|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for CRHR1 |
 Gene summary |
| Gene information | Gene symbol | CRHR1 | Gene ID | 1394 |
| Gene name | corticotropin releasing hormone receptor 1 | |
| Synonyms | CRF-R|CRF-R-1|CRF-R1|CRF1|CRFR-1|CRFR1|CRH-R-1|CRH-R1|CRHR|CRHR1L | |
| Cytomap | 17q21.31 | |
| Type of gene | protein-coding | |
| Description | corticotropin-releasing factor receptor 1CRH receptor 1corticotropin-releasing factor type 1 receptorseven transmembrane helix receptor | |
| Modification date | 20200313 | |
| UniProtAcc | A0A024R9X9, A0A0A0MQZ1, A0A0G2JM19, | |
| Context | - 25272941(Catalpol Regulates Function of Hypothalamic-Pituitary-Adrenocortical-Axis in an Alzheimer's Disease Rat Model) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| CRHR1 | GO:0007189 | adenylate cyclase-activating G protein-coupled receptor signaling pathway | 18292205 |
| CRHR1 | GO:0071376 | cellular response to corticotropin-releasing hormone stimulus | 18292205 |
| CRHR1 | GO:1901386 | negative regulation of voltage-gated calcium channel activity | 18292205 |
Top |
Gene structures and expression levels for CRHR1 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000120088
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| HCC | DOWN | ENST00000634540.1 | LINC02210-CRHR1-202:protein_coding:LINC02210 | 1.034361e+01 | -9.438597e-01 | 3.829452e-04 | 1.798065e-02 |
| CB | DOWN | ENST00000398285.7 | CRHR1-206:protein_coding:CRHR1 | 2.730497e+01 | -1.377133e+00 | 4.208226e-04 | 2.490377e-03 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for CRHR1 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_123056 | chr17 | 45816463:45816582:45821355:45821440:45829215:45829321 | 45821355:45821440 |
| exon_skip_136044 | chr17 | 45830094:45830214:45830417:45830570:45830880:45830940 | 45830417:45830570 |
| exon_skip_150495 | chr17 | 45829215:45829321:45829561:45829647:45830094:45830214 | 45829561:45829647 |
| exon_skip_211308 | chr17 | 45807010:45807097:45821355:45821440:45829215:45829321 | 45821355:45821440 |
| exon_skip_214110 | chr17 | 45833714:45833849:45834007:45834048:45834624:45834764 | 45834007:45834048 |
| exon_skip_61390 | chr17 | 45807010:45807097:45816463:45816582:45821355:45821440 | 45816463:45816582 |
| exon_skip_74435 | chr17 | 45833452:45833537:45833714:45833849:45834007:45834048 | 45833714:45833849 |
| exon_skip_90702 | chr17 | 45821355:45821440:45825486:45825595:45829215:45829321 | 45825486:45825595 |
| exon_skip_94913 | chr17 | 45807010:45807097:45816463:45816582:45829215:45829321 | 45816463:45816582 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for CRHR1 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000398285 | 45821355 | 45821440 | Frame-shift |
| ENST00000398285 | 45833714 | 45833849 | Frame-shift |
| ENST00000398285 | 45816463 | 45816582 | In-frame |
| ENST00000398285 | 45829561 | 45829647 | In-frame |
| ENST00000398285 | 45834007 | 45834048 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000398285 | 45821355 | 45821440 | Frame-shift |
| ENST00000398285 | 45833714 | 45833849 | Frame-shift |
| ENST00000398285 | 45816463 | 45816582 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000398285 | 45821355 | 45821440 | Frame-shift |
| ENST00000398285 | 45830417 | 45830570 | Frame-shift |
| ENST00000398285 | 45833714 | 45833849 | Frame-shift |
| ENST00000398285 | 45816463 | 45816582 | In-frame |
| ENST00000398285 | 45829561 | 45829647 | In-frame |
| ENST00000398285 | 45834007 | 45834048 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for CRHR1 |
p-ENSG00000120088_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000398285 | 2416 | 444 | 45816463 | 45816582 | 123 | 241 | 41 | 80 |
