|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for ATP1B3 |
 Gene summary |
| Gene information | Gene symbol | ATP1B3 | Gene ID | 483 |
| Gene name | ATPase Na+/K+ transporting subunit beta 3 | |
| Synonyms | ATPB-3|CD298 | |
| Cytomap | 3q23 | |
| Type of gene | protein-coding | |
| Description | sodium/potassium-transporting ATPase subunit beta-3ATPase, Na+/K+ transporting, beta 3 polypeptideNa, K-ATPase beta-3 polypeptidesodium pump subunit beta-3sodium-potassium ATPase subunit beta 3 (non-catalytic)sodium/potassium-dependent ATPase subunit | |
| Modification date | 20200313 | |
| UniProtAcc | C9J6S2, | |
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| ATP1B3 | GO:0006883 | cellular sodium ion homeostasis | 10636900|19542013 |
| ATP1B3 | GO:0030007 | cellular potassium ion homeostasis | 10636900|19542013 |
| ATP1B3 | GO:0032781 | positive regulation of ATPase activity | 10636900 |
| ATP1B3 | GO:0036376 | sodium ion export across plasma membrane | 10636900|19542013 |
| ATP1B3 | GO:0050821 | protein stabilization | 10636900 |
| ATP1B3 | GO:0072659 | protein localization to plasma membrane | 18522992 |
| ATP1B3 | GO:0086009 | membrane repolarization | 19542013 |
| ATP1B3 | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity | 10636900 |
| ATP1B3 | GO:1903278 | positive regulation of sodium ion export across plasma membrane | 10636900 |
| ATP1B3 | GO:1903288 | positive regulation of potassium ion import | 10636900 |
| ATP1B3 | GO:1990573 | potassium ion import across plasma membrane | 10636900|19542013 |
Top |
Gene structures and expression levels for ATP1B3 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000069849
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| CB | UP | ENST00000286371.8 | ATP1B3-201:protein_coding:ATP1B3 | 1.969778e+03 | 9.776133e-01 | 1.925100e-19 | 7.249435e-16 |
| CB | UP | ENST00000482635.1 | ATP1B3-206:retained_intron:ATP1B3 | 3.976600e+01 | 9.489664e-01 | 1.034269e-13 | 2.351344e-11 |
| CB | UP | ENST00000475483.5 | ATP1B3-205:protein_coding:ATP1B3 | 3.210583e+01 | 9.045343e-01 | 5.002135e-08 | 1.179945e-06 |
| CB | UP | ENST00000495216.1 | ATP1B3-210:protein_coding:ATP1B3 | 7.166959e+00 | 1.744661e+00 | 1.275675e-03 | 6.335411e-03 |
| TC | UP | ENST00000286371.8 | ATP1B3-201:protein_coding:ATP1B3 | 1.286975e+03 | 8.454596e-01 | 2.104574e-22 | 7.824237e-19 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for ATP1B3 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_121738 | chr3 | 141915970:141916020:141916555:141916574:141921977:141921992 | 141916555:141916574 |
| exon_skip_122281 | chr3 | 141915970:141916020:141916555:141916574:141921977:141922009 | 141916555:141916574 |
| exon_skip_158829 | chr3 | 141907167:141907274:141913652:141913836:141915970:141916010 | 141913652:141913836 |
| exon_skip_222521 | chr3 | 141916555:141916574:141921977:141922063:141925531:141925643 | 141921977:141922063 |
| exon_skip_245907 | chr3 | 141913800:141913836:141915970:141916020:141921977:141922063 | 141915970:141916020 |
| exon_skip_250167 | chr3 | 141913652:141913836:141915970:141916020:141921977:141922063 | 141915970:141916020 |
