSBB.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
O43157	944	984	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	944	984	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	944	984	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	944	984	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	944	984	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	944	984	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	1206	1264	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	1206	1264	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	1206	1264	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	1206	1264	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	1206	1264	1162	1249	Domain	Note=IPT/TIG 2
O43157	1206	1264	1162	1249	Domain	Note=IPT/TIG 2
O43157	1206	1264	1252	1375	Domain	Note=IPT/TIG 3
O43157	1206	1264	1252	1375	Domain	Note=IPT/TIG 3
O43157	1206	1264	1253	1253	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269,ECO:0000269,ECO:0000269;evidence=ECO:0000269\|PubMed:16335952,ECO:0000269\|PubMed:19159218,ECO:0000269\|PubMed:19349973;Dbxref=PMID:16335952,PMID:19159218,PMID:19349973
O43157	1206	1264	1253	1253	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269,ECO:0000269,ECO:0000269;evidence=ECO:0000269\|PubMed:16335952,ECO:0000269\|PubMed:19159218,ECO:0000269\|PubMed:19349973;Dbxref=PMID:16335952,PMID:19159218,PMID:19349973
O43157	1206	1264	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	1206	1264	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255

Lost protein functional features of individual exon skipping events in Mayo.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
O43157	430	472	426	432	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	426	432	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	434	436	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3OL2
O43157	430	472	434	436	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3OL2
O43157	430	472	442	448	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	442	448	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	463	469	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	463	469	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5B4W
O43157	430	472	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	430	472	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	430	472	20	479	Domain	Note=Sema;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00352
O43157	430	472	20	479	Domain	Note=Sema;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00352
O43157	430	472	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	430	472	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	676	902	677	729	Alternative sequence	ID=VSP_011513;Note=In isoform 3. SPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTATASDISPGAS->VMETQQSLRALPPPSSSRPASTTSMTPPGSGSWKRRPWGQAPAPVWRAFRAPR;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	676	902	677	729	Alternative sequence	ID=VSP_011513;Note=In isoform 3. SPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTATASDISPGAS->VMETQQSLRALPPPSSSRPASTTSMTPPGSGSWKRRPWGQAPAPVWRAFRAPR;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	676	902	688	870	Alternative sequence	ID=VSP_011514;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	676	902	688	870	Alternative sequence	ID=VSP_011514;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	676	902	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	676	902	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	676	902	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	676	902	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	676	902	678	829	Compositional bias	Note=Pro-rich
O43157	676	902	678	829	Compositional bias	Note=Pro-rich
O43157	676	902	753	753	Natural variant	ID=VAR_050599;Note=S->L;Dbxref=dbSNP:rs35592743
O43157	676	902	753	753	Natural variant	ID=VAR_050599;Note=S->L;Dbxref=dbSNP:rs35592743
O43157	676	902	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	676	902	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	903	943	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	903	943	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	903	943	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	903	943	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	903	943	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	903	943	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	944	984	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	944	984	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	944	984	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	944	984	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	944	984	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	944	984	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	1206	1264	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	1206	1264	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	1206	1264	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	1206	1264	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	1206	1264	1162	1249	Domain	Note=IPT/TIG 2
O43157	1206	1264	1162	1249	Domain	Note=IPT/TIG 2
O43157	1206	1264	1252	1375	Domain	Note=IPT/TIG 3
O43157	1206	1264	1252	1375	Domain	Note=IPT/TIG 3
O43157	1206	1264	1253	1253	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269,ECO:0000269,ECO:0000269;evidence=ECO:0000269\|PubMed:16335952,ECO:0000269\|PubMed:19159218,ECO:0000269\|PubMed:19349973;Dbxref=PMID:16335952,PMID:19159218,PMID:19349973
O43157	1206	1264	1253	1253	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269,ECO:0000269,ECO:0000269;evidence=ECO:0000269\|PubMed:16335952,ECO:0000269\|PubMed:19159218,ECO:0000269\|PubMed:19349973;Dbxref=PMID:16335952,PMID:19159218,PMID:19349973
O43157	1206	1264	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	1206	1264	20	1490	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	2076	2100	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	2076	2100	730	2135	Alternative sequence	ID=VSP_011515;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10520995;Dbxref=PMID:10520995
O43157	2076	2100	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	2076	2100	20	2135	Chain	ID=PRO_0000024671;Note=Plexin-B1
O43157	2076	2100	2064	2076	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3HM6
O43157	2076	2100	2064	2076	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3HM6
O43157	2076	2100	2084	2097	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3HM6
O43157	2076	2100	2084	2097	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3HM6
O43157	2076	2100	2099	2107	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3HM6
O43157	2076	2100	2099	2107	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3HM6
O43157	2076	2100	1512	2135	Topological domain	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255
O43157	2076	2100	1512	2135	Topological domain	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255

