ExonSkipAD: functional annotation of exon skipping event in human

Gene summary for PLAT

Gene summary

Gene information	Gene symbol	PLAT
	Gene ID	5327
	Gene name	plasminogen activator, tissue type
	Synonyms	T-PA\|TPA
	Cytomap	8p11.21
	Type of gene	protein-coding
	Description	tissue-type plasminogen activatoralteplaseplasminogen/activator kringlereteplaset-plasminogen activator
	Modification date	20200313
	UniProtAcc	B4DN26, B4DNJ1, B8ZX62, E5RGA1, E5RHG4, E7ESF4, H0YBH9, P00750,
	Context

Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Gene	GO ID	GO term	PubMed ID
PLAT	GO:0031639	plasminogen activation	12694198\|17849409\|24196407
PLAT	GO:0045861	negative regulation of proteolysis	1695900

Top

Gene structures and expression levels for PLAT

Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

ENSG00000104368

Differentially expressed gene analysis across multiple brain tissues between AD and control.

Tissue type

DEG direction

Base mean exp.

log2FC(AD/control)

P-value

Adj. p-value

Differentially expressed isoform analysis across multiple brain tissues between AD and control.

Tissue type	DEG direction	ENST	Transcript info.	Base mean exp.	log2FC(AD/control)	P-value	Adjc. p-value
CB	UP	ENST00000429710.6	PLAT-204:protein_coding:PLAT	3.735261e+00	1.418146e+00	1.485240e-02	4.788426e-02

Landscape of isoform expressions across multiple brain tissues between AD and control.

Top

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for PLAT

Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap).

All exon skipping events in AD cohorts.

Exon skip ID	chr	Exons involved in exon skipping	Skipped exon
exon_skip_195009	chr8	42193114:42193211:42206647:42206698:42207494:42207565	42206647:42206698
exon_skip_195452	chr8	42187906:42188016:42188934:42189071:42191372:42191414	42188934:42189071
exon_skip_5258	chr8	42182719:42182890:42185081:42185172:42187398:42187572	42185081:42185172

Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control.

Exon skipping information

Tissue type

Avg(PSIs) in AD

Avg(PSIs) in control

Difference (PSI)

Adj. p-value

Top

Open reading frame (ORF) annotation in the exon skipping event for PLAT

Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000429089	42206647	42206698	3UTR-3UTR
ENST00000220809	42185081	42185172	Frame-shift
ENST00000429089	42185081	42185172	Frame-shift
ENST00000220809	42188934	42189071	In-frame
ENST00000429089	42188934	42189071	In-frame

Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000220809	42188934	42189071	In-frame
ENST00000429089	42188934	42189071	In-frame

Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000429089	42206647	42206698	3UTR-3UTR
ENST00000220809	42185081	42185172	Frame-shift
ENST00000429089	42185081	42185172	Frame-shift
ENST00000220809	42188934	42189071	In-frame
ENST00000429089	42188934	42189071	In-frame

Top

Infer the effects of exon skipping event on protein functional features for PLAT

p-ENSG00000104368_img4.png
boxplot

Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000220809	2723	562	42188934	42189071	373	509	38	84
ENST00000429089	2616	562	42188934	42189071	266	402	38	84

Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000220809	2723	562	42188934	42189071	373	509	38	84
ENST00000429089	2616	562	42188934	42189071	266	402	38	84

Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000220809	2723	562	42188934	42189071	373	509	38	84
ENST00000429089	2616	562	42188934	42189071	266	402	38	84

