|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for FBXW11 |
 Gene summary |
| Gene information | Gene symbol | FBXW11 | Gene ID | 23291 |
| Gene name | F-box and WD repeat domain containing 11 | |
| Synonyms | BTRC2|BTRCP2|FBW1B|FBXW1B|Fbw11|Hos | |
| Cytomap | 5q35.1 | |
| Type of gene | protein-coding | |
| Description | F-box/WD repeat-containing protein 11F-box and WD repeats protein beta-TrCP2F-box and WD-40 domain protein 11F-box and WD-40 domain protein 1BF-box protein Fbw1bF-box/WD repeat-containing protein 1Bbeta-transducin repeat-containing protein 2homolog | |
| Modification date | 20200329 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| FBXW11 | GO:0000209 | protein polyubiquitination | 20347421 |
| FBXW11 | GO:0016567 | protein ubiquitination | 16885022 |
| FBXW11 | GO:0031146 | SCF-dependent proteasomal ubiquitin-dependent protein catabolic process | 20347421 |
| FBXW11 | GO:0043161 | proteasome-mediated ubiquitin-dependent protein catabolic process | 20347421 |
Top |
Gene structures and expression levels for FBXW11 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000072803
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| CB | UP | ENST00000519693.5 | FBXW11-207:nonsense_mediated_decay:FBXW11 | 4.512126e+01 | 9.601292e-01 | 5.406338e-09 | 1.795966e-07 |
| CB | UP | ENST00000393802.6 | FBXW11-203:protein_coding:FBXW11 | 1.776923e+02 | 1.322886e+00 | 7.498053e-08 | 1.664693e-06 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for FBXW11 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_107284 | chr5 | 171914343:171914405:171957597:171957698:171996890:171997051 | 171957597:171957698 |
| exon_skip_149530 | chr5 | 171914343:171914405:171957597:171957698:172006458:172006548 | 171957597:171957698 |
| exon_skip_174161 | chr5 | 171910734:171910797:171957597:171957698:172006458:172006548 | 171957597:171957698 |
| exon_skip_185925 | chr5 | 171899947:171900100:171910572:171910797:172006458:172006548 | 171910572:171910797 |
| exon_skip_196783 | chr5 | 171870748:171870858:171872872:171872990:171876285:171876291 | 171872872:171872990 |
| exon_skip_208855 | chr5 | 171910734:171910797:171914343:171914405:171977636:171977756 | 171914343:171914405 |
| exon_skip_226570 | chr5 | 171910734:171910797:172003181:172003310:172006458:172006548 | 172003181:172003310 |
| exon_skip_238171 | chr5 | 171914343:171914405:171996890:171997051:172006458:172006548 | 171996890:171997051 |
| exon_skip_240126 | chr5 | 171957597:171957698:171996890:171997051:172006458:172006548 | 171996890:171997051 |
| exon_skip_259865 | chr5 | 171910734:171910797:171914343:171914405:171957597:171957698 | 171914343:171914405 |
| exon_skip_264201 | chr5 | 171910734:171910797:171996890:171997051:172006458:172006548 | 171996890:171997051 |
| exon_skip_292126 | chr5 | 171878011:171878129:171891467:171891604:171899004:171899094 | 171891467:171891604 |
| exon_skip_4026 | chr5 | 171899947:171900100:171910572:171910797:171957597:171957698 | 171910572:171910797 |
| exon_skip_70081 | chr5 | 171910734:171910797:171914343:171914405:171996890:171997051 | 171914343:171914405 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
 |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
| exon_skip_149530 | Mayo_TC | 1.949367e-01 | 3.356250e-01 | -1.406883e-01 | 2.040787e-08 |
Top |
