|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for HNRNPC |
 Gene summary |
| Gene information | Gene symbol | HNRNPC | Gene ID | 3183 |
| Gene name | heterogeneous nuclear ribonucleoprotein C | |
| Synonyms | C1|C2|HNRNP|HNRPC|SNRPC | |
| Cytomap | 14q11.2 | |
| Type of gene | protein-coding | |
| Description | heterogeneous nuclear ribonucleoproteins C1/C2heterogeneous nuclear ribonucleoprotein C (C1/C2)hnRNP C1/C2nuclear ribonucleoprotein particle C1 proteinnuclear ribonucleoprotein particle C2 protein | |
| Modification date | 20200322 | |
| UniProtAcc | B2R5W2, B4DSU6, B4DY08, | |
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for HNRNPC |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000092199
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| HCC | DOWN | ENST00000557201.5 | HNRNPC-230:protein_coding:HNRNPC | 5.120225e+01 | -1.613164e+00 | 3.646710e-05 | 3.489625e-03 |
| PG | UP | ENST00000553444.1 | HNRNPC-206:retained_intron:HNRNPC | 4.978943e+01 | 1.202471e+00 | 2.417871e-03 | 2.731539e-02 |
| CB | DOWN | ENST00000553444.1 | HNRNPC-206:retained_intron:HNRNPC | 1.685981e+02 | -2.842080e+00 | 2.381952e-11 | 1.965298e-09 |
| CB | DOWN | ENST00000449098.5 | HNRNPC-204:protein_coding:HNRNPC | 3.502490e+02 | -2.033851e+00 | 8.259174e-10 | 3.725269e-08 |
| CB | UP | ENST00000554383.5 | HNRNPC-209:protein_coding:HNRNPC | 5.169810e+01 | 1.047428e+00 | 1.032472e-08 | 3.088877e-07 |
| TC | DOWN | ENST00000553444.1 | HNRNPC-206:retained_intron:HNRNPC | 1.029205e+02 | -3.351429e+00 | 1.763938e-17 | 2.726294e-14 |
| TC | UP | ENST00000554383.5 | HNRNPC-209:protein_coding:HNRNPC | 5.922212e+01 | 1.059435e+00 | 1.678255e-12 | 5.814965e-10 |
| TC | DOWN | ENST00000449098.5 | HNRNPC-204:protein_coding:HNRNPC | 2.039967e+02 | -1.599581e+00 | 3.285969e-05 | 6.633472e-04 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for HNRNPC |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_101734 | chr14 | 21234219:21234229:21263311:21263582:21269298:21269330 | 21263311:21263582 |
| exon_skip_105678 | chr14 | 21211810:21211923:21212960:21213117:21230319:21230366 | 21212960:21213117 |
| exon_skip_107696 | chr14 | 21230997:21231072:21233953:21234229:21269298:21269389 | 21233953:21234229 |
| exon_skip_119128 | chr14 | 21234219:21234229:21263311:21263582:21269298:21269425 | 21263311:21263582 |
| exon_skip_120776 | chr14 | 21211287:21211306:21211406:21211563:21211810:21211903 | 21211406:21211563 |
| exon_skip_125713 | chr14 | 21263313:21263336:21263667:21263829:21269298:21269389 | 21263667:21263829 |
| exon_skip_132482 | chr14 | 21213105:21213117:21230319:21230366:21230958:21231072 | 21230319:21230366 |
| exon_skip_139017 | chr14 | 21234219:21234229:21263311:21263336:21269298:21269330 | 21263311:21263336 |
| exon_skip_140830 | chr14 | 21234219:21234229:21263311:21263336:21269298:21269389 | 21263311:21263336 |
| exon_skip_143610 | chr14 | 21211256:21211306:21211406:21211563:21211810:21211830 | 21211406:21211563 |
| exon_skip_145330 | chr14 | 21233995:21234229:21254547:21254593:21263311:21263336 | 21254547:21254593 |
