|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for ACP1 |
 Gene summary |
| Gene information | Gene symbol | ACP1 | Gene ID | 52 |
| Gene name | acid phosphatase 1 | |
| Synonyms | HAAP|LMW-PTP|LMWPTP | |
| Cytomap | 2p25.3 | |
| Type of gene | protein-coding | |
| Description | low molecular weight phosphotyrosine protein phosphataseLMW-PTPaseacid phosphatase 1, solubleacid phosphatase of erythrocyteadipocyte acid phosphatasecytoplasmic phosphotyrosyl protein phosphataselow molecular weight cytosolic acid phosphataseprote | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context | - 31816601(Identification of Molecular Correlations of RBM8A With Autophagy in Alzheimer's Disease) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for ACP1 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000143727
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| CB | UP | ENST00000413140.5 | ACP1-206:nonsense_mediated_decay:ACP1 | 2.023480e+01 | 1.064187e+00 | 3.761150e-07 | 6.526971e-06 |
| TC | UP | ENST00000483636.5 | AADACP1-204:lncRNA:AADACP1 | 1.686355e+00 | 1.641002e+00 | 9.034585e-06 | 2.387630e-04 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for ACP1 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_11027 | chr2 | 264919:265007:269301:269347:271866:271939 | 269301:269347 |
| exon_skip_110433 | chr2 | 271866:271939:272037:272065:272192:272305 | 272037:272065 |
| exon_skip_118597 | chr2 | 271893:271939:272037:272150:276980:277085 | 272037:272150 |
| exon_skip_125042 | chr2 | 272037:272150:275140:275201:276980:277085 | 275140:275201 |
| exon_skip_143556 | chr2 | 275153:275201:276980:277085:277227:277261 | 276980:277085 |
| exon_skip_155509 | chr2 | 275140:275201:276980:277085:277227:277261 | 276980:277085 |
| exon_skip_163939 | chr2 | 272037:272150:276980:277085:277227:277261 | 276980:277085 |
| exon_skip_165691 | chr2 | 272192:272305:275140:275201:276980:277085 | 275140:275201 |
| exon_skip_184958 | chr2 | 271866:271939:272037:272150:276980:277085 | 272037:272150 |
| exon_skip_232325 | chr2 | 271866:271939:272192:272305:275140:275200 | 272192:272305 |
| exon_skip_232832 | chr2 | 271893:271939:272037:272150:275140:275200 | 272037:272150 |
| exon_skip_260483 | chr2 | 271866:271939:272037:272150:275140:275200 | 272037:272150 |
| exon_skip_272523 | chr2 | 271893:271939:272192:272305:275140:275200 | 272192:272305 |
| exon_skip_274059 | chr2 | 271893:271939:272037:272065:272192:272305 | 272037:272065 |
| exon_skip_38877 | chr2 | 272037:272150:275140:275201:276980:277035 | 275140:275201 |
| exon_skip_58987 | chr2 | 264965:265007:269301:269347:271866:271939 | 269301:269347 |
| exon_skip_62723 | chr2 | 271918:271939:272037:272065:272192:272305 | 272037:272065 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for ACP1 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000272065 | 275140 | 275201 | Frame-shift |
| ENST00000272065 | 276980 | 277085 | Frame-shift |
| ENST00000272065 | 272037 | 272150 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000272065 | 275140 | 275201 | Frame-shift |
| ENST00000272065 | 272037 | 272150 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000272065 | 275140 | 275201 | Frame-shift |
| ENST00000272065 | 276980 | 277085 | Frame-shift |
| ENST00000272065 | 272037 | 272150 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for ACP1 |
p-ENSG00000143727_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000272065 | 1566 | 158 | 272037 | 272150 | 212 | 324 | 39 | 77 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000272065 | 1566 | 158 | 272037 | 272150 | 212 | 324 | 39 | 77 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000272065 | 1566 | 158 | 272037 | 272150 | 212 | 324 | 39 | 77 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P24666 | 39 | 77 | 41 | 74 | Alternative sequence | ID=VSP_010087;Note=In isoform 2. RVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHV->VIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHK;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:1304913,ECO:0000303|PubMed:14702039,ECO:0000303|P |
| P24666 | 39 | 77 | 41 | 74 | Alternative sequence | ID=VSP_010088;Note=In isoform 3. Missing;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P24666 | 39 | 77 | 40 | 49 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| P24666 | 39 | 77 | 2 | 158 | Chain | ID=PRO_0000046558;Note=Low molecular weight phosphotyrosine protein phosphatase |
| P24666 | 39 | 77 | 37 | 39 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| P24666 | 39 | 77 | 58 | 66 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| P24666 | 39 | 77 | 50 | 53 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P24666 | 39 | 77 | 41 | 74 | Alternative sequence | ID=VSP_010087;Note=In isoform 2. RVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHV->VIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHK;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:1304913,ECO:0000303|PubMed:14702039,ECO:0000303|P |
