|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for ELK4 |
 Gene summary |
| Gene information | Gene symbol | ELK4 | Gene ID | 2005 |
| Gene name | ETS transcription factor ELK4 | |
| Synonyms | SAP1 | |
| Cytomap | 1q32.1 | |
| Type of gene | protein-coding | |
| Description | ETS domain-containing protein Elk-4ELK4, ETS transcription factorELK4, ETS-domain protein (SRF accessory protein 1)SAP-1serum response factor accessory protein 1 | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| ELK4 | GO:0070932 | histone H3 deacetylation | 22722849 |
Top |
Gene structures and expression levels for ELK4 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000158711
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for ELK4 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_143831 | chr1 | 205598455:205598649:205599825:205599925:205600651:205600794 | 205599825:205599925 |
| exon_skip_283482 | chr1 | 205616478:205616644:205618957:205619073:205619966:205620838 | 205618957:205619073 |
| exon_skip_89559 | chr1 | 205618957:205619073:205619966:205620838:205623676:205623891 | 205619966:205620838 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for ELK4 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000357992 | 205618957 | 205619073 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000357992 | 205618957 | 205619073 | In-frame |
| ENST00000357992 | 205619966 | 205620838 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for ELK4 |
p-ENSG00000158711_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000357992 | 10256 | 431 | 205618957 | 205619073 | 1421 | 1536 | 360 | 398 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000357992 | 10256 | 431 | 205619966 | 205620838 | 548 | 1419 | 69 | 359 |
| ENST00000357992 | 10256 | 431 | 205618957 | 205619073 | 1421 | 1536 | 360 | 398 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P28324 | 360 | 398 | 361 | 431 | Alternative sequence | ID=VSP_001468;Note=In isoform 2. TPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT->VACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| P28324 | 360 | 398 | 1 | 431 | Chain | ID=PRO_0000204099;Note=ETS domain-containing protein Elk-4 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P28324 | 69 | 359 | 71 | 74 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1BC8 |
| P28324 | 69 | 359 | 76 | 78 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1K6O |
| P28324 | 69 | 359 | 81 | 84 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1BC8 |
| P28324 | 69 | 359 | 144 | 152 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1HBX |
| P28324 | 69 | 359 | 1 | 431 | Chain | ID=PRO_0000204099;Note=ETS domain-containing protein Elk-4 |
| P28324 | 69 | 359 | 167 | 167 | Cross-link | Note=Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2);Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:28112733;Dbxref=PMID:28112733 |
| P28324 | 69 | 359 | 5 | 85 | DNA binding | Note=ETS;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00237 |
| P28324 | 69 | 359 | 56 | 69 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1BC8 |
| P28324 | 69 | 359 | 89 | 91 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1BC8 |
| P28324 | 69 | 359 | 138 | 143 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1HBX |
| P28324 | 69 | 359 | 153 | 155 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1HBX |
| P28324 | 69 | 359 | 180 | 180 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244;evidence=ECO:0000244|PubMed:23186163;Dbxref=PMID:23186163 |
| P28324 | 69 | 359 | 326 | 326 | Sequence conflict | Note=E->G;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P28324 | 69 | 359 | 85 | 88 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1BC8 |
| P28324 | 360 | 398 | 361 | 431 | Alternative sequence | ID=VSP_001468;Note=In isoform 2. TPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPSTPGPFSPDLQKT->VACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| P28324 | 360 | 398 | 1 | 431 | Chain | ID=PRO_0000204099;Note=ETS domain-containing protein Elk-4 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in ELK4 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for ELK4 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for ELK4 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for ELK4 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for ELK4 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for ELK4 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for ELK4 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|