Lost protein functional features of individual exon skipping events in ROSMAP.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
P00750	38	84	1	40	Alternative sequence	ID=VSP_028029;Note=In isoform 4. MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVI->MAS;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	1	40	Alternative sequence	ID=VSP_028029;Note=In isoform 4. MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVI->MAS;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	39	85	Alternative sequence	ID=VSP_015957;Note=In isoform 3. VICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS->G;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334
P00750	38	84	39	85	Alternative sequence	ID=VSP_015957;Note=In isoform 3. VICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS->G;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334
P00750	38	84	79	208	Alternative sequence	ID=VSP_028030;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	79	208	Alternative sequence	ID=VSP_028030;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	41	43	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	41	43	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	44	46	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	44	46	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	48	50	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	48	50	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	55	59	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	55	59	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	61	64	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	61	64	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	66	70	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	66	70	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	72	74	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	72	74	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	77	81	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	77	81	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	83	85	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	83	85	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	36	562	Chain	ID=PRO_0000028350;Note=Tissue-type plasminogen activator
P00750	38	84	36	562	Chain	ID=PRO_0000028350;Note=Tissue-type plasminogen activator
P00750	38	84	36	310	Chain	ID=PRO_0000028351;Note=Tissue-type plasminogen activator chain A
P00750	38	84	36	310	Chain	ID=PRO_0000028351;Note=Tissue-type plasminogen activator chain A
P00750	38	84	41	71	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	41	71	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	69	78	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	69	78	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	39	81	Domain	Note=Fibronectin type-I;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00478
P00750	38	84	39	81	Domain	Note=Fibronectin type-I;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00478
P00750	38	84	82	120	Domain	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076
P00750	38	84	82	120	Domain	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076
P00750	38	84	42	52	Region	Note=Important for binding to annexin A2
P00750	38	84	42	52	Region	Note=Important for binding to annexin A2

Lost protein functional features of individual exon skipping events in MSBB.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
P00750	38	84	1	40	Alternative sequence	ID=VSP_028029;Note=In isoform 4. MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVI->MAS;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	1	40	Alternative sequence	ID=VSP_028029;Note=In isoform 4. MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVI->MAS;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	39	85	Alternative sequence	ID=VSP_015957;Note=In isoform 3. VICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS->G;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334
P00750	38	84	39	85	Alternative sequence	ID=VSP_015957;Note=In isoform 3. VICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS->G;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334
P00750	38	84	79	208	Alternative sequence	ID=VSP_028030;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	79	208	Alternative sequence	ID=VSP_028030;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	41	43	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	41	43	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	44	46	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	44	46	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	48	50	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	48	50	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	55	59	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	55	59	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	61	64	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	61	64	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	66	70	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	66	70	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	72	74	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	72	74	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	77	81	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	77	81	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	83	85	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	83	85	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	36	562	Chain	ID=PRO_0000028350;Note=Tissue-type plasminogen activator
P00750	38	84	36	562	Chain	ID=PRO_0000028350;Note=Tissue-type plasminogen activator
P00750	38	84	36	310	Chain	ID=PRO_0000028351;Note=Tissue-type plasminogen activator chain A
P00750	38	84	36	310	Chain	ID=PRO_0000028351;Note=Tissue-type plasminogen activator chain A
P00750	38	84	41	71	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	41	71	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	69	78	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	69	78	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	39	81	Domain	Note=Fibronectin type-I;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00478
P00750	38	84	39	81	Domain	Note=Fibronectin type-I;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00478
P00750	38	84	82	120	Domain	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076
P00750	38	84	82	120	Domain	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076
P00750	38	84	42	52	Region	Note=Important for binding to annexin A2
P00750	38	84	42	52	Region	Note=Important for binding to annexin A2

Lost protein functional features of individual exon skipping events in Mayo.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
P00750	38	84	1	40	Alternative sequence	ID=VSP_028029;Note=In isoform 4. MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVI->MAS;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	1	40	Alternative sequence	ID=VSP_028029;Note=In isoform 4. MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVI->MAS;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	39	85	Alternative sequence	ID=VSP_015957;Note=In isoform 3. VICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS->G;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334
P00750	38	84	39	85	Alternative sequence	ID=VSP_015957;Note=In isoform 3. VICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS->G;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334
P00750	38	84	79	208	Alternative sequence	ID=VSP_028030;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	79	208	Alternative sequence	ID=VSP_028030;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.8
P00750	38	84	41	43	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	41	43	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	44	46	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	44	46	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	48	50	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	48	50	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	55	59	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	55	59	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	61	64	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	61	64	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	66	70	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	66	70	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	72	74	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	72	74	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	77	81	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	77	81	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPM
P00750	38	84	83	85	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	83	85	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1TPG
P00750	38	84	36	562	Chain	ID=PRO_0000028350;Note=Tissue-type plasminogen activator
P00750	38	84	36	562	Chain	ID=PRO_0000028350;Note=Tissue-type plasminogen activator
P00750	38	84	36	310	Chain	ID=PRO_0000028351;Note=Tissue-type plasminogen activator chain A
P00750	38	84	36	310	Chain	ID=PRO_0000028351;Note=Tissue-type plasminogen activator chain A
P00750	38	84	41	71	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	41	71	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	69	78	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	69	78	Disulfide bond	Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:1645336;Dbxref=PMID:1645336
P00750	38	84	39	81	Domain	Note=Fibronectin type-I;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00478
P00750	38	84	39	81	Domain	Note=Fibronectin type-I;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00478
P00750	38	84	82	120	Domain	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076
P00750	38	84	82	120	Domain	Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00076
P00750	38	84	42	52	Region	Note=Important for binding to annexin A2
P00750	38	84	42	52	Region	Note=Important for binding to annexin A2

