ExonSkipAD: functional annotation of exon skipping event in human

Gene summary for TBC1D7

Gene summary

Gene information	Gene symbol	TBC1D7
	Gene ID	51256
	Gene name	TBC1 domain family member 7
	Synonyms	MGCPH\|PIG51\|TBC7
	Cytomap	6p24.1
	Type of gene	protein-coding
	Description	TBC1 domain family member 7TS complex subunit 3cell migration-inducing protein 23
	Modification date	20200313
	UniProtAcc	A0A024QZX0, A0A024R011, B4DK47, Q5SZL3, Q5SZL4, Q5SZL5, Q5SZL6, Q5SZL8, Q5SZM1, Q5SZM2, Q9P0N9, U3KPS8, U3KPY5, U3KQ23, U3KQD8, U3KQQ0,
	Context

Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Gene	GO ID	GO term	PubMed ID
TBC1D7	GO:0031398	positive regulation of protein ubiquitination	17658474
TBC1D7	GO:0043547	positive regulation of GTPase activity	17646400

Top

Gene structures and expression levels for TBC1D7

Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

ENSG00000145979

Differentially expressed gene analysis across multiple brain tissues between AD and control.

Tissue type

DEG direction

Base mean exp.

log2FC(AD/control)

P-value

Adj. p-value

Differentially expressed isoform analysis across multiple brain tissues between AD and control.

Tissue type	DEG direction	ENST	Transcript info.	Base mean exp.	log2FC(AD/control)	P-value	Adjc. p-value
TC	DOWN	ENST00000343141.8	TBC1D7-201:protein_coding:TBC1D7	5.894751e+00	-9.144462e-01	3.156633e-03	2.371198e-02
TC	UP	ENST00000446018.5	TBC1D7-211:protein_coding:TBC1D7	1.942360e+00	1.325504e+00	5.665850e-03	3.677466e-02

Landscape of isoform expressions across multiple brain tissues between AD and control.

Top

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for TBC1D7

Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap).

All exon skipping events in AD cohorts.

Exon skip ID

chr

Exons involved in exon skipping

Skipped exon

Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control.

Exon skipping information	Tissue type	Avg(PSIs) in AD	Avg(PSIs) in control	Difference (PSI)	Adj. p-value
exon_skip_265175	Mayo_CB	4.937805e-01	6.208000e-01	-1.270195e-01	1.280867e-06

Top

Open reading frame (ORF) annotation in the exon skipping event for TBC1D7

Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000356436	13307600	13307745	Frame-shift
ENST00000379300	13307600	13307745	Frame-shift
ENST00000356436	13316571	13316708	In-frame
ENST00000379300	13316571	13316708	In-frame
ENST00000356436	13325094	13325174	In-frame
ENST00000379300	13325094	13325174	In-frame

Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000356436	13316571	13316708	In-frame
ENST00000379300	13316571	13316708	In-frame
ENST00000356436	13325094	13325174	In-frame
ENST00000379300	13325094	13325174	In-frame

Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000356436	13307600	13307745	Frame-shift
ENST00000379300	13307600	13307745	Frame-shift
ENST00000356436	13316571	13316708	In-frame
ENST00000379300	13316571	13316708	In-frame
ENST00000356436	13325094	13325174	In-frame
ENST00000379300	13325094	13325174	In-frame

Top

Infer the effects of exon skipping event on protein functional features for TBC1D7

p-ENSG00000145979_img4.png
boxplot

Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000356436	1133	293	13325094	13325174	197	276	37	64
ENST00000379300	1293	293	13325094	13325174	357	436	37	64
ENST00000356436	1133	293	13316571	13316708	466	602	127	172
ENST00000379300	1293	293	13316571	13316708	626	762	127	172

Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000356436	1133	293	13325094	13325174	197	276	37	64
ENST00000379300	1293	293	13325094	13325174	357	436	37	64
ENST00000356436	1133	293	13316571	13316708	466	602	127	172
ENST00000379300	1293	293	13316571	13316708	626	762	127	172

Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000356436	1133	293	13325094	13325174	197	276	37	64
ENST00000379300	1293	293	13325094	13325174	357	436	37	64
ENST00000356436	1133	293	13316571	13316708	466	602	127	172
ENST00000379300	1293	293	13316571	13316708	626	762	127	172

