ExonSkipAD: functional annotation of exon skipping event in human

Gene summary for FKBP5

Gene summary

Gene information	Gene symbol	FKBP5
	Gene ID	2289
	Gene name	FKBP prolyl isomerase 5
	Synonyms	AIG6\|FKBP51\|FKBP54\|P54\|PPIase\|Ptg-10
	Cytomap	6p21.31
	Type of gene	protein-coding
	Description	peptidyl-prolyl cis-trans isomerase FKBP551 kDa FK506-binding protein51 kDa FKBP54 kDa progesterone receptor-associated immunophilinFF1 antigenFK506 binding protein 5FKBP-51HSP90-binding immunophilinPPIase FKBP5T-cell FK506-binding proteinandrog
	Modification date	20200329
	UniProtAcc	L0R859, L8EC85, Q13451, Q2TA84,
	Context	- 31199948(Anxiolytic impact of Apelin-13 in a rat model of Alzheimer's disease: Involvement of glucocorticoid receptor and FKBP5)

Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Gene	GO ID	GO term	PubMed ID
FKBP5	GO:0061077	chaperone-mediated protein folding	11350175

Top

Gene structures and expression levels for FKBP5

Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

ENSG00000096060

Differentially expressed gene analysis across multiple brain tissues between AD and control.

Tissue type

DEG direction

Base mean exp.

log2FC(AD/control)

P-value

Adj. p-value

Differentially expressed isoform analysis across multiple brain tissues between AD and control.

Tissue type	DEG direction	ENST	Transcript info.	Base mean exp.	log2FC(AD/control)	P-value	Adjc. p-value
STG	UP	ENST00000357266.8	FKBP5-201:protein_coding:FKBP5	4.496415e+02	1.091106e+00	1.289520e-04	1.289284e-02

Landscape of isoform expressions across multiple brain tissues between AD and control.

Top

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for FKBP5

Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap).

All exon skipping events in AD cohorts.

Exon skip ID	chr	Exons involved in exon skipping	Skipped exon
exon_skip_185956	chr6	35587034:35587117:35591130:35591220:35597248:35597404	35591130:35591220
exon_skip_203673	chr6	35619096:35619210:35620132:35620274:35637014:35637158	35620132:35620274
exon_skip_231900	chr6	35580036:35580221:35587034:35587117:35591130:35591220	35587034:35587117
exon_skip_265093	chr6	35576994:35577233:35580036:35580221:35587034:35587117	35580036:35580221
exon_skip_36813	chr6	35573590:35575942:35576994:35577233:35580036:35580221	35576994:35577233
exon_skip_80172	chr6	35620132:35620274:35637014:35637158:35642720:35642843	35637014:35637158

Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control.

Exon skipping information

Tissue type

Avg(PSIs) in AD

Avg(PSIs) in control

Difference (PSI)

Adj. p-value

Top

Open reading frame (ORF) annotation in the exon skipping event for FKBP5

Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000357266	35591130	35591220	Frame-shift
ENST00000536438	35591130	35591220	Frame-shift
ENST00000539068	35591130	35591220	Frame-shift
ENST00000357266	35637014	35637158	Frame-shift
ENST00000536438	35637014	35637158	Frame-shift
ENST00000539068	35637014	35637158	Frame-shift
ENST00000357266	35580036	35580221	In-frame
ENST00000536438	35580036	35580221	In-frame
ENST00000539068	35580036	35580221	In-frame
ENST00000357266	35587034	35587117	In-frame
ENST00000536438	35587034	35587117	In-frame
ENST00000539068	35587034	35587117	In-frame

Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000357266	35591130	35591220	Frame-shift
ENST00000536438	35591130	35591220	Frame-shift
ENST00000539068	35591130	35591220	Frame-shift
ENST00000357266	35580036	35580221	In-frame
ENST00000536438	35580036	35580221	In-frame
ENST00000539068	35580036	35580221	In-frame

Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000357266	35591130	35591220	Frame-shift
ENST00000536438	35591130	35591220	Frame-shift
ENST00000539068	35591130	35591220	Frame-shift
ENST00000357266	35620132	35620274	Frame-shift
ENST00000536438	35620132	35620274	Frame-shift
ENST00000539068	35620132	35620274	Frame-shift
ENST00000357266	35637014	35637158	Frame-shift
ENST00000536438	35637014	35637158	Frame-shift
ENST00000539068	35637014	35637158	Frame-shift
ENST00000357266	35576994	35577233	In-frame
ENST00000536438	35576994	35577233	In-frame
ENST00000539068	35576994	35577233	In-frame
ENST00000357266	35580036	35580221	In-frame
ENST00000536438	35580036	35580221	In-frame
ENST00000539068	35580036	35580221	In-frame
ENST00000357266	35587034	35587117	In-frame
ENST00000536438	35587034	35587117	In-frame
ENST00000539068	35587034	35587117	In-frame