| exon_skip_146385 | chr14 | 21213105:21213117:21230319:21230366:21230997:21231027 | 21230319:21230366 |
| exon_skip_158050 | chr14 | 21263311:21263336:21263667:21263829:21269298:21269330 | 21263667:21263829 |
| exon_skip_16406 | chr14 | 21234219:21234229:21236373:21236460:21263311:21263336 | 21236373:21236460 |
| exon_skip_165269 | chr14 | 21263311:21263336:21263667:21263829:21269298:21269389 | 21263667:21263829 |
| exon_skip_169555 | chr14 | 21211256:21211306:21211406:21211566:21211810:21211830 | 21211406:21211566 |
| exon_skip_216152 | chr14 | 21234219:21234229:21262601:21262768:21263311:21263336 | 21262601:21262768 |
| exon_skip_248861 | chr14 | 21233953:21234229:21234769:21234831:21263311:21263336 | 21234769:21234831 |
| exon_skip_251278 | chr14 | 21234219:21234229:21254547:21254593:21263311:21263336 | 21254547:21254593 |
| exon_skip_261852 | chr14 | 21210933:21211306:21211406:21211566:21211810:21211923 | 21211406:21211566 |
| exon_skip_273426 | chr14 | 21234219:21234229:21263311:21263582:21269298:21269389 | 21263311:21263582 |
| exon_skip_28538 | chr14 | 21211256:21211306:21211406:21211563:21211810:21211903 | 21211406:21211563 |
| exon_skip_290859 | chr14 | 21211287:21211306:21211406:21211566:21211810:21211923 | 21211406:21211566 |
| exon_skip_39349 | chr14 | 21230997:21231072:21233953:21234229:21263311:21263336 | 21233953:21234229 |
| exon_skip_39539 | chr14 | 21263311:21263336:21268623:21268668:21269298:21269330 | 21268623:21268668 |
| exon_skip_5949 | chr14 | 21211287:21211306:21211406:21211566:21211810:21211903 | 21211406:21211566 |
| exon_skip_63904 | chr14 | 21211256:21211306:21211406:21211566:21211810:21211903 | 21211406:21211566 |
| exon_skip_64559 | chr14 | 21211287:21211306:21211406:21211563:21211810:21211923 | 21211406:21211563 |
| exon_skip_64719 | chr14 | 21210933:21211306:21211406:21211563:21211810:21211923 | 21211406:21211563 |
| exon_skip_9941 | chr14 | 21263311:21263336:21268623:21268668:21269298:21269389 | 21268623:21268668 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for HNRNPC |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000554455 | 21233953 | 21234229 | 3UTR-3CDS |
| ENST00000557201 | 21233953 | 21234229 | 3UTR-3CDS |
| ENST00000554455 | 21263311 | 21263336 | 3UTR-3UTR |
| ENST00000420743 | 21263667 | 21263829 | 3UTR-3UTR |
| ENST00000420743 | 21211406 | 21211566 | Frame-shift |
| ENST00000554455 | 21211406 | 21211566 | Frame-shift |
| ENST00000557201 | 21211406 | 21211566 | Frame-shift |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000554455 | 21263311 | 21263336 | 3UTR-3UTR |
| ENST00000420743 | 21263667 | 21263829 | 3UTR-3UTR |
| ENST00000420743 | 21211406 | 21211566 | Frame-shift |
| ENST00000554455 | 21211406 | 21211566 | Frame-shift |
| ENST00000557201 | 21211406 | 21211566 | Frame-shift |
| ENST00000420743 | 21212960 | 21213117 | Frame-shift |
| ENST00000554455 | 21212960 | 21213117 | Frame-shift |
| ENST00000557201 | 21212960 | 21213117 | Frame-shift |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000557201 | 21233953 | 21234229 | 3UTR-3CDS |