Lost protein functional features of individual exon skipping events in ROSMAP.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q9P0N9	37	64	1	73	Alternative sequence	ID=VSP_044186;Note=In isoform 3. MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVWKVLLGILPPHHES->MEGASRNLASTPRV;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q9P0N9	37	64	1	73	Alternative sequence	ID=VSP_044186;Note=In isoform 3. MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVWKVLLGILPPHHES->MEGASRNLASTPRV;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q9P0N9	37	64	38	64	Alternative sequence	ID=VSP_041480;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.2
Q9P0N9	37	64	38	64	Alternative sequence	ID=VSP_041480;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.2
Q9P0N9	37	64	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	37	64	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	37	64	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	37	64	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	37	64	39	48	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	39	48	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	53	63	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	53	63	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	59	59	Sequence conflict	Note=V->I;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q9P0N9	37	64	59	59	Sequence conflict	Note=V->I;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q9P0N9	127	172	127	172	Alternative sequence	ID=VSP_044892;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.5
Q9P0N9	127	172	127	172	Alternative sequence	ID=VSP_044892;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.5
Q9P0N9	127	172	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	127	172	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	127	172	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	127	172	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	127	172	129	144	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	129	144	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	148	163	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	148	163	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	170	172	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	170	172	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	136	136	Natural variant	ID=VAR_052538;Note=A->T;Dbxref=dbSNP:rs9381921
Q9P0N9	127	172	136	136	Natural variant	ID=VAR_052538;Note=A->T;Dbxref=dbSNP:rs9381921
Q9P0N9	127	172	164	169	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	164	169	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL

Lost protein functional features of individual exon skipping events in MSBB.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q9P0N9	37	64	1	73	Alternative sequence	ID=VSP_044186;Note=In isoform 3. MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVWKVLLGILPPHHES->MEGASRNLASTPRV;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q9P0N9	37	64	1	73	Alternative sequence	ID=VSP_044186;Note=In isoform 3. MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVWKVLLGILPPHHES->MEGASRNLASTPRV;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q9P0N9	37	64	38	64	Alternative sequence	ID=VSP_041480;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.2
Q9P0N9	37	64	38	64	Alternative sequence	ID=VSP_041480;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.2
Q9P0N9	37	64	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	37	64	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	37	64	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	37	64	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	37	64	39	48	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	39	48	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	53	63	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	53	63	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	59	59	Sequence conflict	Note=V->I;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q9P0N9	37	64	59	59	Sequence conflict	Note=V->I;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q9P0N9	127	172	127	172	Alternative sequence	ID=VSP_044892;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.5
Q9P0N9	127	172	127	172	Alternative sequence	ID=VSP_044892;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.5
Q9P0N9	127	172	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	127	172	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	127	172	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	127	172	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	127	172	129	144	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	129	144	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	148	163	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	148	163	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	170	172	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	170	172	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	136	136	Natural variant	ID=VAR_052538;Note=A->T;Dbxref=dbSNP:rs9381921
Q9P0N9	127	172	136	136	Natural variant	ID=VAR_052538;Note=A->T;Dbxref=dbSNP:rs9381921
Q9P0N9	127	172	164	169	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	164	169	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL

Lost protein functional features of individual exon skipping events in Mayo.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q9P0N9	37	64	1	73	Alternative sequence	ID=VSP_044186;Note=In isoform 3. MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVWKVLLGILPPHHES->MEGASRNLASTPRV;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q9P0N9	37	64	1	73	Alternative sequence	ID=VSP_044186;Note=In isoform 3. MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVWKVLLGILPPHHES->MEGASRNLASTPRV;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q9P0N9	37	64	38	64	Alternative sequence	ID=VSP_041480;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.2
Q9P0N9	37	64	38	64	Alternative sequence	ID=VSP_041480;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.2
Q9P0N9	37	64	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	37	64	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	37	64	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	37	64	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	37	64	39	48	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	39	48	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	53	63	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	53	63	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	37	64	59	59	Sequence conflict	Note=V->I;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q9P0N9	37	64	59	59	Sequence conflict	Note=V->I;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q9P0N9	127	172	127	172	Alternative sequence	ID=VSP_044892;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.5
Q9P0N9	127	172	127	172	Alternative sequence	ID=VSP_044892;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.5
Q9P0N9	127	172	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	127	172	1	293	Chain	ID=PRO_0000208031;Note=TBC1 domain family member 7
Q9P0N9	127	172	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	127	172	50	231	Domain	Note=Rab-GAP TBC;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00163
Q9P0N9	127	172	129	144	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	129	144	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	148	163	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	148	163	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	170	172	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	170	172	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	136	136	Natural variant	ID=VAR_052538;Note=A->T;Dbxref=dbSNP:rs9381921
Q9P0N9	127	172	136	136	Natural variant	ID=VAR_052538;Note=A->T;Dbxref=dbSNP:rs9381921
Q9P0N9	127	172	164	169	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL
Q9P0N9	127	172	164	169	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:3QWL

