|
Open reading frame (ORF) annotation in the exon skipping event | |
3'-UTR located exon skipping events lost miRNA binding sites | |
Splicing Quantitative Trait Loci (sQTLs) in the skipped exons | |
Gene summary for RSPO2 |
Gene summary |
Gene information | Gene symbol | RSPO2 | Gene ID | 340419 |
Gene name | R-spondin 2 | |
Synonyms | CRISTIN2|HHRRD|TETAMS2 | |
Cytomap | 8q23.1 | |
Type of gene | protein-coding | |
Description | R-spondin-2R-spondin 2 homologroof plate-specific spondin-2 | |
Modification date | 20200313 | |
UniProtAcc | ||
Context |
Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Gene | GO ID | GO term | PubMed ID |
RSPO2 | GO:0030177 | positive regulation of Wnt signaling pathway | 29769720 |
Top |
Gene structures and expression levels for RSPO2 |
Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Differentially expressed gene analysis across multiple brain tissues between AD and control. |
Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
PG | DOWN | ENST00000522333.1 | RSPO2-208:protein_coding:RSPO2 | 4.289413e+00 | -9.428158e-01 | 1.211535e-03 | 1.679484e-02 |
CB | UP | ENST00000276659.10 | RSPO2-201:protein_coding:RSPO2 | 6.610040e+01 | 9.303035e-01 | 2.437106e-05 | 2.237999e-04 |
Landscape of isoform expressions across multiple brain tissues between AD and control. |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for RSPO2 |
Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
All exon skipping events in AD cohorts. |
Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
exon_skip_280597 | chr8 | 107960748:107960817:107989056:107989244:108082545:108082807 | 107989056:107989244 |
exon_skip_63542 | chr8 | 107960674:107960817:107989056:107989244:108082545:108082807 | 107989056:107989244 |
exon_skip_78989 | chr8 | 107989056:107989244:108060043:108060238:108082545:108082886 | 108060043:108060238 |
Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for RSPO2 |
Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
ENST | Start of skipped exon | End of skipped exon | ORF |
ENST00000276659 | 107989056 | 107989244 | In-frame |
Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
ENST | Start of skipped exon | End of skipped exon | ORF |
ENST00000276659 | 107989056 | 107989244 | In-frame |
Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
ENST | Start of skipped exon | End of skipped exon | ORF |
ENST00000276659 | 107989056 | 107989244 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for RSPO2 |
p-ENSG00000147655_img4.png |
Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
ENST00000276659 | 3128 | 243 | 107989056 | 107989244 | 716 | 903 | 31 | 94 |
Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
ENST00000276659 | 3128 | 243 | 107989056 | 107989244 | 716 | 903 | 31 | 94 |
Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
ENST00000276659 | 3128 | 243 | 107989056 | 107989244 | 716 | 903 | 31 | 94 |
Lost protein functional features of individual exon skipping events in ROSMAP. |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q6UXX9 | 31 | 94 | 1 | 67 | Alternative sequence | ID=VSP_018321;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
Q6UXX9 | 31 | 94 | 32 | 95 | Alternative sequence | ID=VSP_018322;Note=In isoform 3. ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCAR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
Q6UXX9 | 31 | 94 | 22 | 243 | Chain | ID=PRO_0000234439;Note=R-spondin-2 |
Q6UXX9 | 31 | 94 | 40 | 46 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 43 | 52 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 55 | 74 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 78 | 93 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 90 | 134 | Repeat | Note=FU |
Lost protein functional features of individual exon skipping events in MSBB. |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q6UXX9 | 31 | 94 | 1 | 67 | Alternative sequence | ID=VSP_018321;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
Q6UXX9 | 31 | 94 | 32 | 95 | Alternative sequence | ID=VSP_018322;Note=In isoform 3. ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCAR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
Q6UXX9 | 31 | 94 | 22 | 243 | Chain | ID=PRO_0000234439;Note=R-spondin-2 |
Q6UXX9 | 31 | 94 | 40 | 46 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 43 | 52 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 55 | 74 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 78 | 93 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 90 | 134 | Repeat | Note=FU |
Lost protein functional features of individual exon skipping events in Mayo. |
UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Q6UXX9 | 31 | 94 | 1 | 67 | Alternative sequence | ID=VSP_018321;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
Q6UXX9 | 31 | 94 | 32 | 95 | Alternative sequence | ID=VSP_018322;Note=In isoform 3. ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCAR->G;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
Q6UXX9 | 31 | 94 | 22 | 243 | Chain | ID=PRO_0000234439;Note=R-spondin-2 |
Q6UXX9 | 31 | 94 | 40 | 46 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 43 | 52 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 55 | 74 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 78 | 93 | Disulfide bond | Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00210 |
Q6UXX9 | 31 | 94 | 90 | 134 | Repeat | Note=FU |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in RSPO2 |
3'-UTR exon skipping evnets lost miRNA binding. |
Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for RSPO2 |
- Differential PSIs between mutated versus non-mutated samples. |
- Depth of Coverage in the skipped exon of the mutated samples. |
- Sashimi plot in the skipped exon of the mutated samples. |
- Non-synonymous mutations located in the skipped exons. |
Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
- Non-synonymous mutations located in the skipped exons in CCLE. |
Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for RSPO2 |
Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for RSPO2 |
sQTL information located at the skipped exons. |
Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for RSPO2 |
Correlated RBP and related information. |
Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for RSPO2 |
Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for RSPO2 |
Diseases associated with this gene. (DisGeNet 4.0) |
Gene | Disease ID | Disease name | # pubmeds | Source |