|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for CLEC16A |
 Gene summary |
| Gene information | Gene symbol | CLEC16A | Gene ID | 23274 |
| Gene name | C-type lectin domain containing 16A | |
| Synonyms | Gop-1|KIAA0350 | |
| Cytomap | 16p13.13 | |
| Type of gene | protein-coding | |
| Description | protein CLEC16AC-type lectin domain family 16 member A | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context | - 21156047(Alzheimer's Disease Gene Signature Says: Beware of Brain Viral Infections) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for CLEC16A |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000038532
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for CLEC16A |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_112982 | chr16 | 10982878:10982991:11003074:11003305:11020193:11020325 | 11003074:11003305 |
| exon_skip_115325 | chr16 | 10962455:10962588:10969161:10969309:10971125:10971230 | 10969161:10969309 |
| exon_skip_118934 | chr16 | 10982878:10982991:11003074:11003257:11020193:11020325 | 11003074:11003257 |
| exon_skip_122704 | chr16 | 11166388:11166552:11174154:11174277:11178335:11179078 | 11174154:11174277 |
| exon_skip_123469 | chr16 | 11166388:11166552:11174154:11174277:11178335:11180772 | 11174154:11174277 |
| exon_skip_138040 | chr16 | 11126010:11126146:11166388:11166552:11178335:11182181 | 11166388:11166552 |
| exon_skip_226328 | chr16 | 11123900:11123946:11125979:11126146:11166388:11166552 | 11125979:11126146 |
| exon_skip_244712 | chr16 | 11166388:11166552:11174154:11174277:11178335:11181555 | 11174154:11174277 |
| exon_skip_250601 | chr16 | 11024821:11024921:11036047:11036092:11039754:11039876 | 11036047:11036092 |
| exon_skip_251600 | chr16 | 10972938:10973061:10977225:10977399:10979329:10979382 | 10977225:10977399 |
| exon_skip_25821 | chr16 | 11166388:11166552:11174154:11174277:11178335:11182181 | 11174154:11174277 |
| exon_skip_262918 | chr16 | 10971125:10971230:10972554:10972559:10972938:10973061 | 10972554:10972559 |
| exon_skip_35852 | chr16 | 11024821:11024921:11036047:11036092:11039754:11039871 | 11036047:11036092 |
| exon_skip_64115 | chr16 | 11126010:11126146:11166388:11166552:11178335:11180895 | 11166388:11166552 |
| exon_skip_72562 | chr16 | 10977225:10977399:10979329:10979382:10982878:10982991 | 10979329:10979382 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for CLEC16A |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000409790 | 10969161 | 10969309 | Frame-shift |
| ENST00000409790 | 10977225 | 10977399 | Frame-shift |
| ENST00000409790 | 11003074 | 11003305 | Frame-shift |
| ENST00000409790 | 10972554 | 10972559 | In-frame |
| ENST00000409790 | 10979329 | 10979382 | In-frame |
| ENST00000409790 | 11166388 | 11166552 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000409790 | 10977225 | 10977399 | Frame-shift |
| ENST00000409790 | 11003074 | 11003305 | Frame-shift |
| ENST00000409790 | 10972554 | 10972559 | In-frame |
| ENST00000409790 | 11166388 | 11166552 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000409790 | 10969161 | 10969309 | Frame-shift |
| ENST00000409790 | 10977225 | 10977399 | Frame-shift |
| ENST00000409790 | 11003074 | 11003305 | Frame-shift |
| ENST00000409790 | 10972554 | 10972559 | In-frame |
| ENST00000409790 | 10979329 | 10979382 | In-frame |
| ENST00000409790 | 11125979 | 11126146 | In-frame |
| ENST00000409790 | 11166388 | 11166552 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for CLEC16A |
p-ENSG00000038532_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000409790 | 6908 | 1053 | 10979329 | 10979382 | 1135 | 1187 | 301 | 319 |
| ENST00000409790 | 6908 | 1053 | 11166388 | 11166552 | 2873 | 3036 | 881 | 935 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000409790 | 6908 | 1053 | 11166388 | 11166552 | 2873 | 3036 | 881 | 935 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000409790 | 6908 | 1053 | 10979329 | 10979382 | 1135 | 1187 | 301 | 319 |
| ENST00000409790 | 6908 | 1053 | 11125979 | 11126146 | 2705 | 2871 | 825 | 880 |
| ENST00000409790 | 6908 | 1053 | 11166388 | 11166552 | 2873 | 3036 | 881 | 935 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q2KHT3 | 301 | 319 | 1 | 913 | Alternative sequence | ID=VSP_022745;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q2KHT3 | 301 | 319 | 1 | 1053 | Chain | ID=PRO_0000274476;Note=Protein CLEC16A |
