ExonSkipAD: functional annotation of exon skipping event in human

Gene summary for DIS3L2

Gene summary

Gene information	Gene symbol	DIS3L2
	Gene ID	129563
	Gene name	DIS3 like 3'-5' exoribonuclease 2
	Synonyms	FAM6A\|PRLMNS\|hDIS3L2
	Cytomap	2q37.1
	Type of gene	protein-coding
	Description	DIS3-like exonuclease 2DIS3 mitotic control homolog-like 2family with sequence similarity 6, member A
	Modification date	20200313
	UniProtAcc	C9JGP4, H7C036, H7C1Q8, H7C302, H7C440, Q8IYB7,
	Context

Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Gene	GO ID	GO term	PubMed ID
DIS3L2	GO:0010587	miRNA catabolic process	24141620

Top

Gene structures and expression levels for DIS3L2

Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

ENSG00000144535

Differentially expressed gene analysis across multiple brain tissues between AD and control.

Tissue type

DEG direction

Base mean exp.

log2FC(AD/control)

P-value

Adj. p-value

Differentially expressed isoform analysis across multiple brain tissues between AD and control.

Tissue type	DEG direction	ENST	Transcript info.	Base mean exp.	log2FC(AD/control)	P-value	Adjc. p-value
CB	DOWN	ENST00000418143.1	DIS3L2-207:protein_coding:DIS3L2	8.847279e+00	-1.557896e+00	2.062772e-03	9.455569e-03
TC	DOWN	ENST00000418143.1	DIS3L2-207:protein_coding:DIS3L2	1.607938e+01	-1.826193e+00	4.319747e-06	1.325172e-04

Landscape of isoform expressions across multiple brain tissues between AD and control.

Top

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for DIS3L2

Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap).

All exon skipping events in AD cohorts.

Exon skip ID	chr	Exons involved in exon skipping	Skipped exon
exon_skip_105362	chr2	232238533:232238645:232249239:232249346:232263207:232263362	232249239:232249346
exon_skip_135183	chr2	232330690:232330776:232333840:232333987:232334369:232334454	232333840:232333987
exon_skip_150015	chr2	232163459:232163632:232198527:232198776:232210326:232210405	232198527:232198776
exon_skip_173586	chr2	232330690:232330776:232331670:232331926:232333840:232333987	232331670:232331926
exon_skip_186047	chr2	232087487:232087721:232111197:232111255:232130619:232130719	232111197:232111255
exon_skip_194467	chr2	232130619:232130719:232136472:232136719:232163459:232163632	232136472:232136719
exon_skip_204594	chr2	232210326:232210405:232238533:232238645:232249239:232249346	232238533:232238645
exon_skip_267114	chr2	232329886:232329996:232330690:232330776:232333840:232333987	232330690:232330776
exon_skip_276758	chr2	232014928:232014979:232015514:232015671:232024277:232024330	232015514:232015671
exon_skip_293361	chr2	232330695:232330776:232333840:232333987:232334369:232334454	232333840:232333987
exon_skip_55943	chr2	232163463:232163632:232198527:232198776:232210326:232210405	232198527:232198776
exon_skip_71402	chr2	232330695:232330776:232331670:232331926:232333840:232333987	232331670:232331926
exon_skip_86421	chr2	232249340:232249346:232263207:232263440:232300040:232300119	232263207:232263440

Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control.

Exon skipping information

Tissue type

Avg(PSIs) in AD

Avg(PSIs) in control

Difference (PSI)

Adj. p-value

Top

Open reading frame (ORF) annotation in the exon skipping event for DIS3L2

Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000325385	232015514	232015671	Frame-shift
ENST00000409307	232015514	232015671	Frame-shift
ENST00000325385	232136472	232136719	Frame-shift
ENST00000409307	232136472	232136719	Frame-shift
ENST00000325385	232238533	232238645	Frame-shift
ENST00000409307	232238533	232238645	Frame-shift
ENST00000325385	232333840	232333987	Frame-shift
ENST00000409307	232333840	232333987	Frame-shift
ENST00000325385	232263207	232263440	In-frame
ENST00000409307	232263207	232263440	In-frame
ENST00000325385	232330690	232330776	In-frame
ENST00000409307	232330690	232330776	In-frame

Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000325385	232015514	232015671	Frame-shift
ENST00000409307	232015514	232015671	Frame-shift
ENST00000325385	232136472	232136719	Frame-shift
ENST00000409307	232136472	232136719	Frame-shift
ENST00000325385	232333840	232333987	Frame-shift
ENST00000409307	232333840	232333987	Frame-shift

Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000325385	232015514	232015671	Frame-shift
ENST00000409307	232015514	232015671	Frame-shift
ENST00000325385	232136472	232136719	Frame-shift
ENST00000409307	232136472	232136719	Frame-shift
ENST00000325385	232238533	232238645	Frame-shift
ENST00000409307	232238533	232238645	Frame-shift
ENST00000325385	232333840	232333987	Frame-shift
ENST00000409307	232333840	232333987	Frame-shift
ENST00000325385	232249239	232249346	In-frame
ENST00000409307	232249239	232249346	In-frame
ENST00000325385	232263207	232263440	In-frame
ENST00000409307	232263207	232263440	In-frame
ENST00000325385	232330690	232330776	In-frame
ENST00000409307	232330690	232330776	In-frame

Top

Infer the effects of exon skipping event on protein functional features for DIS3L2

p-ENSG00000144535_img4.png
boxplot

Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000325385	3518	885	232263207	232263440	1703	1935	475	553
ENST00000409307	2675	885	232263207	232263440	1427	1659	475	553
ENST00000325385	3518	885	232330690	232330776	2201	2286	641	670
ENST00000409307	2675	885	232330690	232330776	1925	2010	641	670

Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases.

ENST

Length of mRNA

Length of AA seq.

Genomic start

Genomic end

mRNA start

mRNA end

AA start

AA end

Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000325385	3518	885	232249239	232249346	1595	1701	439	475
ENST00000409307	2675	885	232249239	232249346	1319	1425	439	475
ENST00000325385	3518	885	232263207	232263440	1703	1935	475	553
ENST00000409307	2675	885	232263207	232263440	1427	1659	475	553
ENST00000325385	3518	885	232330690	232330776	2201	2286	641	670
ENST00000409307	2675	885	232330690	232330776	1925	2010	641	670

