ExonSkipAD: functional annotation of exon skipping event in human

Gene summary for APLP2

Gene summary

Gene information	Gene symbol	APLP2
	Gene ID	334
	Gene name	amyloid beta precursor like protein 2
	Synonyms	APLP-2\|APPH\|APPL2\|CDEBP
	Cytomap	11q24.3
	Type of gene	protein-coding
	Description	amyloid-like protein 2CDEI box-binding proteinamyloid beta (A4) precursor-like protein 2amyloid precursor protein homolog HSD-2testicular tissue protein Li 23
	Modification date	20200313
	UniProtAcc	A0A024R3N3, E9PK76, E9PPD0, E9PQS3, E9PSC7, L8E7K0, Q9UED0,
	Context

Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Gene

GO ID

GO term

PubMed ID

Top

Gene structures and expression levels for APLP2

Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

ENSG00000084234

Differentially expressed gene analysis across multiple brain tissues between AD and control.

Tissue type

DEG direction

Base mean exp.

log2FC(AD/control)

P-value

Adj. p-value

Differentially expressed isoform analysis across multiple brain tissues between AD and control.

Tissue type	DEG direction	ENST	Transcript info.	Base mean exp.	log2FC(AD/control)	P-value	Adjc. p-value
STG	UP	ENST00000278756.7	APLP2-202:protein_coding:APLP2	8.841754e+01	2.004324e+00	8.185667e-04	3.459288e-02
CB	UP	ENST00000527702.5	APLP2-209:lncRNA:APLP2	1.991033e+00	8.427982e-01	4.317734e-03	1.744765e-02
CB	UP	ENST00000534761.5	APLP2-225:lncRNA:APLP2	2.018125e+00	9.161657e-01	6.861116e-03	2.551209e-02
CB	UP	ENST00000529701.1	APLP2-213:lncRNA:APLP2	1.194836e+00	9.490482e-01	1.366003e-02	4.471465e-02

Landscape of isoform expressions across multiple brain tissues between AD and control.

Top

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for APLP2

Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap).

All exon skipping events in AD cohorts.

Exon skip ID	chr	Exons involved in exon skipping	Skipped exon
exon_skip_136989	chr11	130070054:130070082:130109429:130109617:130110538:130110661	130109429:130109617
exon_skip_137508	chr11	130133629:130133728:130135563:130135715:130140398:130140457	130135563:130135715
exon_skip_149113	chr11	130122498:130122513:130123612:130123779:130126700:130126830	130123612:130123779
exon_skip_173272	chr11	130135563:130135715:130137256:130137291:130140398:130140447	130137256:130137291
exon_skip_18471	chr11	130133629:130133728:130135563:130135715:130140398:130140447	130135563:130135715
exon_skip_190011	chr11	130140398:130140483:130141498:130141572:130141919:130142074	130141498:130141572
exon_skip_19660	chr11	130069894:130070082:130110538:130110661:130120706:130120777	130110538:130110661
exon_skip_236770	chr11	130133629:130133728:130135563:130135715:130137256:130137291	130135563:130135715
exon_skip_251598	chr11	130069837:130070082:130101370:130101513:130109429:130109581	130101370:130101513
exon_skip_260561	chr11	130070054:130070082:130110538:130110661:130120706:130120777	130110538:130110661
exon_skip_267284	chr11	130069921:130070082:130109429:130109602:130110538:130110560	130109429:130109602
exon_skip_273798	chr11	130069894:130070082:130109429:130109602:130110538:130110661	130109429:130109602
exon_skip_283596	chr11	130135563:130135715:130137256:130137291:130140398:130140483	130137256:130137291
exon_skip_35754	chr11	130122305:130122513:130123612:130123779:130126700:130126830	130123612:130123779
exon_skip_48510	chr11	130135563:130135715:130137256:130137291:130140398:130140457	130137256:130137291
exon_skip_52762	chr11	130070054:130070082:130109429:130109602:130110538:130110661	130109429:130109602
exon_skip_61471	chr11	130133629:130133728:130135563:130135715:130140398:130140483	130135563:130135715
exon_skip_74872	chr11	130135563:130135715:130137256:130137291:130140398:130140482	130137256:130137291
exon_skip_75291	chr11	130069921:130070082:130110538:130110661:130120706:130120777	130110538:130110661

Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control.

