ExonSkipAD: functional annotation of exon skipping event in human

Gene summary for NEO1

Gene summary

Gene information	Gene symbol	NEO1
	Gene ID	4756
	Gene name	neogenin 1
	Synonyms	IGDCC2\|NGN\|NTN1R2
	Cytomap	15q24.1
	Type of gene	protein-coding
	Description	neogeninimmunoglobulin superfamily DCC subclass member 2neogenin homolog 1
	Modification date	20200313
	UniProtAcc	A0A024R610, Q59FP8, Q92859,
	Context

Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Gene

GO ID

GO term

PubMed ID

Top

Gene structures and expression levels for NEO1

Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

ENSG00000067141

Differentially expressed gene analysis across multiple brain tissues between AD and control.

Tissue type

DEG direction

Base mean exp.

log2FC(AD/control)

P-value

Adj. p-value

Differentially expressed isoform analysis across multiple brain tissues between AD and control.

Tissue type	DEG direction	ENST	Transcript info.	Base mean exp.	log2FC(AD/control)	P-value	Adjc. p-value
STG	UP	ENST00000560328.1	NEO1-208:protein_coding:NEO1	2.487738e+02	1.127050e+00	6.503559e-08	5.859277e-05
CB	UP	ENST00000560808.1	NEO1-211:retained_intron:NEO1	1.236722e+00	2.488599e+00	8.562306e-03	3.060804e-02
TC	UP	ENST00000558485.1	NEO1-203:retained_intron:NEO1	2.910086e+00	1.694764e+00	5.098115e-03	3.402272e-02

Landscape of isoform expressions across multiple brain tissues between AD and control.

Top

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for NEO1

Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap).

All exon skipping events in AD cohorts.

Exon skip ID	chr	Exons involved in exon skipping	Skipped exon
exon_skip_101050	chr15	73273811:73274005:73274692:73274724:73278131:73278196	73274692:73274724
exon_skip_125691	chr15	73254717:73254829:73258766:73258876:73260271:73260465	73258766:73258876
exon_skip_138390	chr15	73273811:73274005:73278131:73278199:73282964:73283111	73278131:73278199
exon_skip_139331	chr15	73289146:73289238:73298348:73298611:73301321:73301457	73298348:73298611
exon_skip_142733	chr15	73122634:73122800:73126417:73126570:73135891:73136027	73126417:73126570
exon_skip_14875	chr15	73178307:73178427:73236287:73236506:73244344:73244482	73236287:73236506
exon_skip_149741	chr15	73274692:73274724:73278131:73278199:73282964:73283111	73278131:73278199
exon_skip_152255	chr15	73273811:73274005:73274692:73274724:73278131:73278199	73274692:73274724
exon_skip_152764	chr15	73178310:73178427:73236347:73236506:73244344:73244482	73236347:73236506
exon_skip_1832	chr15	73178307:73178427:73236347:73236506:73244344:73244482	73236347:73236506
exon_skip_242291	chr15	73178310:73178427:73236287:73236506:73244344:73244482	73236287:73236506
exon_skip_249603	chr15	73288313:73288551:73289146:73289238:73293390:73293548	73289146:73289238
exon_skip_267680	chr15	73298348:73298611:73301321:73301457:73302613:73302718	73301321:73301457
exon_skip_58811	chr15	73289146:73289238:73293390:73293548:73298348:73298611	73293390:73293548
exon_skip_67743	chr15	73272455:73272562:73273811:73274005:73278131:73278199	73273811:73274005
exon_skip_9285	chr15	73288313:73288551:73289146:73289238:73298348:73298611	73289146:73289238
exon_skip_94005	chr15	73116540:73116857:73122525:73122800:73126417:73126570	73122525:73122800

Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control.

Exon skipping information	Tissue type	Avg(PSIs) in AD	Avg(PSIs) in control	Difference (PSI)	Adj. p-value
exon_skip_152255	MSBB_PG	3.174046e-01	4.219231e-01	-1.045185e-01	4.434197e-03

Top

Open reading frame (ORF) annotation in the exon skipping event for NEO1

Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000261908	73126417	73126570	Frame-shift
ENST00000339362	73126417	73126570	Frame-shift
ENST00000261908	73236347	73236506	Frame-shift
ENST00000339362	73236347	73236506	Frame-shift
ENST00000261908	73301321	73301457	Frame-shift
ENST00000339362	73301321	73301457	Frame-shift
ENST00000261908	73122525	73122800	In-frame
ENST00000339362	73122525	73122800	In-frame
ENST00000261908	73274692	73274724	In-frame
ENST00000339362	73274692	73274724	In-frame
ENST00000261908	73278131	73278199	In-frame
ENST00000339362	73278131	73278199	In-frame
ENST00000261908	73293390	73293548	In-frame
ENST00000339362	73293390	73293548	In-frame

Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000261908	73126417	73126570	Frame-shift
ENST00000339362	73126417	73126570	Frame-shift
ENST00000261908	73236347	73236506	Frame-shift
ENST00000339362	73236347	73236506	Frame-shift
ENST00000261908	73274692	73274724	In-frame
ENST00000339362	73274692	73274724	In-frame
ENST00000261908	73293390	73293548	In-frame
ENST00000339362	73293390	73293548	In-frame

Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000261908	73126417	73126570	Frame-shift
ENST00000339362	73126417	73126570	Frame-shift
ENST00000261908	73236347	73236506	Frame-shift
ENST00000339362	73236347	73236506	Frame-shift
ENST00000261908	73301321	73301457	Frame-shift
ENST00000339362	73301321	73301457	Frame-shift
ENST00000261908	73122525	73122800	In-frame
ENST00000339362	73122525	73122800	In-frame
ENST00000261908	73258766	73258876	In-frame
ENST00000339362	73258766	73258876	In-frame
ENST00000261908	73274692	73274724	In-frame
ENST00000339362	73274692	73274724	In-frame
ENST00000261908	73278131	73278199	In-frame
ENST00000339362	73278131	73278199	In-frame
ENST00000261908	73289146	73289238	In-frame
ENST00000339362	73289146	73289238	In-frame
ENST00000261908	73293390	73293548	In-frame
ENST00000339362	73293390	73293548	In-frame

Top

Infer the effects of exon skipping event on protein functional features for NEO1

p-ENSG00000067141_img4.png
boxplot

Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000261908	7105	1461	73122525	73122800	642	916	150	241
ENST00000339362	7359	1461	73122525	73122800	897	1171	150	241
ENST00000261908	7105	1461	73274692	73274724	3354	3385	1054	1064
ENST00000339362	7359	1461	73274692	73274724	3609	3640	1054	1064
ENST00000261908	7105	1461	73278131	73278199	3387	3454	1065	1087
ENST00000339362	7359	1461	73278131	73278199	3642	3709	1065	1087
ENST00000261908	7105	1461	73293390	73293548	3936	4093	1248	1300
ENST00000339362	7359	1461	73293390	73293548	4191	4348	1248	1300

Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000261908	7105	1461	73274692	73274724	3354	3385	1054	1064
ENST00000339362	7359	1461	73274692	73274724	3609	3640	1054	1064
ENST00000261908	7105	1461	73293390	73293548	3936	4093	1248	1300
ENST00000339362	7359	1461	73293390	73293548	4191	4348	1248	1300

Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000261908	7105	1461	73122525	73122800	642	916	150	241
ENST00000339362	7359	1461	73122525	73122800	897	1171	150	241
ENST00000261908	7105	1461	73258766	73258876	2286	2395	698	734
ENST00000339362	7359	1461	73258766	73258876	2541	2650	698	734
ENST00000261908	7105	1461	73274692	73274724	3354	3385	1054	1064
ENST00000339362	7359	1461	73274692	73274724	3609	3640	1054	1064
ENST00000261908	7105	1461	73278131	73278199	3387	3454	1065	1087
ENST00000339362	7359	1461	73278131	73278199	3642	3709	1065	1087
ENST00000261908	7105	1461	73289146	73289238	3843	3934	1217	1247
ENST00000339362	7359	1461	73289146	73289238	4098	4189	1217	1247
ENST00000261908	7105	1461	73293390	73293548	3936	4093	1248	1300
ENST00000339362	7359	1461	73293390	73293548	4191	4348	1248	1300

Lost protein functional features of individual exon skipping events in ROSMAP.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q92859	150	241	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	150	241	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	150	241	173	221	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00114
Q92859	150	241	173	221	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00114
Q92859	150	241	152	238	Domain	Note=Ig-like C2-type 2
Q92859	150	241	152	238	Domain	Note=Ig-like C2-type 2
Q92859	150	241	210	210	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269\|PubMed:16335952,ECO:0000269\|PubMed:19349973;Dbxref=PMID:16335952,PMID:19349973
Q92859	150	241	210	210	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269\|PubMed:16335952,ECO:0000269\|PubMed:19349973;Dbxref=PMID:16335952,PMID:19349973
Q92859	150	241	168	168	Sequence conflict	Note=N->G;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q92859	150	241	168	168	Sequence conflict	Note=N->G;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q92859	150	241	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	150	241	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1054	1064	1054	1064	Alternative sequence	ID=VSP_047134;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1054	1064	1054	1064	Alternative sequence	ID=VSP_047134;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1054	1064	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1054	1064	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1054	1064	957	1054	Domain	Note=Fibronectin type-III 6;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00316
Q92859	1054	1064	957	1054	Domain	Note=Fibronectin type-III 6;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00316
Q92859	1054	1064	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1054	1064	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1065	1087	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1065	1087	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1065	1087	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1065	1087	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1248	1300	1248	1301	Alternative sequence	ID=VSP_043330;Note=In isoform 3. PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE->Q;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1248	1300	1248	1301	Alternative sequence	ID=VSP_043330;Note=In isoform 3. PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE->Q;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1248	1300	1248	1300	Alternative sequence	ID=VSP_002593;Note=In isoform 2. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:9121761,ECO:0000303\|PubMed:9169140;Dbxref=PMID:9121761,PMID:9169140
Q92859	1248	1300	1248	1300	Alternative sequence	ID=VSP_002593;Note=In isoform 2. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:9121761,ECO:0000303\|PubMed:9169140;Dbxref=PMID:9121761,PMID:9169140
Q92859	1248	1300	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1248	1300	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1248	1300	1127	1461	Topological domain	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1248	1300	1127	1461	Topological domain	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255