| ENST00000420743 | 21262601 | 21262768 | 3UTR-3UTR |
| ENST00000554455 | 21263311 | 21263336 | 3UTR-3UTR |
| ENST00000420743 | 21263667 | 21263829 | 3UTR-3UTR |
| ENST00000420743 | 21211406 | 21211566 | Frame-shift |
| ENST00000554455 | 21211406 | 21211566 | Frame-shift |
| ENST00000557201 | 21211406 | 21211566 | Frame-shift |
| ENST00000420743 | 21212960 | 21213117 | Frame-shift |
| ENST00000554455 | 21212960 | 21213117 | Frame-shift |
| ENST00000557201 | 21212960 | 21213117 | Frame-shift |
| ENST00000420743 | 21230319 | 21230366 | In-frame |
| ENST00000554455 | 21230319 | 21230366 | In-frame |
| ENST00000557201 | 21230319 | 21230366 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for HNRNPC |
p-ENSG00000092199_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000420743 | 1576 | 306 | 21230319 | 21230366 | 878 | 924 | 119 | 134 |
| ENST00000554455 | 1801 | 306 | 21230319 | 21230366 | 547 | 593 | 119 | 134 |
| ENST00000557201 | 1388 | 306 | 21230319 | 21230366 | 521 | 567 | 119 | 134 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P07910 | 119 | 134 | 39 | 119 | Alternative sequence | ID=VSP_019225;Note=In isoform 3. KYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLS->N;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.3 |
| P07910 | 119 | 134 | 39 | 119 | Alternative sequence | ID=VSP_019225;Note=In isoform 3. KYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLS->N;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.3 |
| P07910 | 119 | 134 | 39 | 119 | Alternative sequence | ID=VSP_019225;Note=In isoform 3. KYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLS->N;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.3 |
| P07910 | 119 | 134 | 108 | 120 | Alternative sequence | ID=VSP_005831;Note=In isoform C1 and isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:15489334,ECO:0000303|PubMed:3110598,ECO:0000303|Ref.3;Dbxref=PMID:15489334,PMID:3110598 |
| P07910 | 119 | 134 | 108 | 120 | Alternative sequence | ID=VSP_005831;Note=In isoform C1 and isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:15489334,ECO:0000303|PubMed:3110598,ECO:0000303|Ref.3;Dbxref=PMID:15489334,PMID:3110598 |
| P07910 | 119 | 134 | 108 | 120 | Alternative sequence | ID=VSP_005831;Note=In isoform C1 and isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:15489334,ECO:0000303|PubMed:3110598,ECO:0000303|Ref.3;Dbxref=PMID:15489334,PMID:3110598 |
| P07910 | 119 | 134 | 2 | 306 | Chain | ID=PRO_0000081844;Note=Heterogeneous nuclear ribonucleoproteins C1/C2 |
| P07910 | 119 | 134 | 2 | 306 | Chain | ID=PRO_0000081844;Note=Heterogeneous nuclear ribonucleoproteins C1/C2 |
| P07910 | 119 | 134 | 2 | 306 | Chain | ID=PRO_0000081844;Note=Heterogeneous nuclear ribonucleoproteins C1/C2 |
| P07910 | 119 | 134 | 121 | 121 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9Z204 |
| P07910 | 119 | 134 | 121 | 121 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9Z204 |