| exon_skip_254 | chr3 | 141877529:141877562:141902136:141902227:141903620:141903748 | 141902136:141902227 |
| exon_skip_267373 | chr3 | 141876855:141876910:141902136:141902227:141903620:141903748 | 141902136:141902227 |
| exon_skip_269284 | chr3 | 141916376:141916440:141916555:141916574:141921977:141922063 | 141916555:141916574 |
| exon_skip_272170 | chr3 | 141915970:141916020:141916555:141916574:141921977:141922063 | 141916555:141916574 |
| exon_skip_54543 | chr3 | 141876855:141876910:141903620:141903748:141907167:141907274 | 141903620:141903748 |
| exon_skip_62090 | chr3 | 141915970:141916020:141921977:141922063:141925531:141925643 | 141921977:141922063 |
| exon_skip_72209 | chr3 | 141876855:141876910:141902136:141902227:141903620:141903630 | 141902136:141902227 |
| exon_skip_80111 | chr3 | 141903728:141903748:141907167:141907274:141913652:141913706 | 141907167:141907274 |
| exon_skip_88539 | chr3 | 141915970:141916020:141916376:141916440:141916555:141916574 | 141916376:141916440 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
 |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
| exon_skip_267373 | ROSMAP_DLPFC | 2.704630e-01 | 3.762393e-01 | -1.057764e-01 | 1.281569e-04 |
| exon_skip_267373 | ROSMAP_PCC | 3.204615e-01 | 4.467059e-01 | -1.262443e-01 | 3.947184e-05 |
| exon_skip_72209 | Mayo_TC | 1.692683e-01 | 2.825641e-01 | -1.132958e-01 | 8.442541e-05 |
Top |
Open reading frame (ORF) annotation in the exon skipping event for ATP1B3 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000286371 | 141913652 | 141913836 | Frame-shift |
| ENST00000286371 | 141903620 | 141903748 | In-frame |
| ENST00000286371 | 141907167 | 141907274 | In-frame |
| ENST00000286371 | 141915970 | 141916020 | In-frame |
| ENST00000286371 | 141921977 | 141922063 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000286371 | 141921977 | 141922063 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000286371 | 141913652 | 141913836 | Frame-shift |
| ENST00000286371 | 141903620 | 141903748 | In-frame |
| ENST00000286371 | 141907167 | 141907274 | In-frame |
| ENST00000286371 | 141915970 | 141916020 | In-frame |
| ENST00000286371 | 141921977 | 141922063 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for ATP1B3 |
p-ENSG00000069849_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000286371 | 1828 | 279 | 141903620 | 141903748 | 299 | 426 | 37 | 79 |
| ENST00000286371 | 1828 | 279 | 141907167 | 141907274 | 428 | 534 | 80 | 115 |
| ENST00000286371 | 1828 | 279 | 141915970 | 141916020 | 721 | 770 | 177 | 194 |
| ENST00000286371 | 1828 | 279 | 141921977 | 141922063 | 772 | 857 | 194 | 223 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000286371 | 1828 | 279 | 141921977 | 141922063 | 772 | 857 | 194 | 223 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000286371 | 1828 | 279 | 141903620 | 141903748 | 299 | 426 | 37 | 79 |
| ENST00000286371 | 1828 | 279 | 141907167 | 141907274 | 428 | 534 | 80 | 115 |
| ENST00000286371 | 1828 | 279 | 141915970 | 141916020 | 721 | 770 | 177 | 194 |
| ENST00000286371 | 1828 | 279 | 141921977 | 141922063 | 772 | 857 | 194 | 223 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P54709 | 37 | 79 | 1 | 279 | Chain | ID=PRO_0000219108;Note=Sodium/potassium-transporting ATPase subunit beta-3 |