Exon skipping information	Tissue type	Avg(PSIs) in AD	Avg(PSIs) in control	Difference (PSI)	Adj. p-value
exon_skip_283596	MSBB_STG	6.636232e-01	7.662500e-01	-1.026268e-01	6.101754e-03
exon_skip_283596	MSBB_PG	5.115333e-01	6.779310e-01	-1.663977e-01	1.493169e-07

Top

Open reading frame (ORF) annotation in the exon skipping event for APLP2

Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000263574	130109429	130109602	In-frame
ENST00000263574	130123612	130123779	In-frame
ENST00000263574	130137256	130137291	In-frame

Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000263574	130109429	130109602	In-frame
ENST00000263574	130123612	130123779	In-frame
ENST00000263574	130137256	130137291	In-frame

Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000263574	130109429	130109602	In-frame
ENST00000263574	130123612	130123779	In-frame
ENST00000263574	130135563	130135715	In-frame
ENST00000263574	130137256	130137291	In-frame
ENST00000263574	130141498	130141572	In-frame

Top

Infer the effects of exon skipping event on protein functional features for APLP2

p-ENSG00000084234_img4.png
boxplot

Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000263574	3744	763	130109429	130109602	179	351	35	93
ENST00000263574	3744	763	130123612	130123779	996	1162	308	363
ENST00000263574	3744	763	130137256	130137291	1911	1945	613	624

Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000263574	3744	763	130109429	130109602	179	351	35	93
ENST00000263574	3744	763	130123612	130123779	996	1162	308	363
ENST00000263574	3744	763	130137256	130137291	1911	1945	613	624

Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000263574	3744	763	130109429	130109602	179	351	35	93
ENST00000263574	3744	763	130123612	130123779	996	1162	308	363
ENST00000263574	3744	763	130135563	130135715	1758	1909	562	612
ENST00000263574	3744	763	130137256	130137291	1911	1945	613	624
ENST00000263574	3744	763	130141498	130141572	2033	2106	653	678

Lost protein functional features of individual exon skipping events in ROSMAP.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q06481	35	93	1	35	Alternative sequence	ID=VSP_046881;Note=In isoform 6. MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIE->MLRAPGELPRQAARCSLCRLGPGRGRAFFKWRCLPASVDRGNPLW;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q06481	35	93	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	35	93	56	80	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	91	133	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	46	205	Domain	Note=E1;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	46	139	Region	Note=GFLD subdomain;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q06481	308	363	136	364	Alternative sequence	ID=VSP_030921;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q06481	308	363	308	363	Alternative sequence	ID=VSP_000018;Note=In isoform 2 and isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:7651835;Dbxref=PMID:7651835
Q06481	308	363	325	329	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	334	338	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	308	363	310	360	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	319	343	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	335	356	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	306	364	Domain	Note=BPTI/Kunitz inhibitor;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	345	347	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	353	359	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	320	321	Site	Note=Reactive bond;Ontology_term=ECO:0000250;evidence=ECO:0000250
Q06481	308	363	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q06481	308	363	330	333	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	613	624	613	624	Alternative sequence	ID=VSP_000019;Note=In isoform 3%2C isoform 4%2C isoform 5 and isoform 6. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334,ECO:0000303\|PubMed:7651835;Dbxref=PMID:14702039,PMID:154893
Q06481	613	624	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	613	624	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255