Lost protein functional features of individual exon skipping events in ROSMAP.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q8IYB7	475	553	250	885	Alternative sequence	ID=VSP_030373;Note=In isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:17974005,ECO:0000303\|Ref.3;Dbxref=PMID:17974005
Q8IYB7	475	553	250	885	Alternative sequence	ID=VSP_030373;Note=In isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:17974005,ECO:0000303\|Ref.3;Dbxref=PMID:17974005
Q8IYB7	475	553	357	885	Alternative sequence	ID=VSP_030374;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:17974005;Dbxref=PMID:17974005
Q8IYB7	475	553	357	885	Alternative sequence	ID=VSP_030374;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:17974005;Dbxref=PMID:17974005
Q8IYB7	475	553	528	603	Alternative sequence	ID=VSP_030375;Note=In isoform 3. AVLNLHGIAKQLRQQRFVDGALRLDQLKLAFTLDHETGLPQGCHIYEYRESNKLVEEFMLLANMAVAHKIHRAFPE->QNADKDGAAHLQASHSPSAEDAEAQPSTEERLPETRGICDRDPDTRLFFLQQQSRVLEAKPQNTIRVEEQTTQLQI;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxr
Q8IYB7	475	553	528	603	Alternative sequence	ID=VSP_030375;Note=In isoform 3. AVLNLHGIAKQLRQQRFVDGALRLDQLKLAFTLDHETGLPQGCHIYEYRESNKLVEEFMLLANMAVAHKIHRAFPE->QNADKDGAAHLQASHSPSAEDAEAQPSTEERLPETRGICDRDPDTRLFFLQQQSRVLEAKPQNTIRVEEQTTQLQI;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxr
Q8IYB7	475	553	1	885	Chain	ID=PRO_0000314817;Note=DIS3-like exonuclease 2
Q8IYB7	475	553	1	885	Chain	ID=PRO_0000314817;Note=DIS3-like exonuclease 2
Q8IYB7	475	553	483	483	Natural variant	ID=VAR_067577;Note=Probable disease-associated mutation found in a patient with Wilms tumor%3B does not suppress anchorage-independent cell growth. R->G;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:22306653;Dbxref=dbSNP:rs186865544,PMID:22306653
Q8IYB7	475	553	483	483	Natural variant	ID=VAR_067577;Note=Probable disease-associated mutation found in a patient with Wilms tumor%3B does not suppress anchorage-independent cell growth. R->G;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:22306653;Dbxref=dbSNP:rs186865544,PMID:22306653
Q8IYB7	475	553	489	489	Natural variant	ID=VAR_067578;Note=In PRLMNS. C->Y;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:22306653;Dbxref=dbSNP:rs387907116,PMID:22306653
Q8IYB7	475	553	489	489	Natural variant	ID=VAR_067578;Note=In PRLMNS. C->Y;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:22306653;Dbxref=dbSNP:rs387907116,PMID:22306653
Q8IYB7	641	670	250	885	Alternative sequence	ID=VSP_030373;Note=In isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:17974005,ECO:0000303\|Ref.3;Dbxref=PMID:17974005
Q8IYB7	641	670	250	885	Alternative sequence	ID=VSP_030373;Note=In isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:17974005,ECO:0000303\|Ref.3;Dbxref=PMID:17974005
Q8IYB7	641	670	357	885	Alternative sequence	ID=VSP_030374;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:17974005;Dbxref=PMID:17974005
Q8IYB7	641	670	357	885	Alternative sequence	ID=VSP_030374;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:17974005;Dbxref=PMID:17974005
Q8IYB7	641	670	604	885	Alternative sequence	ID=VSP_030377;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q8IYB7	641	670	604	885	Alternative sequence	ID=VSP_030377;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q8IYB7	641	670	620	885	Alternative sequence	ID=VSP_030378;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q8IYB7	641	670	620	885	Alternative sequence	ID=VSP_030378;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q8IYB7	641	670	1	885	Chain	ID=PRO_0000314817;Note=DIS3-like exonuclease 2
Q8IYB7	641	670	1	885	Chain	ID=PRO_0000314817;Note=DIS3-like exonuclease 2

Lost protein functional features of individual exon skipping events in MSBB.

UniProt acc.

Start of exon skipping (AA)

End of exon skipping (AA)

Protein feature start (AA)

Protein feature end (AA)