Top

3'-UTR located exon skipping events that lost miRNA binding sites in PLAT

3'-UTR exon skipping evnets lost miRNA binding.

Tissue type

ENST

Exon skip start

Exon skip end

microRNA

Binding site by TargetScan

Binding type by TargetScan

Bdinding site by miRanda

Score of miRanda

Energy by miRanda

Top

SNVs in the skipped exons for PLAT

- Differential PSIs between mutated versus non-mutated samples.

- Depth of Coverage in the skipped exon of the mutated samples.

- Sashimi plot in the skipped exon of the mutated samples.

- Non-synonymous mutations located in the skipped exons.

Cancer type

Sample

ESID

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

- Non-synonymous mutations located in the skipped exons in CCLE.

Sample

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

Top

AD stage-associated exon skippint events for PLAT

Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR).

AD stage info

Cohort

Tissue

SE id

Coefficient

P-value

Chromosome

Strand

E1 start

E1 end

Skipped start

Skipped end

E2 start

E2 end

Top

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for PLAT

sQTL information located at the skipped exons.

Tissue type

Exon skip ID

SNP id

Location

P-value

FDR

Top

Correlation with RNA binding proteins (RBPs) for PLAT

Correlated RBP and related information.

Tissue type

RBP name

Exon skip ID

Correlation coeifficient

P-value

Top

RelatedDrugs for PLAT

Approved drugs targeting this gene.
(DrugBank Version 5.1.0 2018-04-02)

UniProtAcc	DrugBank ID	Drug name	Drug activity	Drug type	Drug status
P00750	approved\|investigational\|withdrawn	DB00013	Urokinase	biotech	P00750
P00750	approved\|investigational	DB00513	Aminocaproic Acid	small molecule	P00750
P00750	approved\|investigational	DB01088	Iloprost	small molecule	P00750
P00750	approved	DB06404	Human C1-esterase inhibitor	biotech	P00750
P00750	approved\|investigational	DB09213	Dexibuprofen	small molecule	P00750
P00750	approved\|investigational	DB09228	Conestat alfa	biotech	P00750

Top

RelatedDiseases for PLAT

Diseases associated with this gene.
(DisGeNet 4.0)

Gene

Disease ID

Disease name

# pubmeds

Source

	Gene summary
	Gene structures and expression levels
	Exon skipping events with PSIs in RPSMAP, MSBB, and Mayo
	Open reading frame (ORF) annotation in the exon skipping event
	Exon skipping events in the canonical protein sequence
	3'-UTR located exon skipping events lost miRNA binding sites
	SNVs in the skipped exons with depth of coverage
	AD stage-associated exon skipping events
	Splicing Quantitative Trait Loci (sQTLs) in the skipped exons
	Correlation with RNA binding proteins (RBPs)
	Related drugs with this gene
	Related diseases with this gene

Home

Download

Statistics

Landscape

Help

Contact

Gene summary for PLAT

Gene structures and expression levels for PLAT

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for PLAT

Open reading frame (ORF) annotation in the exon skipping event for PLAT

Infer the effects of exon skipping event on protein functional features for PLAT

3'-UTR located exon skipping events that lost miRNA binding sites in PLAT

SNVs in the skipped exons for PLAT

AD stage-associated exon skippint events for PLAT

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for PLAT

Correlation with RNA binding proteins (RBPs) for PLAT

RelatedDrugs for PLAT

RelatedDiseases for PLAT