Lost protein functional features of individual exon skipping events in MSBB.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q92859	1054	1064	1054	1064	Alternative sequence	ID=VSP_047134;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1054	1064	1054	1064	Alternative sequence	ID=VSP_047134;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1054	1064	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1054	1064	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1054	1064	957	1054	Domain	Note=Fibronectin type-III 6;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00316
Q92859	1054	1064	957	1054	Domain	Note=Fibronectin type-III 6;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00316
Q92859	1054	1064	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1054	1064	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1248	1300	1248	1301	Alternative sequence	ID=VSP_043330;Note=In isoform 3. PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE->Q;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1248	1300	1248	1301	Alternative sequence	ID=VSP_043330;Note=In isoform 3. PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE->Q;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1248	1300	1248	1300	Alternative sequence	ID=VSP_002593;Note=In isoform 2. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:9121761,ECO:0000303\|PubMed:9169140;Dbxref=PMID:9121761,PMID:9169140
Q92859	1248	1300	1248	1300	Alternative sequence	ID=VSP_002593;Note=In isoform 2. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:9121761,ECO:0000303\|PubMed:9169140;Dbxref=PMID:9121761,PMID:9169140
Q92859	1248	1300	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1248	1300	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1248	1300	1127	1461	Topological domain	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1248	1300	1127	1461	Topological domain	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255

Lost protein functional features of individual exon skipping events in Mayo.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q92859	150	241	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	150	241	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	150	241	173	221	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00114
Q92859	150	241	173	221	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00114
Q92859	150	241	152	238	Domain	Note=Ig-like C2-type 2
Q92859	150	241	152	238	Domain	Note=Ig-like C2-type 2
Q92859	150	241	210	210	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269\|PubMed:16335952,ECO:0000269\|PubMed:19349973;Dbxref=PMID:16335952,PMID:19349973
Q92859	150	241	210	210	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000269,ECO:0000269;evidence=ECO:0000269\|PubMed:16335952,ECO:0000269\|PubMed:19349973;Dbxref=PMID:16335952,PMID:19349973
Q92859	150	241	168	168	Sequence conflict	Note=N->G;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q92859	150	241	168	168	Sequence conflict	Note=N->G;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q92859	150	241	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	150	241	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	698	734	704	708	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1X5H
Q92859	698	734	704	708	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1X5H
Q92859	698	734	710	713	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1X5H
Q92859	698	734	710	713	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1X5H
Q92859	698	734	716	720	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1X5H
Q92859	698	734	716	720	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1X5H
Q92859	698	734	724	727	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1X5H
Q92859	698	734	724	727	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:1X5H
Q92859	698	734	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	698	734	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	698	734	636	731	Domain	Note=Fibronectin type-III 3;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00316
Q92859	698	734	636	731	Domain	Note=Fibronectin type-III 3;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00316
Q92859	698	734	715	715	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	698	734	715	715	Glycosylation	Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	698	734	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	698	734	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1054	1064	1054	1064	Alternative sequence	ID=VSP_047134;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1054	1064	1054	1064	Alternative sequence	ID=VSP_047134;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1054	1064	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1054	1064	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1054	1064	957	1054	Domain	Note=Fibronectin type-III 6;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00316
Q92859	1054	1064	957	1054	Domain	Note=Fibronectin type-III 6;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00316
Q92859	1054	1064	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1054	1064	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1065	1087	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1065	1087	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1065	1087	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1065	1087	34	1105	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1217	1247	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1217	1247	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1217	1247	1127	1461	Topological domain	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1217	1247	1127	1461	Topological domain	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1248	1300	1248	1301	Alternative sequence	ID=VSP_043330;Note=In isoform 3. PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE->Q;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1248	1300	1248	1301	Alternative sequence	ID=VSP_043330;Note=In isoform 3. PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE->Q;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q92859	1248	1300	1248	1300	Alternative sequence	ID=VSP_002593;Note=In isoform 2. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:9121761,ECO:0000303\|PubMed:9169140;Dbxref=PMID:9121761,PMID:9169140
Q92859	1248	1300	1248	1300	Alternative sequence	ID=VSP_002593;Note=In isoform 2. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:9121761,ECO:0000303\|PubMed:9169140;Dbxref=PMID:9121761,PMID:9169140
Q92859	1248	1300	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1248	1300	34	1461	Chain	ID=PRO_0000015043;Note=Neogenin
Q92859	1248	1300	1127	1461	Topological domain	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q92859	1248	1300	1127	1461	Topological domain	Note=Cytoplasmic;Ontology_term=ECO:0000255;evidence=ECO:0000255