Lost protein functional features of individual exon skipping events in MSBB.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q06481	35	93	1	35	Alternative sequence	ID=VSP_046881;Note=In isoform 6. MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIE->MLRAPGELPRQAARCSLCRLGPGRGRAFFKWRCLPASVDRGNPLW;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q06481	35	93	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	35	93	56	80	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	91	133	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	46	205	Domain	Note=E1;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	46	139	Region	Note=GFLD subdomain;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q06481	308	363	136	364	Alternative sequence	ID=VSP_030921;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q06481	308	363	308	363	Alternative sequence	ID=VSP_000018;Note=In isoform 2 and isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:7651835;Dbxref=PMID:7651835
Q06481	308	363	325	329	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	334	338	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	308	363	310	360	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	319	343	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	335	356	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	306	364	Domain	Note=BPTI/Kunitz inhibitor;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	345	347	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	353	359	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	320	321	Site	Note=Reactive bond;Ontology_term=ECO:0000250;evidence=ECO:0000250
Q06481	308	363	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q06481	308	363	330	333	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	613	624	613	624	Alternative sequence	ID=VSP_000019;Note=In isoform 3%2C isoform 4%2C isoform 5 and isoform 6. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334,ECO:0000303\|PubMed:7651835;Dbxref=PMID:14702039,PMID:154893
Q06481	613	624	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	613	624	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255

Lost protein functional features of individual exon skipping events in Mayo.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q06481	35	93	1	35	Alternative sequence	ID=VSP_046881;Note=In isoform 6. MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIE->MLRAPGELPRQAARCSLCRLGPGRGRAFFKWRCLPASVDRGNPLW;Ontology_term=ECO:0000305;evidence=ECO:0000305
Q06481	35	93	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	35	93	56	80	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	91	133	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	46	205	Domain	Note=E1;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	46	139	Region	Note=GFLD subdomain;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01217
Q06481	35	93	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q06481	308	363	136	364	Alternative sequence	ID=VSP_030921;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q06481	308	363	308	363	Alternative sequence	ID=VSP_000018;Note=In isoform 2 and isoform 4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:7651835;Dbxref=PMID:7651835
Q06481	308	363	325	329	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	334	338	Beta strand	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	308	363	310	360	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	319	343	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	335	356	Disulfide bond	Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	306	364	Domain	Note=BPTI/Kunitz inhibitor;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU00031
Q06481	308	363	345	347	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	353	359	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	308	363	320	321	Site	Note=Reactive bond;Ontology_term=ECO:0000250;evidence=ECO:0000250
Q06481	308	363	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q06481	308	363	330	333	Turn	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5JBT
Q06481	562	612	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	562	612	373	564	Domain	Note=E2;Ontology_term=ECO:0000255;evidence=ECO:0000255\|PROSITE-ProRule:PRU01218
Q06481	562	612	558	566	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5TPT
Q06481	562	612	590	590	Modified residue	Note=Phosphoserine%3B by FAM20C;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:26091039;Dbxref=PMID:26091039
Q06481	562	612	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q06481	613	624	613	624	Alternative sequence	ID=VSP_000019;Note=In isoform 3%2C isoform 4%2C isoform 5 and isoform 6. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:14702039,ECO:0000303\|PubMed:15489334,ECO:0000303\|PubMed:7651835;Dbxref=PMID:14702039,PMID:154893
Q06481	613	624	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	613	624	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255
Q06481	653	678	32	763	Chain	ID=PRO_0000000207;Note=Amyloid-like protein 2
Q06481	653	678	32	692	Topological domain	Note=Extracellular;Ontology_term=ECO:0000255;evidence=ECO:0000255

Top

3'-UTR located exon skipping events that lost miRNA binding sites in APLP2

3'-UTR exon skipping evnets lost miRNA binding.

Tissue type

ENST

Exon skip start

Exon skip end

microRNA

Binding site by TargetScan

Binding type by TargetScan

Bdinding site by miRanda

Score of miRanda

Energy by miRanda

Top

SNVs in the skipped exons for APLP2

- Differential PSIs between mutated versus non-mutated samples.

- Depth of Coverage in the skipped exon of the mutated samples.