Open reading frame (ORF) annotation in the exon skipping event for FBXW11 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000265094 | 171910572 | 171910797 | Frame-shift |
| ENST00000265094 | 171957597 | 171957698 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000265094 | 171872872 | 171872990 | Frame-shift |
| ENST00000265094 | 171910572 | 171910797 | Frame-shift |
| ENST00000265094 | 171957597 | 171957698 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000265094 | 171872872 | 171872990 | Frame-shift |
| ENST00000265094 | 171891467 | 171891604 | In-frame |
| ENST00000265094 | 171957597 | 171957698 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for FBXW11 |
p-ENSG00000072803_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000265094 | 4359 | 542 | 171957597 | 171957698 | 184 | 284 | 15 | 48 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000265094 | 4359 | 542 | 171957597 | 171957698 | 184 | 284 | 15 | 48 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000265094 | 4359 | 542 | 171957597 | 171957698 | 184 | 284 | 15 | 48 |
| ENST00000265094 | 4359 | 542 | 171891467 | 171891604 | 790 | 926 | 217 | 262 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9UKB1 | 15 | 48 | 16 | 49 | Alternative sequence | ID=VSP_006765;Note=In isoform A. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9UKB1 | 15 | 48 | 16 | 48 | Alternative sequence | ID=VSP_006766;Note=In isoform B. CSVPRSLWLGCANLVESMCALSCLQSMPSVRCL->NTSVMEDQNEDESPKKNTLW;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UKB1 | 15 | 48 | 1 | 542 | Chain | ID=PRO_0000050981;Note=F-box/WD repeat-containing protein 11 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9UKB1 | 15 | 48 | 16 | 49 | Alternative sequence | ID=VSP_006765;Note=In isoform A. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9UKB1 | 15 | 48 | 16 | 48 | Alternative sequence | ID=VSP_006766;Note=In isoform B. CSVPRSLWLGCANLVESMCALSCLQSMPSVRCL->NTSVMEDQNEDESPKKNTLW;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UKB1 | 15 | 48 | 1 | 542 | Chain | ID=PRO_0000050981;Note=F-box/WD repeat-containing protein 11 |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9UKB1 | 15 | 48 | 16 | 49 | Alternative sequence | ID=VSP_006765;Note=In isoform A. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q9UKB1 | 15 | 48 | 16 | 48 | Alternative sequence | ID=VSP_006766;Note=In isoform B. CSVPRSLWLGCANLVESMCALSCLQSMPSVRCL->NTSVMEDQNEDESPKKNTLW;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UKB1 | 15 | 48 | 1 | 542 | Chain | ID=PRO_0000050981;Note=F-box/WD repeat-containing protein 11 |
| Q9UKB1 | 217 | 262 | 1 | 542 | Chain | ID=PRO_0000050981;Note=F-box/WD repeat-containing protein 11 |
| Q9UKB1 | 217 | 262 | 238 | 275 | Repeat | Note=WD 1 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in FBXW11 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for FBXW11 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for FBXW11 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for FBXW11 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for FBXW11 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
| CB | RBM6 | exon_skip_259865 | -4.786297e-01 | 8.222726e-08 |
| CB | TRA2A | exon_skip_259865 | -5.785708e-01 | 1.925231e-11 |
| CB | RBM45 | exon_skip_259865 | 6.420606e-01 | 1.802740e-14 |