| P07910 | 119 | 134 | 121 | 121 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000250;evidence=ECO:0000250|UniProtKB:Q9Z204 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in HNRNPC |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
| Mayo | ENST00000420743 | 21263667 | 21263829 | hsa-miR-552-5p | chr14:21263775-21263782 | 8mer-1a | chr14:21263774-21263797 | 162.00 | -19.92 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-7152-5p | chr14:21262723-21262730 | 8mer-1a | chr14:21262717-21262740 | 150.00 | -18.99 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-5006-3p | chr14:21262747-21262754 | 8mer-1a | chr14:21262729-21262754 | 156.00 | -27.70 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-623 | chr14:21262746-21262753 | 8mer-1a | chr14:21262729-21262754 | 156.00 | -27.70 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-631 | chr14:21262647-21262654 | 8mer-1a | chr14:21262646-21262669 | 159.00 | -23.42 |
| Mayo | ENST00000420743 | 21263667 | 21263829 | hsa-miR-3680-5p | chr14:21263799-21263806 | 8mer-1a | chr14:21263791-21263811 | 140.00 | -22.56 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-4780 | chr14:21262745-21262752 | 8mer-1a | chr14:21262729-21262754 | 156.00 | -27.70 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-4755-5p | chr14:21262747-21262754 | 8mer-1a | chr14:21262729-21262754 | 156.00 | -27.70 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-3661 | chr14:21262647-21262654 | 8mer-1a | chr14:21262646-21262669 | 159.00 | -23.42 |
| Mayo | ENST00000420743 | 21263667 | 21263829 | hsa-miR-340-5p | chr14:21263718-21263725 | 8mer-1a | chr14:21263709-21263737 | 155.00 | -19.96 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-486-5p | chr14:21262721-21262728 | 8mer-1a | chr14:21262710-21262728 | 155.00 | -27.29 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-6081 | chr14:21262667-21262674 | 8mer-1a | chr14:21262651-21262674 | 170.00 | -28.76 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-660-3p | chr14:21262755-21262762 | 8mer-1a | chr14:21262742-21262762 | 158.00 | -17.62 |
| Mayo | ENST00000420743 | 21262601 | 21262768 | hsa-miR-505-5p | chr14:21262642-21262649 | 8mer-1a | chr14:21262641-21262658 | 155.00 | -22.33 |
| Mayo | ENST00000420743 | 21263667 | 21263829 | hsa-miR-891b | chr14:21263692-21263699 | 8mer-1a | chr14:21263690-21263710 | 163.00 | -12.39 |
| MSBB | ENST00000420743 | 21263667 | 21263829 | hsa-miR-552-5p | chr14:21263775-21263782 | 8mer-1a | chr14:21263774-21263797 | 162.00 | -19.92 |
| MSBB | ENST00000420743 | 21263667 | 21263829 | hsa-miR-3680-5p | chr14:21263799-21263806 | 8mer-1a | chr14:21263791-21263811 | 140.00 | -22.56 |
| MSBB | ENST00000420743 | 21263667 | 21263829 | hsa-miR-340-5p | chr14:21263718-21263725 | 8mer-1a | chr14:21263709-21263737 | 155.00 | -19.96 |
| MSBB | ENST00000420743 | 21263667 | 21263829 | hsa-miR-891b | chr14:21263692-21263699 | 8mer-1a | chr14:21263690-21263710 | 163.00 | -12.39 |
| ROSMAP | ENST00000420743 | 21263667 | 21263829 | hsa-miR-552-5p | chr14:21263775-21263782 | 8mer-1a | chr14:21263774-21263797 | 162.00 | -19.92 |