| ENST00000398285 | 2416 | 444 | 45829561 | 45829647 | 436 | 521 | 145 | 173 |
| ENST00000398285 | 2416 | 444 | 45834007 | 45834048 | 1154 | 1194 | 384 | 398 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000398285 | 2416 | 444 | 45816463 | 45816582 | 123 | 241 | 41 | 80 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000398285 | 2416 | 444 | 45816463 | 45816582 | 123 | 241 | 41 | 80 |
| ENST00000398285 | 2416 | 444 | 45829561 | 45829647 | 436 | 521 | 145 | 173 |
| ENST00000398285 | 2416 | 444 | 45834007 | 45834048 | 1154 | 1194 | 384 | 398 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P34998 | 41 | 80 | 1 | 204 | Alternative sequence | ID=VSP_045434;Note=In isoform 5. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|Ref.6;Dbxref=PMID:14702039 |
| P34998 | 41 | 80 | 41 | 81 | Alternative sequence | ID=VSP_001996;Note=In isoform CRF-R3. GLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTN->D;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:7811272;Dbxref=PMID:7811272 |
| P34998 | 41 | 80 | 49 | 52 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L27 |
| P34998 | 41 | 80 | 62 | 67 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3EHU |
| P34998 | 41 | 80 | 70 | 74 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3EHU |
| P34998 | 41 | 80 | 24 | 444 | Chain | ID=PRO_0000012814;Note=Corticotropin-releasing factor receptor 1 |
| P34998 | 41 | 80 | 30 | 54 | Disulfide bond | . |
| P34998 | 41 | 80 | 44 | 87 | Disulfide bond | . |
| P34998 | 41 | 80 | 68 | 102 | Disulfide bond | . |
| P34998 | 41 | 80 | 45 | 45 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P34998 | 41 | 80 | 78 | 78 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P34998 | 41 | 80 | 24 | 111 | Topological domain | Note=Extracellular |
| P34998 | 145 | 173 | 1 | 204 | Alternative sequence | ID=VSP_045434;Note=In isoform 5. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|Ref.6;Dbxref=PMID:14702039 |
| P34998 | 145 | 173 | 146 | 174 | Alternative sequence | ID=VSP_001997;Note=In isoform CRF-R2%2C isoform CRF-R3 and isoform CRF-R4. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:10598591,ECO:0000303|PubMed:15489334,ECO:00003 |
| P34998 | 145 | 173 | 24 | 444 | Chain | ID=PRO_0000012814;Note=Corticotropin-releasing factor receptor 1 |
| P34998 | 145 | 173 | 143 | 178 | Topological domain | Note=Cytoplasmic |
| P34998 | 384 | 398 | 385 | 398 | Alternative sequence | ID=VSP_001998;Note=In isoform CRF-R4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:10598591;Dbxref=PMID:10598591 |
| P34998 | 384 | 398 | 24 | 444 | Chain | ID=PRO_0000012814;Note=Corticotropin-releasing factor receptor 1 |
| P34998 | 384 | 398 | 368 | 396 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4K5Y |
| P34998 | 384 | 398 | 384 | 384 | Mutagenesis | Note=Increases antagonist binding. Q->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23863939;Dbxref=PMID:23863939 |
| P34998 | 384 | 398 | 398 | 444 | Topological domain | Note=Cytoplasmic |
| P34998 | 384 | 398 | 368 | 397 | Transmembrane | Note=Helical%3B Name%3D7 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P34998 | 41 | 80 | 1 | 204 | Alternative sequence | ID=VSP_045434;Note=In isoform 5. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|Ref.6;Dbxref=PMID:14702039 |
| P34998 | 41 | 80 | 41 | 81 | Alternative sequence | ID=VSP_001996;Note=In isoform CRF-R3. GLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTN->D;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:7811272;Dbxref=PMID:7811272 |
| P34998 | 41 | 80 | 49 | 52 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L27 |
| P34998 | 41 | 80 | 62 | 67 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3EHU |