| P24666 | 39 | 77 | 41 | 74 | Alternative sequence | ID=VSP_010088;Note=In isoform 3. Missing;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P24666 | 39 | 77 | 40 | 49 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| P24666 | 39 | 77 | 2 | 158 | Chain | ID=PRO_0000046558;Note=Low molecular weight phosphotyrosine protein phosphatase |
| P24666 | 39 | 77 | 37 | 39 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| P24666 | 39 | 77 | 58 | 66 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| P24666 | 39 | 77 | 50 | 53 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P24666 | 39 | 77 | 41 | 74 | Alternative sequence | ID=VSP_010087;Note=In isoform 2. RVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHV->VIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHK;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:1304913,ECO:0000303|PubMed:14702039,ECO:0000303|P |
| P24666 | 39 | 77 | 41 | 74 | Alternative sequence | ID=VSP_010088;Note=In isoform 3. Missing;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P24666 | 39 | 77 | 40 | 49 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| P24666 | 39 | 77 | 2 | 158 | Chain | ID=PRO_0000046558;Note=Low molecular weight phosphotyrosine protein phosphatase |
| P24666 | 39 | 77 | 37 | 39 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| P24666 | 39 | 77 | 58 | 66 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
| P24666 | 39 | 77 | 50 | 53 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5JNT |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in ACP1 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for ACP1 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for ACP1 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for ACP1 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
| HCC | exon_skip_110433 | rs11692330 | chr2:210076 | 4.512438e-05 | 4.617227e-03 |
| HCC | exon_skip_110433 | rs10205435 | chr2:230442 | 8.508503e-05 | 7.955226e-03 |
| HCC | exon_skip_110433 | rs1474052 | chr2:224192 | 1.246492e-04 | 1.103820e-02 |
| HCC | exon_skip_110433 | rs9808365 | chr2:232343 | 1.246492e-04 | 1.103820e-02 |
| HCC | exon_skip_110433 | rs3748872 | chr2:234130 | 1.246492e-04 | 1.103820e-02 |
| HCC | exon_skip_110433 | rs2085852 | chr2:240630 | 1.246492e-04 | 1.103820e-02 |
| HCC | exon_skip_110433 | rs4255987 | chr2:259296 | 1.313663e-04 | 1.150698e-02 |
| HCC | exon_skip_110433 | rs10188763 | chr2:260677 | 1.313663e-04 | 1.150698e-02 |
| HCC | exon_skip_110433 | rs11127466 | chr2:278752 | 1.313663e-04 | 1.150698e-02 |
| HCC | exon_skip_110433 | rs1474053 | chr2:224086 | 2.089361e-04 | 1.681614e-02 |
| HCC | exon_skip_110433 | rs7558758 | chr2:172101 | 3.605588e-04 | 2.613703e-02 |
| HCC | exon_skip_110433 | rs7609512 | chr2:251673 | 7.814295e-04 | 4.818673e-02 |
| DLPFC | exon_skip_274059 | rs4255987 | chr2:259296 | 6.476785e-06 | 7.656770e-04 |
| DLPFC | exon_skip_274059 | rs10188763 | chr2:260677 | 6.476785e-06 | 7.656770e-04 |
| DLPFC | exon_skip_274059 | rs11127466 | chr2:278752 | 6.476785e-06 | 7.656770e-04 |
| DLPFC | exon_skip_274059 | rs1474052 | chr2:224192 | 6.566466e-06 | 7.729966e-04 |
| DLPFC | exon_skip_274059 | rs9808365 | chr2:232343 | 6.566466e-06 | 7.729966e-04 |
| DLPFC | exon_skip_274059 | rs3748872 | chr2:234130 | 6.566466e-06 | 7.729966e-04 |
| DLPFC | exon_skip_274059 | rs2085852 | chr2:240630 | 6.566466e-06 | 7.729966e-04 |
| DLPFC | exon_skip_274059 | rs11692330 | chr2:210076 | 7.503376e-06 | 8.698032e-04 |
| DLPFC | exon_skip_274059 | rs4854302 | chr2:305803 | 2.260200e-04 | 1.702980e-02 |
| DLPFC | exon_skip_274059 | rs17713729 | chr2:249092 | 2.381166e-04 | 1.782865e-02 |
| DLPFC | exon_skip_274059 | rs7605824 | chr2:280819 | 2.381166e-04 | 1.782865e-02 |
| DLPFC | exon_skip_274059 | rs3791220 | chr2:227066 | 2.435050e-04 | 1.812647e-02 |
| DLPFC | exon_skip_274059 | rs17713396 | chr2:227201 | 2.435050e-04 | 1.812647e-02 |
| DLPFC | exon_skip_274059 | rs6721594 | chr2:305203 | 4.968711e-04 | 3.212933e-02 |
| DLPFC | exon_skip_274059 | rs6548222 | chr2:296812 | 5.999667e-04 | 3.733988e-02 |
Top |
Correlation with RNA binding proteins (RBPs) for ACP1 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
| CB | TRA2A | exon_skip_125042 | -4.911210e-01 | 5.690809e-11 |
| CB | FUBP1 | exon_skip_125042 | -4.278656e-01 | 2.052696e-08 |
| CB | NUP42 | exon_skip_125042 | 4.601874e-01 | 1.177278e-09 |
| IFG | HNRNPF | exon_skip_110433 | 4.997712e-01 | 7.945848e-03 |
Top |
RelatedDrugs for ACP1 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for ACP1 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|