|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for VIT |
 Gene summary |
| Gene information | Gene symbol | VIT | Gene ID | 5212 |
| Gene name | vitrin | |
| Synonyms | VIT1 | |
| Cytomap | 2p22.2 | |
| Type of gene | protein-coding | |
| Description | vitrin | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for VIT |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000205221
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| CB | DOWN | ENST00000379241.7 | VIT-201:protein_coding:VIT | 1.450935e+01 | -1.727471e+00 | 1.888097e-04 | 1.267221e-03 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for VIT |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_133295 | chr2 | 36696877:36696973:36716353:36716422:36729426:36729491 | 36716353:36716422 |
| exon_skip_163761 | chr2 | 36773791:36773847:36775002:36775067:36783340:36783402 | 36775002:36775067 |
| exon_skip_165193 | chr2 | 36775002:36775067:36783340:36783402:36787129:36787276 | 36783340:36783402 |
| exon_skip_250052 | chr2 | 36758969:36759046:36767094:36767285:36773791:36773847 | 36767094:36767285 |
| exon_skip_278473 | chr2 | 36775002:36775067:36781727:36781771:36783340:36783402 | 36781727:36781771 |
| exon_skip_282023 | chr2 | 36805438:36805664:36808472:36808985:36814183:36814433 | 36808472:36808985 |
| exon_skip_99971 | chr2 | 36773812:36773847:36775002:36775067:36783340:36783402 | 36775002:36775067 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for VIT |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000389975 | 36808472 | 36808985 | Frame-shift |
| ENST00000389975 | 36775002 | 36775067 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000389975 | 36716353 | 36716422 | 5CDS-5UTR |
| ENST00000389975 | 36767094 | 36767285 | In-frame |
| ENST00000389975 | 36775002 | 36775067 | In-frame |
| ENST00000389975 | 36783340 | 36783402 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for VIT |
p-ENSG00000205221_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000389975 | 2787 | 678 | 36775002 | 36775067 | 1040 | 1104 | 246 | 267 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000389975 | 2787 | 678 | 36767094 | 36767285 | 791 | 981 | 163 | 226 |
| ENST00000389975 | 2787 | 678 | 36775002 | 36775067 | 1040 | 1104 | 246 | 267 |
| ENST00000389975 | 2787 | 678 | 36783340 | 36783402 | 1106 | 1167 | 268 | 288 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q6UXI7 | 246 | 267 | 204 | 678 | Alternative sequence | ID=VSP_020210;Note=In isoform 3. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
| Q6UXI7 | 246 | 267 | 247 | 268 | Alternative sequence | ID=VSP_020211;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:12975309;Dbxref=PMID:12975309 |
| Q6UXI7 | 246 | 267 | 267 | 267 | Alternative sequence | ID=VSP_040124;Note=In isoform 4. L->LGEMDSWKPGSVLLDE;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q6UXI7 | 246 | 267 | 27 | 678 | Chain | ID=PRO_0000248210;Note=Vitrin |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q6UXI7 | 163 | 226 | 164 | 203 | Alternative sequence | ID=VSP_020209;Note=In isoform 3. ETTKAYQRPPIPGTTAQPVTLMQLLAVTVAVATPTTLPRP->KCSRVIESKPSESMNTRRVLGDSGEINILTGQAPLALAIF;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
| Q6UXI7 | 163 | 226 | 204 | 678 | Alternative sequence | ID=VSP_020210;Note=In isoform 3. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
| Q6UXI7 | 163 | 226 | 27 | 678 | Chain | ID=PRO_0000248210;Note=Vitrin |
| Q6UXI7 | 246 | 267 | 204 | 678 | Alternative sequence | ID=VSP_020210;Note=In isoform 3. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
| Q6UXI7 | 246 | 267 | 247 | 268 | Alternative sequence | ID=VSP_020211;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:12975309;Dbxref=PMID:12975309 |
| Q6UXI7 | 246 | 267 | 267 | 267 | Alternative sequence | ID=VSP_040124;Note=In isoform 4. L->LGEMDSWKPGSVLLDE;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q6UXI7 | 246 | 267 | 27 | 678 | Chain | ID=PRO_0000248210;Note=Vitrin |
| Q6UXI7 | 268 | 288 | 204 | 678 | Alternative sequence | ID=VSP_020210;Note=In isoform 3. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
| Q6UXI7 | 268 | 288 | 247 | 268 | Alternative sequence | ID=VSP_020211;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:12975309;Dbxref=PMID:12975309 |
| Q6UXI7 | 268 | 288 | 268 | 289 | Alternative sequence | ID=VSP_044597;Note=In isoform 5. GLVPKEELSTQSLEPVSLGDPN->D;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q6UXI7 | 268 | 288 | 27 | 678 | Chain | ID=PRO_0000248210;Note=Vitrin |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in VIT |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for VIT |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for VIT |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for VIT |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for VIT |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for VIT |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for VIT |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|