| P54709 | 37 | 79 | 57 | 279 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P54709 | 37 | 79 | 36 | 56 | Transmembrane | Note=Helical%3B Signal-anchor for type II membrane protein;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P54709 | 80 | 115 | 1 | 279 | Chain | ID=PRO_0000219108;Note=Sodium/potassium-transporting ATPase subunit beta-3 |
| P54709 | 80 | 115 | 57 | 279 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P54709 | 177 | 194 | 1 | 279 | Chain | ID=PRO_0000219108;Note=Sodium/potassium-transporting ATPase subunit beta-3 |
| P54709 | 177 | 194 | 191 | 250 | Disulfide bond | Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P54709 | 177 | 194 | 186 | 279 | Region | Note=immunoglobulin-like;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P54709 | 177 | 194 | 57 | 279 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P54709 | 194 | 223 | 195 | 279 | Alternative sequence | ID=VSP_056687;Note=In isoform 2. NEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA->TNNVKDGMKIYQM;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P54709 | 194 | 223 | 1 | 279 | Chain | ID=PRO_0000219108;Note=Sodium/potassium-transporting ATPase subunit beta-3 |
| P54709 | 194 | 223 | 191 | 250 | Disulfide bond | Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P54709 | 194 | 223 | 186 | 279 | Region | Note=immunoglobulin-like;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P54709 | 194 | 223 | 57 | 279 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P54709 | 194 | 223 | 195 | 279 | Alternative sequence | ID=VSP_056687;Note=In isoform 2. NEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA->TNNVKDGMKIYQM;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P54709 | 194 | 223 | 1 | 279 | Chain | ID=PRO_0000219108;Note=Sodium/potassium-transporting ATPase subunit beta-3 |
| P54709 | 194 | 223 | 191 | 250 | Disulfide bond | Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P54709 | 194 | 223 | 186 | 279 | Region | Note=immunoglobulin-like;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P54709 | 194 | 223 | 57 | 279 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P54709 | 37 | 79 | 1 | 279 | Chain | ID=PRO_0000219108;Note=Sodium/potassium-transporting ATPase subunit beta-3 |
| P54709 | 37 | 79 | 57 | 279 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P54709 | 37 | 79 | 36 | 56 | Transmembrane | Note=Helical%3B Signal-anchor for type II membrane protein;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P54709 | 80 | 115 | 1 | 279 | Chain | ID=PRO_0000219108;Note=Sodium/potassium-transporting ATPase subunit beta-3 |
| P54709 | 80 | 115 | 57 | 279 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P54709 | 177 | 194 | 1 | 279 | Chain | ID=PRO_0000219108;Note=Sodium/potassium-transporting ATPase subunit beta-3 |