| ROSMAP | ENST00000420743 | 21263667 | 21263829 | hsa-miR-3680-5p | chr14:21263799-21263806 | 8mer-1a | chr14:21263791-21263811 | 140.00 | -22.56 |
| ROSMAP | ENST00000420743 | 21263667 | 21263829 | hsa-miR-340-5p | chr14:21263718-21263725 | 8mer-1a | chr14:21263709-21263737 | 155.00 | -19.96 |
| ROSMAP | ENST00000420743 | 21263667 | 21263829 | hsa-miR-891b | chr14:21263692-21263699 | 8mer-1a | chr14:21263690-21263710 | 163.00 | -12.39 |
Top |
SNVs in the skipped exons for HNRNPC |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for HNRNPC |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
| ADstage | MSBB | IFG | exon_skip_157099 | 4.443558e-01 | 1.783621e-02 | chr14 | - | 21234219 | 21234229 | 21263311 | 21263829 | 21269298 | 21269389 |
| ADstage | ROSMAP | PCC | exon_skip_140830 | 3.093297e-01 | 3.780000e-06 | chr14 | - | 21234219 | 21234229 | 21263311 | 21263336 | 21269298 | 21269389 |
| CDR | MSBB | IFG | exon_skip_157099 | 4.084000e-01 | 3.095835e-02 | chr14 | - | 21234219 | 21234229 | 21263311 | 21263829 | 21269298 | 21269389 |
| CDR | MSBB | IFG | exon_skip_140830 | 4.010038e-01 | 3.444316e-02 | chr14 | - | 21234219 | 21234229 | 21263311 | 21263336 | 21269298 | 21269389 |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for HNRNPC |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for HNRNPC |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
| CB | ELAVL1 | exon_skip_140830 | 4.220966e-01 | 2.996777e-08 |
| CB | U2AF2 | exon_skip_140830 | 4.976350e-01 | 2.499419e-11 |
| CB | HNRNPC | exon_skip_140830 | 4.038187e-01 | 1.303708e-07 |
| CB | SRSF2 | exon_skip_157099 | 4.180540e-01 | 4.179968e-08 |
| CB | ELAVL1 | exon_skip_157099 | 4.028376e-01 | 1.407305e-07 |
| CB | TIA1 | exon_skip_157099 | 4.956774e-01 | 3.072338e-11 |
| CB | HNRNPK | exon_skip_157099 | 5.043945e-01 | 1.213222e-11 |
| CB | PCBP2 | exon_skip_157099 | 4.879174e-01 | 6.874426e-11 |
| CB | SF1 | exon_skip_157099 | 4.480068e-01 | 3.191751e-09 |
| CB | KHSRP | exon_skip_157099 | 4.009514e-01 | 1.629047e-07 |
| CB | HNRNPDL | exon_skip_157099 | 4.283291e-01 | 1.778669e-08 |
| CB | HNRNPD | exon_skip_157099 | 4.601652e-01 | 1.044192e-09 |
| CB | RALYL | exon_skip_157099 | 4.785886e-01 | 1.763061e-10 |
| CB | PTBP3 | exon_skip_157099 | 4.179156e-01 | 4.227538e-08 |
| CB | CPEB4 | exon_skip_157099 | 4.355109e-01 | 9.622501e-09 |
| CB | CELF1 | exon_skip_157099 | 4.943241e-01 | 3.540781e-11 |
| CB | RBM23 | exon_skip_157099 | 4.126638e-01 | 6.470460e-08 |
| CB | CPEB1 | exon_skip_157099 | 4.807443e-01 | 1.421803e-10 |
| CB | EWSR1 | exon_skip_157099 | 4.795830e-01 | 1.596797e-10 |
| CB | SRSF9 | exon_skip_157099 | 5.074984e-01 | 8.659246e-12 |
| CB | EIF4B | exon_skip_157099 | 4.622531e-01 | 8.580721e-10 |
| CB | RBM41 | exon_skip_157099 | 4.871970e-01 | 7.400533e-11 |
| FL | SRSF2 | exon_skip_141096 | -4.460764e-01 | 1.571310e-10 |
| FL | MSI1 | exon_skip_141096 | 4.569442e-01 | 4.910095e-11 |
| FL | MATR3 | exon_skip_141096 | -4.688389e-01 | 1.310371e-11 |
| FL | ILF2 | exon_skip_141096 | -4.314264e-01 | 7.073530e-10 |