- Sashimi plot in the skipped exon of the mutated samples.

- Non-synonymous mutations located in the skipped exons.

Cancer type

Sample

ESID

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

- Non-synonymous mutations located in the skipped exons in CCLE.

Sample

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

Top

AD stage-associated exon skippint events for APLP2

Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR).

AD stage info

Cohort

Tissue

SE id

Coefficient

P-value

Chromosome

Strand

E1 start

E1 end

Skipped start

Skipped end

E2 start

E2 end

CDR

MSBB

STG

exon_skip_283596

-3.381985e-01

9.143710e-04

chr11

130135563

130135715

130137256

130137291

130140398

130140483

Top

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for APLP2

sQTL information located at the skipped exons.

Tissue type	Exon skip ID	SNP id	Location	P-value	FDR
DLPFC	exon_skip_35754	rs3819105	chr11:130129842	1.419564e-04	1.142236e-02
DLPFC	exon_skip_35754	rs7483775	chr11:130138401	1.419564e-04	1.142236e-02

Top

Correlation with RNA binding proteins (RBPs) for APLP2

Correlated RBP and related information.

Tissue type	RBP name	Exon skip ID	Correlation coeifficient	P-value
CB	TARDBP	exon_skip_35754	4.394372e-01	6.835703e-09
CB	ZNF638	exon_skip_35754	4.377435e-01	7.926410e-09
CB	FUBP1	exon_skip_35754	4.449621e-01	4.193666e-09
CB	RBM4	exon_skip_35754	5.625726e-01	1.188449e-14
CB	RBM4B	exon_skip_35754	4.378082e-01	7.881786e-09
CB	TARDBP	exon_skip_18471	-5.342864e-01	4.073120e-13
CB	PCBP1	exon_skip_18471	-6.554739e-01	6.926761e-21
CB	PCBP4	exon_skip_18471	5.240332e-01	1.354664e-12
CB	TRA2A	exon_skip_18471	-6.072076e-01	2.157020e-17
CB	SRSF1	exon_skip_18471	-4.375817e-01	8.038944e-09
CB	PCBP2	exon_skip_173272	6.010487e-01	5.465819e-17
CB	NUP42	exon_skip_173272	6.343126e-01	2.805230e-19
CB	HNRNPL	exon_skip_173272	4.294058e-01	1.623645e-08
DLPFC	G3BP2	exon_skip_35754	4.366074e-01	2.134896e-17
DLPFC	PCBP2	exon_skip_74872	6.067815e-01	6.237782e-26
DLPFC	NUP42	exon_skip_74872	6.173887e-01	4.970692e-27
DLPFC	HNRNPL	exon_skip_74872	7.177942e-01	6.337384e-40
DLPFC	PABPC4	exon_skip_74872	5.013190e-01	6.224640e-17
FL	PCBP2	exon_skip_283596	4.140162e-01	1.212401e-09
FL	NUP42	exon_skip_283596	5.051669e-01	2.759563e-14
FL	HNRNPL	exon_skip_283596	5.864376e-01	8.970581e-20
HCC	RBMS2	exon_skip_35754	-5.004283e-01	1.042902e-18
HCC	SFPQ	exon_skip_35754	-4.840037e-01	1.941815e-17
HCC	ZNF638	exon_skip_35754	-4.963166e-01	2.200902e-18
HCC	TIA1	exon_skip_35754	-4.911009e-01	5.595173e-18
HCC	RBM5	exon_skip_35754	-5.222434e-01	1.667803e-20
HCC	TRNAU1AP	exon_skip_35754	-4.406382e-01	2.143738e-14
HCC	FUBP3	exon_skip_35754	-4.123089e-01	1.251874e-12
HCC	FUBP1	exon_skip_35754	-4.183681e-01	5.414133e-13