| P54709 | 177 | 194 | 191 | 250 | Disulfide bond | Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P54709 | 177 | 194 | 186 | 279 | Region | Note=immunoglobulin-like;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P54709 | 177 | 194 | 57 | 279 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P54709 | 194 | 223 | 195 | 279 | Alternative sequence | ID=VSP_056687;Note=In isoform 2. NEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA->TNNVKDGMKIYQM;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P54709 | 194 | 223 | 1 | 279 | Chain | ID=PRO_0000219108;Note=Sodium/potassium-transporting ATPase subunit beta-3 |
| P54709 | 194 | 223 | 191 | 250 | Disulfide bond | Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P54709 | 194 | 223 | 186 | 279 | Region | Note=immunoglobulin-like;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P54709 | 194 | 223 | 57 | 279 | Topological domain | Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in ATP1B3 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for ATP1B3 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for ATP1B3 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
| ADstage | ROSMAP | PCC | exon_skip_267373 | -3.187540e-01 | 1.830000e-06 | chr3 | + | 141876855 | 141876910 | 141902136 | 141902227 | 141903620 | 141903748 |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for ATP1B3 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
| HCC | exon_skip_267373 | rs2068229 | chr3:141904462 | 6.214288e-04 | 4.023317e-02 |
| HCC | exon_skip_267373 | rs10755098 | chr3:141884909 | 7.477586e-04 | 4.654883e-02 |
Top |
Correlation with RNA binding proteins (RBPs) for ATP1B3 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
| CB | TIA1 | exon_skip_267373 | 4.089897e-01 | 8.677261e-08 |
| CB | TRA2A | exon_skip_267373 | -5.257621e-01 | 1.109311e-12 |
| CB | HNRNPA1 | exon_skip_267373 | 5.863080e-01 | 4.673876e-16 |
| CB | NUP42 | exon_skip_267373 | 5.994368e-01 | 6.948771e-17 |
| CB | TRA2A | exon_skip_145810 | -4.681640e-01 | 1.161885e-07 |
| CB | NUP42 | exon_skip_145810 | 5.048452e-01 | 7.521577e-09 |
| CB | SRSF9 | exon_skip_145810 | 4.384704e-01 | 8.524321e-07 |
| CB | TRA2A | exon_skip_20576 | -4.613838e-01 | 2.385819e-07 |
| CB | NUP42 | exon_skip_20576 | 5.240601e-01 | 2.180078e-09 |
| CB | PTBP1 | exon_skip_20576 | -4.292921e-01 | 1.879600e-06 |
| CB | PABPC1 | exon_skip_20576 | 5.456848e-01 | 3.416888e-10 |
| CB | SRSF9 | exon_skip_20576 | 4.446903e-01 | 7.167573e-07 |
| CB | RBM4 | exon_skip_20576 | -7.006198e-01 | 4.069196e-18 |
| CB | ZNF638 | exon_skip_44317 | -5.697937e-01 | 1.001331e-12 |
| CB | TRA2A | exon_skip_44317 | -5.024094e-01 | 8.351208e-10 |
| CB | HNRNPDL | exon_skip_44317 | 5.469470e-01 | 1.159786e-11 |
| CB | HNRNPD | exon_skip_44317 | 4.187494e-01 | 5.825927e-07 |
| CB | NUP42 | exon_skip_44317 | 4.766772e-01 | 7.567329e-09 |
| CB | PABPC1 | exon_skip_44317 | 5.666890e-01 | 1.412385e-12 |
| CB | PABPC4 | exon_skip_44317 | 4.403714e-01 | 1.264441e-07 |
| CB | SRSF9 | exon_skip_44317 | 4.134910e-01 | 8.314798e-07 |
| CB | DAZAP1 | exon_skip_45499 | -4.844774e-01 | 1.471609e-10 |
| CB | TARDBP | exon_skip_45499 | -4.545300e-01 | 2.516560e-09 |
| CB | ELAVL1 | exon_skip_45499 | -4.102012e-01 | 1.048326e-07 |
| CB | CNOT4 | exon_skip_45499 | -4.839985e-01 | 1.543334e-10 |
| CB | TRA2A | exon_skip_45499 | -5.028030e-01 | 2.250897e-11 |
| CB | FUBP1 | exon_skip_45499 | -4.081599e-01 | 1.229180e-07 |