Top

3'-UTR located exon skipping events that lost miRNA binding sites in TBC1D7

3'-UTR exon skipping evnets lost miRNA binding.

Tissue type

ENST

Exon skip start

Exon skip end

microRNA

Binding site by TargetScan

Binding type by TargetScan

Bdinding site by miRanda

Score of miRanda

Energy by miRanda

Top

SNVs in the skipped exons for TBC1D7

- Differential PSIs between mutated versus non-mutated samples.

- Depth of Coverage in the skipped exon of the mutated samples.

- Sashimi plot in the skipped exon of the mutated samples.

- Non-synonymous mutations located in the skipped exons.

Cancer type

Sample

ESID

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

- Non-synonymous mutations located in the skipped exons in CCLE.

Sample

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

Top

AD stage-associated exon skippint events for TBC1D7

Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR).

AD stage info

Cohort

Tissue

SE id

Coefficient

P-value

Chromosome

Strand

E1 start

E1 end

Skipped start

Skipped end

E2 start

E2 end

Top

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for TBC1D7

sQTL information located at the skipped exons.

Tissue type

Exon skip ID

SNP id

Location

P-value

FDR

Top

Correlation with RNA binding proteins (RBPs) for TBC1D7

Correlated RBP and related information.

Tissue type	RBP name	Exon skip ID	Correlation coeifficient	P-value
CB	RBM6	exon_skip_265175	-5.033251e-01	1.834919e-11
CB	RBM3	exon_skip_265175	4.833460e-01	1.436954e-10
CB	PCBP4	exon_skip_265175	4.379513e-01	9.690184e-09
DLPFC	RBM3	exon_skip_265175	4.024042e-01	2.312511e-12
HCC	RBM3	exon_skip_265175	4.257903e-01	4.737713e-13
IFG	TIA1	exon_skip_265175	-4.730705e-01	3.514915e-02
IFG	RALYL	exon_skip_265175	-4.497183e-01	4.665027e-02
PCC	RBM3	exon_skip_265175	4.768706e-01	1.399746e-12
TC	RBM3	exon_skip_265175	4.975838e-01	4.494405e-11

Top

RelatedDrugs for TBC1D7

Approved drugs targeting this gene.
(DrugBank Version 5.1.0 2018-04-02)

UniProtAcc

DrugBank ID

Drug name

Drug activity

Drug type

Drug status

Top

RelatedDiseases for TBC1D7

Diseases associated with this gene.
(DisGeNet 4.0)

Gene

Disease ID

Disease name

# pubmeds

Source

	Gene summary
	Gene structures and expression levels
	Exon skipping events with PSIs in RPSMAP, MSBB, and Mayo
	Open reading frame (ORF) annotation in the exon skipping event
	Exon skipping events in the canonical protein sequence
	3'-UTR located exon skipping events lost miRNA binding sites
	SNVs in the skipped exons with depth of coverage
	AD stage-associated exon skipping events
	Splicing Quantitative Trait Loci (sQTLs) in the skipped exons
	Correlation with RNA binding proteins (RBPs)
	Related drugs with this gene
	Related diseases with this gene

Home

Download

Statistics

Landscape

Help

Contact

Gene summary for TBC1D7

Gene structures and expression levels for TBC1D7

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for TBC1D7

Open reading frame (ORF) annotation in the exon skipping event for TBC1D7

Infer the effects of exon skipping event on protein functional features for TBC1D7

3'-UTR located exon skipping events that lost miRNA binding sites in TBC1D7

SNVs in the skipped exons for TBC1D7

AD stage-associated exon skippint events for TBC1D7

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for TBC1D7

Correlation with RNA binding proteins (RBPs) for TBC1D7

RelatedDrugs for TBC1D7

RelatedDiseases for TBC1D7