Top

Infer the effects of exon skipping event on protein functional features for FKBP5

p-ENSG00000096060_img4.png
boxplot

Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000357266	3789	457	35587034	35587117	910	992	252	279
ENST00000536438	3957	457	35587034	35587117	1073	1155	252	279
ENST00000539068	3844	457	35587034	35587117	960	1042	252	279
ENST00000357266	3789	457	35580036	35580221	994	1178	280	341
ENST00000536438	3957	457	35580036	35580221	1157	1341	280	341
ENST00000539068	3844	457	35580036	35580221	1044	1228	280	341

Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000357266	3789	457	35580036	35580221	994	1178	280	341
ENST00000536438	3957	457	35580036	35580221	1157	1341	280	341
ENST00000539068	3844	457	35580036	35580221	1044	1228	280	341

Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000357266	3789	457	35587034	35587117	910	992	252	279
ENST00000536438	3957	457	35587034	35587117	1073	1155	252	279
ENST00000539068	3844	457	35587034	35587117	960	1042	252	279
ENST00000357266	3789	457	35580036	35580221	994	1178	280	341
ENST00000536438	3957	457	35580036	35580221	1157	1341	280	341
ENST00000539068	3844	457	35580036	35580221	1044	1228	280	341
ENST00000357266	3789	457	35576994	35577233	1180	1418	342	421
ENST00000536438	3957	457	35576994	35577233	1343	1581	342	421
ENST00000539068	3844	457	35576994	35577233	1230	1468	342	421

Lost protein functional features of individual exon skipping events in ROSMAP.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q13451	252	279	223	268	Alternative sequence	ID=VSP_044820;Note=In isoform 2. YGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQA->PKNPGRWIPKKNWSRLPLSKRREPYTSRCVSPYAILSISKNLFKCW;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	223	268	Alternative sequence	ID=VSP_044820;Note=In isoform 2. YGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQA->PKNPGRWIPKKNWSRLPLSKRREPYTSRCVSPYAILSISKNLFKCW;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	223	268	Alternative sequence	ID=VSP_044820;Note=In isoform 2. YGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQA->PKNPGRWIPKKNWSRLPLSKRREPYTSRCVSPYAILSISKNLFKCW;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	252	279	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	252	279	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	252	279	256	258	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	256	258	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	256	258	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	268	301	Repeat	Note=TPR 1
Q13451	252	279	268	301	Repeat	Note=TPR 1
Q13451	252	279	268	301	Repeat	Note=TPR 1
Q13451	280	341	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	280	341	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	280	341	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	280	341	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	280	341	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	280	341	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	280	341	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	284	298	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	284	298	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	284	298	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	306	329	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	306	329	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	306	329	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	268	301	Repeat	Note=TPR 1
Q13451	280	341	268	301	Repeat	Note=TPR 1
Q13451	280	341	268	301	Repeat	Note=TPR 1
Q13451	280	341	317	350	Repeat	Note=TPR 2
Q13451	280	341	317	350	Repeat	Note=TPR 2
Q13451	280	341	317	350	Repeat	Note=TPR 2

Lost protein functional features of individual exon skipping events in MSBB.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q13451	280	341	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	280	341	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	280	341	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	280	341	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	280	341	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	280	341	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	280	341	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	284	298	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	284	298	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	284	298	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	306	329	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	306	329	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	306	329	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	268	301	Repeat	Note=TPR 1
Q13451	280	341	268	301	Repeat	Note=TPR 1
Q13451	280	341	268	301	Repeat	Note=TPR 1
Q13451	280	341	317	350	Repeat	Note=TPR 2
Q13451	280	341	317	350	Repeat	Note=TPR 2
Q13451	280	341	317	350	Repeat	Note=TPR 2