Top

3'-UTR located exon skipping events that lost miRNA binding sites in PLXNB1

3'-UTR exon skipping evnets lost miRNA binding.

Tissue type

ENST

Exon skip start

Exon skip end

microRNA

Binding site by TargetScan

Binding type by TargetScan

Bdinding site by miRanda

Score of miRanda

Energy by miRanda

Top

SNVs in the skipped exons for PLXNB1

- Differential PSIs between mutated versus non-mutated samples.

- Depth of Coverage in the skipped exon of the mutated samples.

- Sashimi plot in the skipped exon of the mutated samples.

- Non-synonymous mutations located in the skipped exons.

Cancer type

Sample

ESID

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

- Non-synonymous mutations located in the skipped exons in CCLE.

Sample

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

Top

AD stage-associated exon skippint events for PLXNB1

Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR).

AD stage info

Cohort

Tissue

SE id

Coefficient

P-value

Chromosome

Strand

E1 start

E1 end

Skipped start

Skipped end

E2 start

E2 end

Top

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for PLXNB1

sQTL information located at the skipped exons.

Tissue type

Exon skip ID

SNP id

Location

P-value

FDR

Top

Correlation with RNA binding proteins (RBPs) for PLXNB1

Correlated RBP and related information.

Tissue type

RBP name

Exon skip ID

Correlation coeifficient

P-value

Top

RelatedDrugs for PLXNB1

Approved drugs targeting this gene.
(DrugBank Version 5.1.0 2018-04-02)

UniProtAcc

DrugBank ID

Drug name

Drug activity

Drug type

Drug status

Top

RelatedDiseases for PLXNB1

Diseases associated with this gene.
(DisGeNet 4.0)

Gene

Disease ID

Disease name

# pubmeds

Source

	Gene summary
	Gene structures and expression levels
	Exon skipping events with PSIs in RPSMAP, MSBB, and Mayo
	Open reading frame (ORF) annotation in the exon skipping event
	Exon skipping events in the canonical protein sequence
	3'-UTR located exon skipping events lost miRNA binding sites
	SNVs in the skipped exons with depth of coverage
	AD stage-associated exon skipping events
	Splicing Quantitative Trait Loci (sQTLs) in the skipped exons
	Correlation with RNA binding proteins (RBPs)
	Related drugs with this gene
	Related diseases with this gene

Home

Download

Statistics

Landscape

Help

Contact

Gene summary for PLXNB1

Gene structures and expression levels for PLXNB1

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for PLXNB1

Open reading frame (ORF) annotation in the exon skipping event for PLXNB1

Infer the effects of exon skipping event on protein functional features for PLXNB1

3'-UTR located exon skipping events that lost miRNA binding sites in PLXNB1

SNVs in the skipped exons for PLXNB1

AD stage-associated exon skippint events for PLXNB1

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for PLXNB1

Correlation with RNA binding proteins (RBPs) for PLXNB1

RelatedDrugs for PLXNB1

RelatedDiseases for PLXNB1