| FL | HNRNPK | exon_skip_141096 | -4.374854e-01 | 3.829860e-10 |
| FL | G3BP2 | exon_skip_141096 | -4.620600e-01 | 2.799323e-11 |
| FL | KHDRBS3 | exon_skip_141096 | -4.297153e-01 | 8.393457e-10 |
| FL | FUBP1 | exon_skip_141096 | -4.404930e-01 | 2.811599e-10 |
| FL | HNRNPA0 | exon_skip_141096 | -4.569184e-01 | 4.923868e-11 |
| FL | HNRNPC | exon_skip_141096 | -4.567887e-01 | 4.993949e-11 |
| FL | RALYL | exon_skip_141096 | -4.440473e-01 | 1.943692e-10 |
| FL | EIF4B | exon_skip_141096 | -4.072042e-01 | 7.306657e-09 |
| FL | ZCRB1 | exon_skip_141096 | -4.050312e-01 | 8.929278e-09 |
| FL | SRSF2 | exon_skip_157099 | -4.274044e-01 | 8.586128e-10 |
| FL | MSI1 | exon_skip_157099 | 4.713067e-01 | 7.660054e-12 |
| FL | TIA1 | exon_skip_157099 | -4.214233e-01 | 1.552550e-09 |
| FL | HNRNPK | exon_skip_157099 | -4.298070e-01 | 6.745834e-10 |
| FL | FUBP1 | exon_skip_157099 | -4.579926e-01 | 3.442875e-11 |
| FL | HNRNPC | exon_skip_157099 | -4.582552e-01 | 3.344400e-11 |
| FL | RALYL | exon_skip_157099 | -4.135772e-01 | 3.318685e-09 |
| FL | SRSF9 | exon_skip_157099 | -4.684125e-01 | 1.067867e-11 |
| HCC | RBM3 | exon_skip_141096 | -4.089875e-01 | 1.967979e-12 |
| IFG | RBM24 | exon_skip_140830 | 4.179592e-01 | 2.688199e-02 |
| IFG | PTBP3 | exon_skip_157099 | -4.640615e-01 | 1.286245e-02 |
| PCC | RBM47 | exon_skip_141096 | 4.183951e-01 | 1.606557e-10 |
| PCC | RBM47 | exon_skip_176269 | 4.106302e-01 | 3.742436e-10 |
| PG | TARDBP | exon_skip_157099 | -4.088027e-01 | 1.216639e-08 |
| PG | SRSF2 | exon_skip_157099 | -4.028291e-01 | 2.067872e-08 |
| PG | ELAVL4 | exon_skip_157099 | -4.033023e-01 | 1.983542e-08 |
| PG | TIA1 | exon_skip_157099 | -4.236717e-01 | 3.103012e-09 |
| PG | RBM3 | exon_skip_157099 | -4.744224e-01 | 1.722012e-11 |
| PG | HNRNPK | exon_skip_157099 | -4.022517e-01 | 2.175465e-08 |
| PG | KHDRBS2 | exon_skip_157099 | -4.794054e-01 | 9.860641e-12 |
| PG | KHDRBS3 | exon_skip_157099 | -4.398601e-01 | 6.488789e-10 |
| PG | RBM24 | exon_skip_157099 | -4.110508e-01 | 9.937811e-09 |
| PG | FUBP1 | exon_skip_157099 | -4.577284e-01 | 1.045577e-10 |
| PG | HNRNPC | exon_skip_157099 | -4.377303e-01 | 8.009994e-10 |
| PG | RALYL | exon_skip_157099 | -4.197126e-01 | 4.493767e-09 |
| PG | HNRNPL | exon_skip_157099 | -4.238389e-01 | 3.054544e-09 |
| PG | CPEB4 | exon_skip_157099 | -4.359057e-01 | 9.582848e-10 |
| PG | SRSF1 | exon_skip_157099 | -4.193698e-01 | 4.639114e-09 |
| PG | SRSF9 | exon_skip_157099 | -4.694126e-01 | 2.989283e-11 |
| PG | EIF4B | exon_skip_157099 | -4.669938e-01 | 3.888969e-11 |
| PG | NOVA1 | exon_skip_157099 | -4.186075e-01 | 4.978873e-09 |
| TC | ELAVL4 | exon_skip_157099 | -4.636684e-01 | 6.630072e-10 |
| TC | KHDRBS2 | exon_skip_157099 | -4.400426e-01 | 5.803229e-09 |
| TC | RALYL | exon_skip_157099 | -4.388971e-01 | 6.420221e-09 |
| TC | ESRP1 | exon_skip_157099 | -4.562757e-01 | 1.330709e-09 |
Top |
RelatedDrugs for HNRNPC |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for HNRNPC |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|