|
Open reading frame (ORF) annotation in the exon skipping event | |
3'-UTR located exon skipping events lost miRNA binding sites | |
Splicing Quantitative Trait Loci (sQTLs) in the skipped exons | |
Gene summary for GSTK1 |
Gene summary |
Gene information | Gene symbol | GSTK1 | Gene ID | 373156 |
Gene name | glutathione S-transferase kappa 1 | |
Synonyms | GST|GST 13-13|GST13|GST13-13|GSTK1-1|hGSTK1 | |
Cytomap | 7q34 | |
Type of gene | protein-coding | |
Description | glutathione S-transferase kappa 1GST class-kappaglutathione S-transferase k1glutathione S-transferase subunit 13 homolog | |
Modification date | 20200313 | |
UniProtAcc | ||
Context | - 28495476(Studies on Diagnostic Biomarkers and Therapeutic Mechanism of Alzheimer's Disease Through Metabolomics and Hippocampal Proteomics) |
Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for GSTK1 |
Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Differentially expressed gene analysis across multiple brain tissues between AD and control. |
Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
Landscape of isoform expressions across multiple brain tissues between AD and control. |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for GSTK1 |
Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
All exon skipping events in AD cohorts. |
Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
exon_skip_112211 | chr7 | 143264086:143264167:143264548:143264676:143264992:143265092 | 143264548:143264676 |
exon_skip_13612 | chr7 | 143263496:143263585:143264086:143264167:143264548:143264676 | 143264086:143264167 |
exon_skip_141901 | chr7 | 143264992:143265092:143265261:143265296:143267617:143267733 | 143265261:143265296 |
exon_skip_18752 | chr7 | 143264086:143264167:143264548:143264676:143264992:143265005 | 143264548:143264676 |
exon_skip_204543 | chr7 | 143265055:143265092:143265261:143265296:143267617:143267733 | 143265261:143265296 |
exon_skip_211221 | chr7 | 143263496:143263585:143264086:143264167:143264992:143265092 | 143264086:143264167 |
exon_skip_269245 | chr7 | 143263496:143263585:143264086:143264167:143264992:143265005 | 143264086:143264167 |
exon_skip_281583 | chr7 | 143265261:143265296:143267617:143267733:143268091:143268184 | 143267617:143267733 |
exon_skip_46613 | chr7 | 143267617:143267733:143268091:143268184:143268788:143268943 | 143268091:143268184 |
exon_skip_59184 | chr7 | 143264996:143265092:143265261:143265296:143267617:143267733 | 143265261:143265296 |
exon_skip_63515 | chr7 | 143267617:143267733:143268091:143268184:143268788:143268866 | 143268091:143268184 |
Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for GSTK1 |
Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
ENST | Start of skipped exon | End of skipped exon | ORF |
ENST00000358406 | 143264086 | 143264167 | Frame-shift |
ENST00000358406 | 143268091 | 143268184 | Frame-shift |
ENST00000358406 | 143264548 | 143264676 | In-frame |
ENST00000358406 | 143265261 | 143265296 | In-frame |
Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
ENST | Start of skipped exon | End of skipped exon | ORF |
ENST00000358406 | 143264086 | 143264167 | Frame-shift |
ENST00000358406 | 143264548 | 143264676 | In-frame |
ENST00000358406 | 143265261 | 143265296 | In-frame |
Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
ENST | Start of skipped exon | End of skipped exon | ORF |
ENST00000358406 | 143264086 | 143264167 | Frame-shift |
ENST00000358406 | 143268091 | 143268184 | Frame-shift |
ENST00000358406 | 143264548 | 143264676 | In-frame |
ENST00000358406 | 143265261 | 143265296 | In-frame |
ENST00000358406 | 143267617 | 143267733 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for GSTK1 |
p-ENSG00000197448_img4.png |
Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
ENST00000358406 | 1061 | 226 | 143264548 | 143264676 | 227 | 354 | 52 | 94 |
ENST00000358406 | 1061 | 226 | 143265261 | 143265296 | 457 | 491 | 128 | 140 |
Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
ENST00000358406 | 1061 | 226 | 143264548 | 143264676 | 227 | 354 | 52 | 94 |
ENST00000358406 | 1061 | 226 | 143265261 | 143265296 | 457 | 491 | 128 | 140 |
Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
ENST00000358406 | 1061 | 226 | 143264548 | 143264676 | 227 | 354 | 52 | 94 |
ENST00000358406 | 1061 | 226 | 143265261 | 143265296 | 457 | 491 | 128 | 140 |
ENST00000358406 | 1061 | 226 | 143267617 | 143267733 | 493 | 608 | 140 | 179 |
Lost protein functional features of individual exon skipping events in ROSMAP. |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q9Y2Q3 | 52 | 94 | 52 | 94 | Alternative sequence | ID=VSP_040978;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
Q9Y2Q3 | 52 | 94 | 57 | 59 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 52 | 94 | 53 | 53 | Binding site | Note=Glutathione;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16081649;Dbxref=PMID:16081649 |
Q9Y2Q3 | 52 | 94 | 1 | 226 | Chain | ID=PRO_0000185891;Note=Glutathione S-transferase kappa 1 |
Q9Y2Q3 | 52 | 94 | 61 | 77 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 52 | 94 | 88 | 94 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 52 | 94 | 71 | 71 | Modified residue | Note=N6-acetyllysine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:19608861;Dbxref=PMID:19608861 |
Q9Y2Q3 | 52 | 94 | 85 | 85 | Modified residue | Note=N6-acetyllysine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9DCM2 |
Q9Y2Q3 | 128 | 140 | 128 | 128 | Alternative sequence | ID=VSP_040025;Note=In isoform 2. R->RVSVGLWESSGRTLDDFLTFPRHVFRVMILPPPGGSTVLPVTPLSPHRLPAVFSSSQ;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
Q9Y2Q3 | 128 | 140 | 129 | 140 | Alternative sequence | ID=VSP_040979;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
Q9Y2Q3 | 128 | 140 | 1 | 226 | Chain | ID=PRO_0000185891;Note=Glutathione S-transferase kappa 1 |
Q9Y2Q3 | 128 | 140 | 135 | 144 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Lost protein functional features of individual exon skipping events in MSBB. |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q9Y2Q3 | 52 | 94 | 52 | 94 | Alternative sequence | ID=VSP_040978;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
Q9Y2Q3 | 52 | 94 | 57 | 59 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 52 | 94 | 53 | 53 | Binding site | Note=Glutathione;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16081649;Dbxref=PMID:16081649 |
Q9Y2Q3 | 52 | 94 | 1 | 226 | Chain | ID=PRO_0000185891;Note=Glutathione S-transferase kappa 1 |
Q9Y2Q3 | 52 | 94 | 61 | 77 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 52 | 94 | 88 | 94 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 52 | 94 | 71 | 71 | Modified residue | Note=N6-acetyllysine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:19608861;Dbxref=PMID:19608861 |
Q9Y2Q3 | 52 | 94 | 85 | 85 | Modified residue | Note=N6-acetyllysine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9DCM2 |
Q9Y2Q3 | 128 | 140 | 128 | 128 | Alternative sequence | ID=VSP_040025;Note=In isoform 2. R->RVSVGLWESSGRTLDDFLTFPRHVFRVMILPPPGGSTVLPVTPLSPHRLPAVFSSSQ;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
Q9Y2Q3 | 128 | 140 | 129 | 140 | Alternative sequence | ID=VSP_040979;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
Q9Y2Q3 | 128 | 140 | 1 | 226 | Chain | ID=PRO_0000185891;Note=Glutathione S-transferase kappa 1 |
Q9Y2Q3 | 128 | 140 | 135 | 144 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Lost protein functional features of individual exon skipping events in Mayo. |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q9Y2Q3 | 52 | 94 | 52 | 94 | Alternative sequence | ID=VSP_040978;Note=In isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
Q9Y2Q3 | 52 | 94 | 57 | 59 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 52 | 94 | 53 | 53 | Binding site | Note=Glutathione;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:16081649;Dbxref=PMID:16081649 |
Q9Y2Q3 | 52 | 94 | 1 | 226 | Chain | ID=PRO_0000185891;Note=Glutathione S-transferase kappa 1 |
Q9Y2Q3 | 52 | 94 | 61 | 77 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 52 | 94 | 88 | 94 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 52 | 94 | 71 | 71 | Modified residue | Note=N6-acetyllysine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:19608861;Dbxref=PMID:19608861 |