| CB | NUP42 | exon_skip_259865 | 5.443615e-01 | 4.599559e-10 |
| CB | PABPC4 | exon_skip_259865 | 4.464997e-01 | 7.160012e-07 |
| CB | TRA2A | exon_skip_70081 | -4.023121e-01 | 1.584105e-06 |
| CB | RBM45 | exon_skip_70081 | 5.497354e-01 | 7.229221e-12 |
| CB | RBM6 | exon_skip_162996 | -4.252594e-01 | 1.468686e-07 |
| CB | TRA2A | exon_skip_162996 | -5.789455e-01 | 5.484411e-14 |
| CB | RBM45 | exon_skip_162996 | 6.468131e-01 | 4.547648e-18 |
| CB | NUP42 | exon_skip_162996 | 4.236215e-01 | 1.658358e-07 |
| CB | RBM4 | exon_skip_174355 | -5.414143e-01 | 2.446192e-10 |
| CB | RBM4 | exon_skip_174161 | -5.718984e-01 | 2.359665e-13 |
| CB | RBM4 | exon_skip_149530 | -5.136195e-01 | 2.321148e-09 |
| HCC | RBM4 | exon_skip_174161 | -4.537540e-01 | 1.164689e-14 |
| IFG | ELAVL4 | exon_skip_259865 | -5.357151e-01 | 6.975274e-03 |
| IFG | RBM6 | exon_skip_259865 | -4.368474e-01 | 3.280767e-02 |
| IFG | PCBP2 | exon_skip_259865 | -4.146348e-01 | 4.394937e-02 |
| IFG | RBM45 | exon_skip_259865 | -4.591237e-01 | 2.401747e-02 |
| IFG | RALYL | exon_skip_259865 | -6.027884e-01 | 1.823508e-03 |
| IFG | SRSF9 | exon_skip_259865 | -4.374731e-01 | 3.252999e-02 |
| IFG | SART3 | exon_skip_259865 | -4.769171e-01 | 1.845406e-02 |
| IFG | SART3 | exon_skip_70081 | -4.300308e-01 | 4.576160e-02 |
| IFG | IGF2BP2 | exon_skip_162996 | 4.044192e-01 | 3.640996e-02 |
| IFG | RBFOX2 | exon_skip_174161 | 6.354057e-01 | 3.691590e-04 |
| IFG | MBNL1 | exon_skip_174161 | 4.848023e-01 | 1.038015e-02 |
| IFG | HNRNPK | exon_skip_174161 | 4.866352e-01 | 1.005221e-02 |
| IFG | RBM24 | exon_skip_174161 | 4.655569e-01 | 1.439579e-02 |
| IFG | RALYL | exon_skip_174161 | 5.141288e-01 | 6.080526e-03 |
| IFG | SRSF5 | exon_skip_174161 | 6.485415e-01 | 2.534326e-04 |
| IFG | RBM23 | exon_skip_238171 | 4.174104e-01 | 3.386713e-02 |
| PCC | RBFOX2 | exon_skip_174355 | 4.212243e-01 | 2.613345e-09 |
| PCC | RBFOX2 | exon_skip_174161 | 4.721274e-01 | 1.925462e-12 |
| PCC | RBFOX2 | exon_skip_107284 | 4.184330e-01 | 5.059947e-09 |
| PCC | RBFOX2 | exon_skip_149530 | 4.631723e-01 | 1.335705e-11 |
| STG | RBM24 | exon_skip_238171 | -4.496556e-01 | 1.348938e-04 |
| TC | RBFOX2 | exon_skip_174161 | 4.551403e-01 | 1.122885e-08 |
| TC | RALYL | exon_skip_174161 | 4.298165e-01 | 8.453952e-08 |
| TC | SRSF5 | exon_skip_174161 | 4.100683e-01 | 3.653750e-07 |
| TC | RBFOX2 | exon_skip_264201 | -5.904675e-01 | 4.952667e-16 |
| TC | ELAVL1 | exon_skip_264201 | -4.259969e-01 | 2.950042e-08 |
| TC | MATR3 | exon_skip_264201 | -4.813608e-01 | 2.003219e-10 |
| TC | RBM24 | exon_skip_264201 | -4.741753e-01 | 4.031338e-10 |
| TC | HNRNPD | exon_skip_264201 | -4.417457e-01 | 7.798005e-09 |
| TC | NUP42 | exon_skip_264201 | -4.668020e-01 | 8.126088e-10 |
| TC | RALYL | exon_skip_264201 | -5.154314e-01 | 5.775216e-12 |
| TC | PTBP3 | exon_skip_264201 | -5.247521e-01 | 2.040208e-12 |
| TC | CELF1 | exon_skip_264201 | -4.657231e-01 | 8.991342e-10 |
| TC | RBM23 | exon_skip_264201 | -4.383256e-01 | 1.047089e-08 |
| TC | SRSF9 | exon_skip_264201 | -4.247356e-01 | 3.272241e-08 |
| TC | RBFOX2 | exon_skip_149530 | 4.781058e-01 | 1.552838e-09 |
| TC | RALYL | exon_skip_149530 | 4.364991e-01 | 5.041999e-08 |
Top |
RelatedDrugs for FBXW11 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for FBXW11 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|