Category of protein feature

Description of feature

Lost protein functional features of individual exon skipping events in Mayo.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q8IYB7	439	475	250	885	Alternative sequence	ID=VSP_030373;Note=In isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:17974005,ECO:0000303\|Ref.3;Dbxref=PMID:17974005
Q8IYB7	439	475	250	885	Alternative sequence	ID=VSP_030373;Note=In isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:17974005,ECO:0000303\|Ref.3;Dbxref=PMID:17974005
Q8IYB7	439	475	357	885	Alternative sequence	ID=VSP_030374;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:17974005;Dbxref=PMID:17974005
Q8IYB7	439	475	357	885	Alternative sequence	ID=VSP_030374;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:17974005;Dbxref=PMID:17974005
Q8IYB7	439	475	1	885	Chain	ID=PRO_0000314817;Note=DIS3-like exonuclease 2
Q8IYB7	439	475	1	885	Chain	ID=PRO_0000314817;Note=DIS3-like exonuclease 2
Q8IYB7	439	475	443	443	Natural variant	ID=VAR_079527;Note=In PRLMNS%3B unknown pathological significance. M->K;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:28328139;Dbxref=PMID:28328139
Q8IYB7	439	475	443	443	Natural variant	ID=VAR_079527;Note=In PRLMNS%3B unknown pathological significance. M->K;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:28328139;Dbxref=PMID:28328139
Q8IYB7	475	553	250	885	Alternative sequence	ID=VSP_030373;Note=In isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:17974005,ECO:0000303\|Ref.3;Dbxref=PMID:17974005
Q8IYB7	475	553	250	885	Alternative sequence	ID=VSP_030373;Note=In isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:17974005,ECO:0000303\|Ref.3;Dbxref=PMID:17974005
Q8IYB7	475	553	357	885	Alternative sequence	ID=VSP_030374;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:17974005;Dbxref=PMID:17974005
Q8IYB7	475	553	357	885	Alternative sequence	ID=VSP_030374;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:17974005;Dbxref=PMID:17974005
Q8IYB7	475	553	528	603	Alternative sequence	ID=VSP_030375;Note=In isoform 3. AVLNLHGIAKQLRQQRFVDGALRLDQLKLAFTLDHETGLPQGCHIYEYRESNKLVEEFMLLANMAVAHKIHRAFPE->QNADKDGAAHLQASHSPSAEDAEAQPSTEERLPETRGICDRDPDTRLFFLQQQSRVLEAKPQNTIRVEEQTTQLQI;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxr
Q8IYB7	475	553	528	603	Alternative sequence	ID=VSP_030375;Note=In isoform 3. AVLNLHGIAKQLRQQRFVDGALRLDQLKLAFTLDHETGLPQGCHIYEYRESNKLVEEFMLLANMAVAHKIHRAFPE->QNADKDGAAHLQASHSPSAEDAEAQPSTEERLPETRGICDRDPDTRLFFLQQQSRVLEAKPQNTIRVEEQTTQLQI;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxr
Q8IYB7	475	553	1	885	Chain	ID=PRO_0000314817;Note=DIS3-like exonuclease 2
Q8IYB7	475	553	1	885	Chain	ID=PRO_0000314817;Note=DIS3-like exonuclease 2
Q8IYB7	475	553	483	483	Natural variant	ID=VAR_067577;Note=Probable disease-associated mutation found in a patient with Wilms tumor%3B does not suppress anchorage-independent cell growth. R->G;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:22306653;Dbxref=dbSNP:rs186865544,PMID:22306653
Q8IYB7	475	553	483	483	Natural variant	ID=VAR_067577;Note=Probable disease-associated mutation found in a patient with Wilms tumor%3B does not suppress anchorage-independent cell growth. R->G;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:22306653;Dbxref=dbSNP:rs186865544,PMID:22306653
Q8IYB7	475	553	489	489	Natural variant	ID=VAR_067578;Note=In PRLMNS. C->Y;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:22306653;Dbxref=dbSNP:rs387907116,PMID:22306653
Q8IYB7	475	553	489	489	Natural variant	ID=VAR_067578;Note=In PRLMNS. C->Y;Ontology_term=ECO:0000269;evidence=ECO:0000269\|PubMed:22306653;Dbxref=dbSNP:rs387907116,PMID:22306653
Q8IYB7	641	670	250	885	Alternative sequence	ID=VSP_030373;Note=In isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:17974005,ECO:0000303\|Ref.3;Dbxref=PMID:17974005
Q8IYB7	641	670	250	885	Alternative sequence	ID=VSP_030373;Note=In isoform 4. Missing;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303\|PubMed:17974005,ECO:0000303\|Ref.3;Dbxref=PMID:17974005
Q8IYB7	641	670	357	885	Alternative sequence	ID=VSP_030374;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:17974005;Dbxref=PMID:17974005
Q8IYB7	641	670	357	885	Alternative sequence	ID=VSP_030374;Note=In isoform 5. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:17974005;Dbxref=PMID:17974005
Q8IYB7	641	670	604	885	Alternative sequence	ID=VSP_030377;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q8IYB7	641	670	604	885	Alternative sequence	ID=VSP_030377;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:14702039;Dbxref=PMID:14702039
Q8IYB7	641	670	620	885	Alternative sequence	ID=VSP_030378;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q8IYB7	641	670	620	885	Alternative sequence	ID=VSP_030378;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:15489334;Dbxref=PMID:15489334
Q8IYB7	641	670	1	885	Chain	ID=PRO_0000314817;Note=DIS3-like exonuclease 2
Q8IYB7	641	670	1	885	Chain	ID=PRO_0000314817;Note=DIS3-like exonuclease 2

Top

3'-UTR located exon skipping events that lost miRNA binding sites in DIS3L2

3'-UTR exon skipping evnets lost miRNA binding.

Tissue type

ENST

Exon skip start

Exon skip end

microRNA

Binding site by TargetScan

Binding type by TargetScan

Bdinding site by miRanda

Score of miRanda

Energy by miRanda

Top

SNVs in the skipped exons for DIS3L2

- Differential PSIs between mutated versus non-mutated samples.