Lost protein functional features of individual exon skipping events in Mayo.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q13451	252	279	223	268	Alternative sequence	ID=VSP_044820;Note=In isoform 2. YGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQA->PKNPGRWIPKKNWSRLPLSKRREPYTSRCVSPYAILSISKNLFKCW;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	223	268	Alternative sequence	ID=VSP_044820;Note=In isoform 2. YGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQA->PKNPGRWIPKKNWSRLPLSKRREPYTSRCVSPYAILSISKNLFKCW;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	223	268	Alternative sequence	ID=VSP_044820;Note=In isoform 2. YGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQA->PKNPGRWIPKKNWSRLPLSKRREPYTSRCVSPYAILSISKNLFKCW;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	252	279	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	252	279	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	252	279	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	252	279	256	258	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	256	258	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	256	258	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	252	279	268	301	Repeat	Note=TPR 1
Q13451	252	279	268	301	Repeat	Note=TPR 1
Q13451	252	279	268	301	Repeat	Note=TPR 1
Q13451	280	341	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	280	341	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	280	341	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	280	341	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	280	341	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	280	341	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	280	341	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	261	280	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	284	298	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	284	298	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	284	298	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	306	329	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	306	329	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	306	329	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	280	341	268	301	Repeat	Note=TPR 1
Q13451	280	341	268	301	Repeat	Note=TPR 1
Q13451	280	341	268	301	Repeat	Note=TPR 1
Q13451	280	341	317	350	Repeat	Note=TPR 2
Q13451	280	341	317	350	Repeat	Note=TPR 2
Q13451	280	341	317	350	Repeat	Note=TPR 2
Q13451	342	421	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	342	421	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	342	421	269	457	Alternative sequence	ID=VSP_044821;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.4
Q13451	342	421	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	342	421	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	342	421	1	457	Chain	ID=PRO_0000075324;Note=Peptidyl-prolyl cis-trans isomerase FKBP5
Q13451	342	421	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	333	346	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	351	363	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	351	363	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	351	363	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	367	380	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	367	380	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	367	380	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	385	423	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	385	423	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	385	423	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:5OMP
Q13451	342	421	317	350	Repeat	Note=TPR 2
Q13451	342	421	317	350	Repeat	Note=TPR 2
Q13451	342	421	317	350	Repeat	Note=TPR 2
Q13451	342	421	351	384	Repeat	Note=TPR 3
Q13451	342	421	351	384	Repeat	Note=TPR 3
Q13451	342	421	351	384	Repeat	Note=TPR 3

Top

3'-UTR located exon skipping events that lost miRNA binding sites in FKBP5

3'-UTR exon skipping evnets lost miRNA binding.

Tissue type

ENST

Exon skip start

Exon skip end

microRNA

Binding site by TargetScan

Binding type by TargetScan

Bdinding site by miRanda

Score of miRanda

Energy by miRanda

Top

SNVs in the skipped exons for FKBP5

- Differential PSIs between mutated versus non-mutated samples.

- Depth of Coverage in the skipped exon of the mutated samples.

- Sashimi plot in the skipped exon of the mutated samples.

- Non-synonymous mutations located in the skipped exons.

Cancer type

Sample

ESID

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

- Non-synonymous mutations located in the skipped exons in CCLE.

Sample

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

Top

AD stage-associated exon skippint events for FKBP5

Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR).

AD stage info

Cohort

Tissue

SE id

Coefficient

P-value

Chromosome

Strand

E1 start

E1 end

Skipped start

Skipped end

E2 start

E2 end

Top

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for FKBP5

sQTL information located at the skipped exons.

Tissue type

Exon skip ID

SNP id

Location

P-value

FDR

Top

Correlation with RNA binding proteins (RBPs) for FKBP5

Correlated RBP and related information.

Tissue type

RBP name

Exon skip ID

Correlation coeifficient

P-value

Top

RelatedDrugs for FKBP5

Approved drugs targeting this gene.
(DrugBank Version 5.1.0 2018-04-02)

UniProtAcc

DrugBank ID

Drug name

Drug activity

Drug type

Drug status

Top

RelatedDiseases for FKBP5

Diseases associated with this gene.
(DisGeNet 4.0)

Gene

Disease ID

Disease name

# pubmeds

Source

	Gene summary
	Gene structures and expression levels
	Exon skipping events with PSIs in RPSMAP, MSBB, and Mayo
	Open reading frame (ORF) annotation in the exon skipping event
	Exon skipping events in the canonical protein sequence
	3'-UTR located exon skipping events lost miRNA binding sites
	SNVs in the skipped exons with depth of coverage
	AD stage-associated exon skipping events
	Splicing Quantitative Trait Loci (sQTLs) in the skipped exons
	Correlation with RNA binding proteins (RBPs)
	Related drugs with this gene
	Related diseases with this gene

Home

Download

Statistics

Landscape

Help

Contact

Gene summary for FKBP5

Gene structures and expression levels for FKBP5

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for FKBP5

Open reading frame (ORF) annotation in the exon skipping event for FKBP5

Infer the effects of exon skipping event on protein functional features for FKBP5

3'-UTR located exon skipping events that lost miRNA binding sites in FKBP5

SNVs in the skipped exons for FKBP5

AD stage-associated exon skippint events for FKBP5

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for FKBP5

Correlation with RNA binding proteins (RBPs) for FKBP5

RelatedDrugs for FKBP5

RelatedDiseases for FKBP5