| CB | KHSRP | exon_skip_45499 | -4.821214e-01 | 1.858517e-10 |
| CB | HNRNPAB | exon_skip_45499 | -4.733069e-01 | 4.382089e-10 |
| CB | PTBP1 | exon_skip_45499 | -4.846621e-01 | 1.444803e-10 |
| CB | RBM4 | exon_skip_45499 | -5.411756e-01 | 3.013345e-13 |
| CB | HNRNPAB | exon_skip_88539 | -4.549684e-01 | 3.457488e-09 |
| CB | PABPN1L | exon_skip_157815 | 4.509031e-01 | 2.455590e-09 |
| CB | CNOT4 | exon_skip_157815 | -4.276752e-01 | 1.879676e-08 |
| CB | NUP42 | exon_skip_157815 | 4.786785e-01 | 1.747373e-10 |
| CB | RBM4 | exon_skip_157815 | -5.269560e-01 | 9.656929e-13 |
| CB | NUP42 | exon_skip_245549 | 4.469009e-01 | 7.803939e-08 |
| CB | RBM4 | exon_skip_245549 | -5.157571e-01 | 2.472126e-10 |
| CB | FUBP1 | exon_skip_272170 | -4.174145e-01 | 4.404151e-08 |
| CB | NUP42 | exon_skip_272170 | 5.095100e-01 | 6.946506e-12 |
| CB | NUP42 | exon_skip_108785 | 4.453153e-01 | 8.782422e-08 |
| DLPFC | ELAVL4 | exon_skip_267373 | 5.176994e-01 | 3.158372e-24 |
| DLPFC | RC3H1 | exon_skip_267373 | 4.489380e-01 | 6.410730e-18 |
| HCC | ZNF326 | exon_skip_267373 | -4.672531e-01 | 3.709106e-16 |
| HCC | RBM5 | exon_skip_267373 | -4.339147e-01 | 6.479159e-14 |
| HCC | FUBP1 | exon_skip_267373 | -4.268187e-01 | 1.811032e-13 |
| HCC | HNRNPA2B1 | exon_skip_267373 | -4.562129e-01 | 2.183072e-15 |
| HCC | HNRNPF | exon_skip_267373 | -6.019031e-01 | 3.372437e-28 |
| HCC | DAZAP1 | exon_skip_157815 | -4.639113e-01 | 5.646966e-16 |
| HCC | MSI1 | exon_skip_157815 | -5.919792e-01 | 3.309904e-27 |
| HCC | PABPN1 | exon_skip_157815 | -4.648954e-01 | 4.812205e-16 |
| HCC | RBM47 | exon_skip_157815 | -4.958870e-01 | 2.378159e-18 |
| HCC | KHDRBS2 | exon_skip_157815 | 4.070590e-01 | 2.553277e-12 |
| HCC | KHDRBS3 | exon_skip_157815 | -4.514468e-01 | 4.098569e-15 |
| HCC | HNRNPAB | exon_skip_157815 | -4.131098e-01 | 1.121658e-12 |
| HCC | PTBP1 | exon_skip_157815 | -6.418114e-01 | 4.303830e-33 |
| HCC | RBM4 | exon_skip_157815 | -4.470243e-01 | 8.122913e-15 |
| HCC | DAZAP1 | exon_skip_272170 | -4.048813e-01 | 3.419151e-12 |
| HCC | RBM47 | exon_skip_272170 | -4.747661e-01 | 9.398428e-17 |
| IFG | PABPN1L | exon_skip_267373 | -4.903970e-01 | 8.064687e-03 |
| IFG | FUBP1 | exon_skip_267373 | -4.193813e-01 | 2.631466e-02 |
| IFG | ESRP2 | exon_skip_267373 | -4.182544e-01 | 2.676342e-02 |
| PCC | ELAVL4 | exon_skip_267373 | 5.747340e-01 | 2.683452e-20 |
| PCC | RALYL | exon_skip_267373 | 4.013369e-01 | 1.001137e-09 |
| PCC | HNRNPF | exon_skip_267373 | -5.121746e-01 | 8.914175e-16 |
| TC | ELAVL4 | exon_skip_72209 | 7.696983e-01 | 1.316058e-32 |
| TC | HNRNPA1L2 | exon_skip_72209 | 4.440670e-01 | 4.057136e-09 |
| TC | HNRNPD | exon_skip_72209 | 5.475796e-01 | 6.726232e-14 |
| TC | NUP42 | exon_skip_72209 | 6.311568e-01 | 3.676574e-19 |
| TC | RALYL | exon_skip_72209 | 7.618422e-01 | 1.323819e-31 |
| TC | SRSF5 | exon_skip_72209 | 4.045648e-01 | 1.121366e-07 |
| TC | ESRP1 | exon_skip_72209 | 5.928495e-01 | 1.467414e-16 |
| TC | HNRNPF | exon_skip_72209 | -4.276950e-01 | 1.691142e-08 |
Top |
RelatedDrugs for ATP1B3 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for ATP1B3 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|