- Depth of Coverage in the skipped exon of the mutated samples.

- Sashimi plot in the skipped exon of the mutated samples.

- Non-synonymous mutations located in the skipped exons.

Cancer type

Sample

ESID

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

- Non-synonymous mutations located in the skipped exons in CCLE.

Sample

Skipped exon start

Skipped exon end

Mutation start

Mutation end

Mutation type

Reference seq

Mutation seq

AAchange

Top

AD stage-associated exon skippint events for DIS3L2

Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR).

AD stage info

Cohort

Tissue

SE id

Coefficient

P-value

Chromosome

Strand

E1 start

E1 end

Skipped start

Skipped end

E2 start

E2 end

Top

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for DIS3L2

sQTL information located at the skipped exons.

Tissue type

Exon skip ID

SNP id

Location

P-value

FDR

Top

Correlation with RNA binding proteins (RBPs) for DIS3L2

Correlated RBP and related information.

Tissue type	RBP name	Exon skip ID	Correlation coeifficient	P-value
CB	HNRNPA2B1	exon_skip_194467	4.114758e-01	1.149059e-07
CB	CNOT4	exon_skip_293361	-5.213328e-01	2.551656e-12
IFG	RBM25	exon_skip_194467	-5.411270e-01	9.305012e-03
IFG	RBM6	exon_skip_194467	-4.255860e-01	4.830146e-02
IFG	SRSF11	exon_skip_194467	-4.952590e-01	1.909718e-02
IFG	MBNL1	exon_skip_194467	-4.720346e-01	2.655065e-02
IFG	IGF2BP2	exon_skip_194467	-4.591382e-01	3.159419e-02
IFG	RBM47	exon_skip_194467	-4.580056e-01	3.207097e-02
IFG	PTBP1	exon_skip_194467	-4.410966e-01	3.988828e-02
IFG	PABPC4	exon_skip_194467	-4.801631e-01	2.371648e-02
IFG	SRSF1	exon_skip_194467	-4.615837e-01	3.058384e-02
IFG	SRSF9	exon_skip_194467	-5.058528e-01	1.631142e-02
IFG	SRSF5	exon_skip_194467	-4.749377e-01	2.550906e-02
IFG	SART3	exon_skip_194467	-4.488103e-01	3.615569e-02
IFG	PABPN1L	exon_skip_150015	5.284052e-01	5.521047e-03
IFG	PTBP1	exon_skip_150015	5.126977e-01	7.403266e-03

Top

RelatedDrugs for DIS3L2

Approved drugs targeting this gene.
(DrugBank Version 5.1.0 2018-04-02)

UniProtAcc

DrugBank ID

Drug name

Drug activity

Drug type

Drug status

Top

RelatedDiseases for DIS3L2

Diseases associated with this gene.
(DisGeNet 4.0)

Gene

Disease ID

Disease name

# pubmeds

Source

	Gene summary
	Gene structures and expression levels
	Exon skipping events with PSIs in RPSMAP, MSBB, and Mayo
	Open reading frame (ORF) annotation in the exon skipping event
	Exon skipping events in the canonical protein sequence
	3'-UTR located exon skipping events lost miRNA binding sites
	SNVs in the skipped exons with depth of coverage
	AD stage-associated exon skipping events
	Splicing Quantitative Trait Loci (sQTLs) in the skipped exons
	Correlation with RNA binding proteins (RBPs)
	Related drugs with this gene
	Related diseases with this gene

Home

Download

Statistics

Landscape

Help

Contact

Gene summary for DIS3L2

Gene structures and expression levels for DIS3L2

Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for DIS3L2

Open reading frame (ORF) annotation in the exon skipping event for DIS3L2

Infer the effects of exon skipping event on protein functional features for DIS3L2

3'-UTR located exon skipping events that lost miRNA binding sites in DIS3L2

SNVs in the skipped exons for DIS3L2

AD stage-associated exon skippint events for DIS3L2

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for DIS3L2

Correlation with RNA binding proteins (RBPs) for DIS3L2

RelatedDrugs for DIS3L2

RelatedDiseases for DIS3L2