| Q2KHT3 | 881 | 935 | 1 | 913 | Alternative sequence | ID=VSP_022745;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q2KHT3 | 881 | 935 | 882 | 924 | Alternative sequence | ID=VSP_022748;Note=In isoform 2. FAVAQCINQHSSPSLSSQSPPSASGSPSGSGSTSHCDSGGTSS->EPAPRPAPQLVHHGGRSRSFSLWSLCELPFLSQKPRRLAAPAS;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q2KHT3 | 881 | 935 | 914 | 935 | Alternative sequence | ID=VSP_022749;Note=In isoform 3. TSHCDSGGTSSSSTPSTAQSPA->MAATGFSAPNGSCHGTSRTVNS;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q2KHT3 | 881 | 935 | 925 | 1053 | Alternative sequence | ID=VSP_022750;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q2KHT3 | 881 | 935 | 1 | 1053 | Chain | ID=PRO_0000274476;Note=Protein CLEC16A |
| Q2KHT3 | 881 | 935 | 892 | 933 | Compositional bias | Note=Ser-rich |
| Q2KHT3 | 881 | 935 | 906 | 906 | Natural variant | ID=VAR_030288;Note=G->E;Dbxref=dbSNP:rs2241100 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q2KHT3 | 881 | 935 | 1 | 913 | Alternative sequence | ID=VSP_022745;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q2KHT3 | 881 | 935 | 882 | 924 | Alternative sequence | ID=VSP_022748;Note=In isoform 2. FAVAQCINQHSSPSLSSQSPPSASGSPSGSGSTSHCDSGGTSS->EPAPRPAPQLVHHGGRSRSFSLWSLCELPFLSQKPRRLAAPAS;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q2KHT3 | 881 | 935 | 914 | 935 | Alternative sequence | ID=VSP_022749;Note=In isoform 3. TSHCDSGGTSSSSTPSTAQSPA->MAATGFSAPNGSCHGTSRTVNS;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q2KHT3 | 881 | 935 | 925 | 1053 | Alternative sequence | ID=VSP_022750;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q2KHT3 | 881 | 935 | 1 | 1053 | Chain | ID=PRO_0000274476;Note=Protein CLEC16A |
| Q2KHT3 | 881 | 935 | 892 | 933 | Compositional bias | Note=Ser-rich |
| Q2KHT3 | 881 | 935 | 906 | 906 | Natural variant | ID=VAR_030288;Note=G->E;Dbxref=dbSNP:rs2241100 |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q2KHT3 | 301 | 319 | 1 | 913 | Alternative sequence | ID=VSP_022745;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q2KHT3 | 301 | 319 | 1 | 1053 | Chain | ID=PRO_0000274476;Note=Protein CLEC16A |
| Q2KHT3 | 825 | 880 | 1 | 913 | Alternative sequence | ID=VSP_022745;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q2KHT3 | 825 | 880 | 1 | 1053 | Chain | ID=PRO_0000274476;Note=Protein CLEC16A |
| Q2KHT3 | 881 | 935 | 1 | 913 | Alternative sequence | ID=VSP_022745;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q2KHT3 | 881 | 935 | 882 | 924 | Alternative sequence | ID=VSP_022748;Note=In isoform 2. FAVAQCINQHSSPSLSSQSPPSASGSPSGSGSTSHCDSGGTSS->EPAPRPAPQLVHHGGRSRSFSLWSLCELPFLSQKPRRLAAPAS;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q2KHT3 | 881 | 935 | 914 | 935 | Alternative sequence | ID=VSP_022749;Note=In isoform 3. TSHCDSGGTSSSSTPSTAQSPA->MAATGFSAPNGSCHGTSRTVNS;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q2KHT3 | 881 | 935 | 925 | 1053 | Alternative sequence | ID=VSP_022750;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q2KHT3 | 881 | 935 | 1 | 1053 | Chain | ID=PRO_0000274476;Note=Protein CLEC16A |
| Q2KHT3 | 881 | 935 | 892 | 933 | Compositional bias | Note=Ser-rich |
| Q2KHT3 | 881 | 935 | 906 | 906 | Natural variant | ID=VAR_030288;Note=G->E;Dbxref=dbSNP:rs2241100 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in CLEC16A |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for CLEC16A |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for CLEC16A |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for CLEC16A |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for CLEC16A |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
| CB | RBM6 | exon_skip_122704 | -4.187438e-01 | 7.175057e-08 |
| CB | PCBP4 | exon_skip_122704 | 4.599830e-01 | 2.208027e-09 |
| CB | RBM45 | exon_skip_122704 | 6.349077e-01 | 1.216334e-18 |
| CB | NUP42 | exon_skip_122704 | 4.017520e-01 | 2.644255e-07 |
Top |
RelatedDrugs for CLEC16A |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for CLEC16A |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|