Top

3'-UTR located exon skipping events that lost miRNA binding sites in NEO1

3'-UTR exon skipping evnets lost miRNA binding.

Tissue type

ENST

Exon skip start

Exon skip end

microRNA

Binding site by TargetScan

Binding type by TargetScan

Bdinding site by miRanda

Score of miRanda

Energy by miRanda

Top

SNVs in the skipped exons for NEO1

- Differential PSIs between mutated versus non-mutated samples.

- Depth of Coverage in the skipped exon of the mutated samples.

- Sashimi plot in the skipped exon of the mutated samples.

- Non-synonymous mutations located in the skipped exons.

Cancer type

Sample

ESID

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

- Non-synonymous mutations located in the skipped exons in CCLE.

Sample

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

Top

AD stage-associated exon skippint events for NEO1

Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR).

AD stage info

Cohort

Tissue

SE id

Coefficient

P-value

Chromosome

Strand

E1 start

E1 end

Skipped start

Skipped end

E2 start

E2 end

Top

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for NEO1

sQTL information located at the skipped exons.

Tissue type

Exon skip ID

SNP id

Location

P-value

FDR

Top

Correlation with RNA binding proteins (RBPs) for NEO1

Correlated RBP and related information.

Tissue type	RBP name	Exon skip ID	Correlation coeifficient	P-value
CB	NOVA1	exon_skip_58811	-4.839741e-01	1.027158e-10
DLPFC	RC3H1	exon_skip_58811	-4.574418e-01	1.122422e-18
DLPFC	KHDRBS2	exon_skip_152255	5.685190e-01	3.410388e-28
FL	KHDRBS2	exon_skip_152255	4.310434e-01	2.894955e-09
FL	SRSF9	exon_skip_152255	4.311539e-01	2.865284e-09
HCC	SNRNP70	exon_skip_152255	-5.513588e-01	4.936055e-23
HCC	RBM6	exon_skip_58811	5.936287e-01	2.193771e-27
HCC	SRSF11	exon_skip_58811	4.935391e-01	3.624456e-18
HCC	IGF2BP2	exon_skip_58811	4.186319e-01	5.218128e-13
HCC	PCBP4	exon_skip_58811	4.662591e-01	3.852197e-16
HCC	SF1	exon_skip_58811	4.458737e-01	9.689567e-15
PG	KHDRBS2	exon_skip_152255	5.209110e-01	4.051722e-14
STG	KHDRBS2	exon_skip_152255	4.637336e-01	1.300129e-05
TC	KHDRBS2	exon_skip_101050	6.097914e-01	1.146890e-17

Top

RelatedDrugs for NEO1

Approved drugs targeting this gene.
(DrugBank Version 5.1.0 2018-04-02)

UniProtAcc

DrugBank ID

Drug name

Drug activity

Drug type

Drug status

Top

RelatedDiseases for NEO1

Diseases associated with this gene.
(DisGeNet 4.0)

Gene

Disease ID

Disease name

# pubmeds

Source

	Gene summary
	Gene structures and expression levels
	Exon skipping events with PSIs in RPSMAP, MSBB, and Mayo
	Open reading frame (ORF) annotation in the exon skipping event
	Exon skipping events in the canonical protein sequence
	3'-UTR located exon skipping events lost miRNA binding sites
	SNVs in the skipped exons with depth of coverage
	AD stage-associated exon skipping events
	Splicing Quantitative Trait Loci (sQTLs) in the skipped exons
	Correlation with RNA binding proteins (RBPs)
	Related drugs with this gene
	Related diseases with this gene

Home

Download

Statistics

Landscape

Help

Contact

Gene summary for NEO1

Gene structures and expression levels for NEO1

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for NEO1

Open reading frame (ORF) annotation in the exon skipping event for NEO1

Infer the effects of exon skipping event on protein functional features for NEO1

3'-UTR located exon skipping events that lost miRNA binding sites in NEO1

SNVs in the skipped exons for NEO1

AD stage-associated exon skippint events for NEO1

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for NEO1

Correlation with RNA binding proteins (RBPs) for NEO1

RelatedDrugs for NEO1

RelatedDiseases for NEO1