|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for BRD4 |
 Gene summary |
| Gene information | Gene symbol | BRD4 | Gene ID | 23476 |
| Gene name | bromodomain containing 4 | |
| Synonyms | CAP|HUNK1|HUNKI|MCAP | |
| Cytomap | 19p13.12 | |
| Type of gene | protein-coding | |
| Description | bromodomain-containing protein 4chromosome-associated proteinmitotic chromosome-associated protein | |
| Modification date | 20200329 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| BRD4 | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter | 19103749|23086925 |
| BRD4 | GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling | 19103749 |
| BRD4 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 23086925|23317504|24360279 |
| BRD4 | GO:0050727 | regulation of inflammatory response | 19103749 |
| BRD4 | GO:1901407 | regulation of phosphorylation of RNA polymerase II C-terminal domain | 23086925 |
Top |
Gene structures and expression levels for BRD4 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000141867
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| CB | UP | ENST00000594841.5 | BRD4-205:protein_coding:BRD4 | 1.339844e+01 | 1.053418e+00 | 1.640859e-04 | 1.126561e-03 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for BRD4 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_101504 | chr19 | 15239910:15240022:15242900:15243487:15244231:15244600 | 15242900:15243487 |
| exon_skip_162361 | chr19 | 15244231:15244600:15244710:15244762:15254152:15254262 | 15244710:15244762 |
| exon_skip_186826 | chr19 | 15269013:15269042:15272815:15273133:15332290:15332443 | 15272815:15273133 |
| exon_skip_227672 | chr19 | 15267514:15267551:15268154:15268281:15268905:15269042 | 15268154:15268281 |
| exon_skip_57926 | chr19 | 15256964:15257173:15263420:15263548:15264404:15264766 | 15263420:15263548 |
| exon_skip_58906 | chr19 | 15267514:15267551:15268154:15268240:15268905:15269042 | 15268154:15268240 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for BRD4 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000263377 | 15244710 | 15244762 | Frame-shift |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000263377 | 15244710 | 15244762 | Frame-shift |
| ENST00000263377 | 15242900 | 15243487 | In-frame |
| ENST00000263377 | 15263420 | 15263548 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for BRD4 |
p-ENSG00000141867_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000263377 | 7186 | 1362 | 15263420 | 15263548 | 1435 | 1562 | 404 | 446 |
| ENST00000263377 | 7186 | 1362 | 15242900 | 15243487 | 2804 | 3390 | 860 | 1056 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| O60885 | 404 | 446 | 412 | 414 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2MJV |
| O60885 | 404 | 446 | 435 | 437 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2I8N |
| O60885 | 404 | 446 | 433 | 433 | Binding site | Note=Acetylated histones;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22464331;Dbxref=PMID:22464331 |
| O60885 | 404 | 446 | 433 | 433 | Binding site | Note=Inhibitor |
| O60885 | 404 | 446 | 1 | 1362 | Chain | ID=PRO_0000211183;Note=Bromodomain-containing protein 4 |
| O60885 | 404 | 446 | 368 | 440 | Domain | Note=Bromo 2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00035 |
| O60885 | 404 | 446 | 400 | 408 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4Z93 |
| O60885 | 404 | 446 | 415 | 432 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4Z93 |
| O60885 | 404 | 446 | 438 | 454 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4Z93 |
| O60885 | 404 | 446 | 433 | 433 | Mutagenesis | Note=Abolishes binding to acetylated histones. N->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:22464331;Dbxref=PMID:22464331 |
| O60885 | 860 | 1056 | 720 | 1362 | Alternative sequence | ID=VSP_047671;Note=In isoform B. EMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPP |
| O60885 | 860 | 1056 | 723 | 1362 | Alternative sequence | ID=VSP_010903;Note=In isoform C. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|Ref.2 |
| O60885 | 860 | 1056 | 1 | 1362 | Chain | ID=PRO_0000211183;Note=Bromodomain-containing protein 4 |
| O60885 | 860 | 1056 | 954 | 964 | Compositional bias | Note=Poly-Pro |
| O60885 | 860 | 1056 | 974 | 986 | Compositional bias | Note=Poly-Pro |
| O60885 | 860 | 1056 | 1011 | 1014 | Compositional bias | Note=Poly-Pro |
| O60885 | 860 | 1056 | 1028 | 1033 | Compositional bias | Note=Poly-Pro |
| O60885 | 860 | 1056 | 1050 | 1050 | Cross-link | Note=Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2);Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:28112733;Dbxref=PMID:28112733 |
| O60885 | 860 | 1056 | 1047 | 1362 | Region | Note=C-terminal (CTD) region |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in BRD4 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for BRD4 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for BRD4 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for BRD4 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for BRD4 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for BRD4 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for BRD4 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|