| P34998 | 41 | 80 | 70 | 74 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3EHU |
| P34998 | 41 | 80 | 24 | 444 | Chain | ID=PRO_0000012814;Note=Corticotropin-releasing factor receptor 1 |
| P34998 | 41 | 80 | 30 | 54 | Disulfide bond | . |
| P34998 | 41 | 80 | 44 | 87 | Disulfide bond | . |
| P34998 | 41 | 80 | 68 | 102 | Disulfide bond | . |
| P34998 | 41 | 80 | 45 | 45 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P34998 | 41 | 80 | 78 | 78 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P34998 | 41 | 80 | 24 | 111 | Topological domain | Note=Extracellular |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P34998 | 41 | 80 | 1 | 204 | Alternative sequence | ID=VSP_045434;Note=In isoform 5. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|Ref.6;Dbxref=PMID:14702039 |
| P34998 | 41 | 80 | 41 | 81 | Alternative sequence | ID=VSP_001996;Note=In isoform CRF-R3. GLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTN->D;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:7811272;Dbxref=PMID:7811272 |
| P34998 | 41 | 80 | 49 | 52 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L27 |
| P34998 | 41 | 80 | 62 | 67 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3EHU |
| P34998 | 41 | 80 | 70 | 74 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:3EHU |
| P34998 | 41 | 80 | 24 | 444 | Chain | ID=PRO_0000012814;Note=Corticotropin-releasing factor receptor 1 |
| P34998 | 41 | 80 | 30 | 54 | Disulfide bond | . |
| P34998 | 41 | 80 | 44 | 87 | Disulfide bond | . |
| P34998 | 41 | 80 | 68 | 102 | Disulfide bond | . |
| P34998 | 41 | 80 | 45 | 45 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P34998 | 41 | 80 | 78 | 78 | Glycosylation | Note=N-linked (GlcNAc...) asparagine;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P34998 | 41 | 80 | 24 | 111 | Topological domain | Note=Extracellular |
| P34998 | 145 | 173 | 1 | 204 | Alternative sequence | ID=VSP_045434;Note=In isoform 5. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:14702039,ECO:0000303|Ref.6;Dbxref=PMID:14702039 |
| P34998 | 145 | 173 | 146 | 174 | Alternative sequence | ID=VSP_001997;Note=In isoform CRF-R2%2C isoform CRF-R3 and isoform CRF-R4. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:10598591,ECO:0000303|PubMed:15489334,ECO:00003 |
| P34998 | 145 | 173 | 24 | 444 | Chain | ID=PRO_0000012814;Note=Corticotropin-releasing factor receptor 1 |
| P34998 | 145 | 173 | 143 | 178 | Topological domain | Note=Cytoplasmic |
| P34998 | 384 | 398 | 385 | 398 | Alternative sequence | ID=VSP_001998;Note=In isoform CRF-R4. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:10598591;Dbxref=PMID:10598591 |
| P34998 | 384 | 398 | 24 | 444 | Chain | ID=PRO_0000012814;Note=Corticotropin-releasing factor receptor 1 |
| P34998 | 384 | 398 | 368 | 396 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4K5Y |
| P34998 | 384 | 398 | 384 | 384 | Mutagenesis | Note=Increases antagonist binding. Q->A;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:23863939;Dbxref=PMID:23863939 |
| P34998 | 384 | 398 | 398 | 444 | Topological domain | Note=Cytoplasmic |
| P34998 | 384 | 398 | 368 | 397 | Transmembrane | Note=Helical%3B Name%3D7 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in CRHR1 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for CRHR1 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for CRHR1 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for CRHR1 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for CRHR1 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
| CB | PCBP4 | exon_skip_74435 | 4.139391e-01 | 7.089095e-08 |
Top |
RelatedDrugs for CRHR1 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for CRHR1 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|