HCC	RBM4	exon_skip_35754	-4.407751e-01	2.100040e-14
HCC	RBM4B	exon_skip_35754	-4.843906e-01	1.815796e-17
HCC	IGF2BP2	exon_skip_283596	-4.146099e-01	9.123879e-13
HCC	PABPC4	exon_skip_283596	-4.650275e-01	4.709824e-16
IFG	SFPQ	exon_skip_35754	-4.030391e-01	3.345422e-02
IFG	ZNF638	exon_skip_35754	-5.413341e-01	2.931349e-03
IFG	CNOT4	exon_skip_35754	-4.187761e-01	2.655489e-02
IFG	TIA1	exon_skip_35754	-4.790738e-01	9.900340e-03
IFG	G3BP2	exon_skip_35754	4.603406e-01	1.370086e-02
IFG	FUBP3	exon_skip_35754	-4.008072e-01	3.453994e-02
IFG	IGF2BP3	exon_skip_283596	-5.407272e-01	2.969679e-03
IFG	IGF2BP2	exon_skip_283596	-5.473206e-01	2.575462e-03
IFG	TRA2A	exon_skip_283596	-4.979433e-01	7.007770e-03
IFG	PABPC4	exon_skip_283596	-4.149985e-01	2.809499e-02
PCC	RBMS2	exon_skip_35754	-4.992518e-01	5.931188e-15
PCC	TRNAU1AP	exon_skip_35754	-4.007768e-01	1.061284e-09
PG	IGF2BP2	exon_skip_283596	-4.332181e-01	6.326607e-11
PG	NUP42	exon_skip_283596	4.406942e-01	2.709243e-11
PG	HNRNPL	exon_skip_283596	5.481323e-01	1.040529e-17
STG	ELAVL4	exon_skip_35754	4.065341e-01	5.265186e-05
STG	G3BP2	exon_skip_35754	4.566863e-01	4.200882e-06
STG	RALYL	exon_skip_35754	4.447659e-01	7.948685e-06
STG	IGF2BP2	exon_skip_283596	-4.578350e-01	3.945454e-06
STG	NUP42	exon_skip_283596	5.981947e-01	2.422310e-10
STG	HNRNPL	exon_skip_283596	5.796140e-01	1.146458e-09
TC	ELAVL4	exon_skip_149113	6.583514e-01	3.070608e-21
TC	G3BP2	exon_skip_149113	6.283857e-01	5.831172e-19
TC	RBM24	exon_skip_149113	6.136634e-01	6.268078e-18
TC	PUM1	exon_skip_149113	5.887752e-01	2.649690e-16
TC	HNRNPD	exon_skip_149113	5.447171e-01	9.612454e-14
TC	NUP42	exon_skip_149113	5.391201e-01	1.913410e-13
TC	RALYL	exon_skip_149113	6.737650e-01	1.625492e-22
TC	CELF1	exon_skip_149113	5.243126e-01	1.113535e-12
TC	NUP42	exon_skip_48510	7.291916e-01	8.065666e-28
TC	HNRNPL	exon_skip_48510	4.589690e-01	1.034403e-09

Top

RelatedDrugs for APLP2

Approved drugs targeting this gene.
(DrugBank Version 5.1.0 2018-04-02)

UniProtAcc

DrugBank ID

Drug name

Drug activity

Drug type

Drug status

Top

RelatedDiseases for APLP2

Diseases associated with this gene.
(DisGeNet 4.0)

Gene

Disease ID

Disease name

# pubmeds

Source

	Gene summary
	Gene structures and expression levels
	Exon skipping events with PSIs in RPSMAP, MSBB, and Mayo
	Open reading frame (ORF) annotation in the exon skipping event
	Exon skipping events in the canonical protein sequence
	3'-UTR located exon skipping events lost miRNA binding sites
	SNVs in the skipped exons with depth of coverage
	AD stage-associated exon skipping events
	Splicing Quantitative Trait Loci (sQTLs) in the skipped exons
	Correlation with RNA binding proteins (RBPs)
	Related drugs with this gene
	Related diseases with this gene

Home

Download

Statistics

Landscape

Help

Contact