Q9Y2Q3 | 52 | 94 | 85 | 85 | Modified residue | Note=N6-acetyllysine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9DCM2 |
Q9Y2Q3 | 128 | 140 | 128 | 128 | Alternative sequence | ID=VSP_040025;Note=In isoform 2. R->RVSVGLWESSGRTLDDFLTFPRHVFRVMILPPPGGSTVLPVTPLSPHRLPAVFSSSQ;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|PubMed:15489334;Dbxref=PMID:14702039,PMID:15489334 |
Q9Y2Q3 | 128 | 140 | 129 | 140 | Alternative sequence | ID=VSP_040979;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
Q9Y2Q3 | 128 | 140 | 1 | 226 | Chain | ID=PRO_0000185891;Note=Glutathione S-transferase kappa 1 |
Q9Y2Q3 | 128 | 140 | 135 | 144 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 140 | 179 | 129 | 140 | Alternative sequence | ID=VSP_040979;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
Q9Y2Q3 | 140 | 179 | 1 | 226 | Chain | ID=PRO_0000185891;Note=Glutathione S-transferase kappa 1 |
Q9Y2Q3 | 140 | 179 | 135 | 144 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 140 | 179 | 149 | 156 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 140 | 179 | 162 | 177 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Q9Y2Q3 | 140 | 179 | 144 | 144 | Modified residue | Note=N6-succinyllysine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9DCM2 |
Q9Y2Q3 | 140 | 179 | 158 | 158 | Modified residue | Note=N6-acetyllysine%3B alternate;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9DCM2 |
Q9Y2Q3 | 140 | 179 | 158 | 158 | Modified residue | Note=N6-succinyllysine%3B alternate;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9DCM2 |
Q9Y2Q3 | 140 | 179 | 165 | 165 | Modified residue | Note=N6-acetyllysine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9DCM2 |
Q9Y2Q3 | 140 | 179 | 169 | 169 | Modified residue | Note=N6-acetyllysine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:19608861;Dbxref=PMID:19608861 |
Q9Y2Q3 | 140 | 179 | 171 | 171 | Sequence conflict | Note=T->A;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
Q9Y2Q3 | 140 | 179 | 179 | 179 | Sequence conflict | Note=G->R;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
Q9Y2Q3 | 140 | 179 | 157 | 160 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3RPP |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in GSTK1 |
3'-UTR exon skipping evnets lost miRNA binding. |
Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for GSTK1 |
- Differential PSIs between mutated versus non-mutated samples. |
- Depth of Coverage in the skipped exon of the mutated samples. |
- Sashimi plot in the skipped exon of the mutated samples. |
- Non-synonymous mutations located in the skipped exons. |
Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
- Non-synonymous mutations located in the skipped exons in CCLE. |
Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for GSTK1 |
Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
ADstage | MSBB | IFG | exon_skip_141901 | -4.851483e-01 | 8.876377e-03 | chr7 | + | 143264992 | 143265092 | 143265261 | 143265296 | 143267617 | 143267733 |
CDR | MSBB | IFG | exon_skip_141901 | -5.918853e-01 | 9.073500e-04 | chr7 | + | 143264992 | 143265092 | 143265261 | 143265296 | 143267617 | 143267733 |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for GSTK1 |
sQTL information located at the skipped exons. |
Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
PCC | exon_skip_141901 | rs4726612 | chr7:143363198 | 3.309953e-05 | 7.045824e-03 |
Top |
Correlation with RNA binding proteins (RBPs) for GSTK1 |
Correlated RBP and related information. |
Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
IFG | RBM5 | exon_skip_141901 | -4.208397e-01 | 2.574300e-02 |
IFG | TRA2A | exon_skip_141901 | -4.945073e-01 | 7.473521e-03 |
Top |
RelatedDrugs for GSTK1 |
Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Q9Y2Q3 | approved|investigational|nutraceutical | DB00143 | Glutathione | small molecule | Q9Y2Q3 |
Top |
RelatedDiseases for GSTK1 |
Diseases associated with this gene. (DisGeNet 4.0) |
Gene | Disease ID | Disease name | # pubmeds | Source |