|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for AGAP1 |
 Gene summary |
| Gene information | Gene symbol | AGAP1 | Gene ID | 116987 |
| Gene name | ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 | |
| Synonyms | AGAP-1|CENTG2|GGAP1|cnt-g2 | |
| Cytomap | 2q37.2 | |
| Type of gene | protein-coding | |
| Description | arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1Arf GAP with GTP-binding protein-like, ANK repeat and PH domains 1GTP-binding and GTPase-activating protein 1centaurin, gamma 2 | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Gene structures and expression levels for AGAP1 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000157985
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| PG | UP | ENST00000453371.2 | AGAP1-209:lncRNA:AGAP1 | 1.389482e+01 | 6.991873e+00 | 2.198711e-06 | 1.631686e-04 |
| CB | UP | ENST00000409538.5 | AGAP1-205:protein_coding:AGAP1 | 9.345257e+01 | 9.768408e-01 | 2.139023e-10 | 1.200862e-08 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for AGAP1 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_117160 | chr2 | 235930765:235930923:235968462:235968623:236014805:236014879 | 235968462:235968623 |
| exon_skip_134516 | chr2 | 235968468:235968623:236014805:236014879:236036561:236036697 | 236014805:236014879 |
| exon_skip_14948 | chr2 | 235908842:235908906:235930765:235930923:235968462:235968623 | 235930765:235930923 |
| exon_skip_182611 | chr2 | 235968462:235968623:236014805:236014879:236036561:236036697 | 236014805:236014879 |
| exon_skip_19619 | chr2 | 235908842:235908906:235968462:235968623:236036561:236036697 | 235968462:235968623 |
| exon_skip_202323 | chr2 | 235908842:235908906:235968462:235968623:236014805:236014879 | 235968462:235968623 |
| exon_skip_204807 | chr2 | 235807239:235807331:235883345:235883449:235908738:235908906 | 235883345:235883449 |
| exon_skip_257607 | chr2 | 235709179:235709237:235717557:235717644:235740963:235741048 | 235717557:235717644 |
| exon_skip_32220 | chr2 | 235797759:235797886:235799367:235799522:235807239:235807331 | 235799367:235799522 |
| exon_skip_52739 | chr2 | 235744698:235744839:235750354:235750488:235797759:235797886 | 235750354:235750488 |
| exon_skip_73490 | chr2 | 235883395:235883449:235908738:235908906:235930765:235930923 | 235908738:235908906 |
| exon_skip_88962 | chr2 | 235930765:235930923:235968462:235968623:236036561:236036697 | 235968462:235968623 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
 |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
| exon_skip_125204 | ROSMAP_DLPFC | 6.875393e-01 | 7.927451e-01 | -1.052058e-01 | 3.325540e-05 |
Top |
Open reading frame (ORF) annotation in the exon skipping event for AGAP1 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000304032 | 235717557 | 235717644 | Frame-shift |
| ENST00000304032 | 235750354 | 235750488 | In-frame |
| ENST00000304032 | 235799367 | 235799522 | In-frame |
| ENST00000304032 | 235883345 | 235883449 | In-frame |
| ENST00000304032 | 235930765 | 235930923 | In-frame |
| ENST00000304032 | 235968462 | 235968623 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000304032 | 235750354 | 235750488 | In-frame |
| ENST00000304032 | 235799367 | 235799522 | In-frame |
| ENST00000304032 | 235930765 | 235930923 | In-frame |
| ENST00000304032 | 235968462 | 235968623 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000304032 | 235717557 | 235717644 | Frame-shift |
| ENST00000304032 | 235908738 | 235908906 | Frame-shift |
| ENST00000304032 | 235750354 | 235750488 | In-frame |
| ENST00000304032 | 235799367 | 235799522 | In-frame |
| ENST00000304032 | 235883345 | 235883449 | In-frame |
| ENST00000304032 | 235930765 | 235930923 | In-frame |
| ENST00000304032 | 235968462 | 235968623 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for AGAP1 |
p-ENSG00000157985_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000304032 | 10849 | 857 | 235750354 | 235750488 | 1120 | 1253 | 180 | 224 |
| ENST00000304032 | 10849 | 857 | 235799367 | 235799522 | 1383 | 1537 | 267 | 319 |
| ENST00000304032 | 10849 | 857 | 235883345 | 235883449 | 1632 | 1735 | 350 | 385 |
| ENST00000304032 | 10849 | 857 | 235930765 | 235930923 | 1906 | 2063 | 442 | 494 |
| ENST00000304032 | 10849 | 857 | 235968462 | 235968623 | 2065 | 2225 | 495 | 548 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000304032 | 10849 | 857 | 235750354 | 235750488 | 1120 | 1253 | 180 | 224 |
| ENST00000304032 | 10849 | 857 | 235799367 | 235799522 | 1383 | 1537 | 267 | 319 |
| ENST00000304032 | 10849 | 857 | 235930765 | 235930923 | 1906 | 2063 | 442 | 494 |
| ENST00000304032 | 10849 | 857 | 235968462 | 235968623 | 2065 | 2225 | 495 | 548 |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000304032 | 10849 | 857 | 235750354 | 235750488 | 1120 | 1253 | 180 | 224 |
| ENST00000304032 | 10849 | 857 | 235799367 | 235799522 | 1383 | 1537 | 267 | 319 |
| ENST00000304032 | 10849 | 857 | 235883345 | 235883449 | 1632 | 1735 | 350 | 385 |
| ENST00000304032 | 10849 | 857 | 235930765 | 235930923 | 1906 | 2063 | 442 | 494 |
| ENST00000304032 | 10849 | 857 | 235968462 | 235968623 | 2065 | 2225 | 495 | 548 |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9UPQ3 | 180 | 224 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 180 | 224 | 178 | 181 | Nucleotide binding | Note=GTP;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9UPQ3 | 180 | 224 | 66 | 276 | Region | Note=Small GTPase-like |
| Q9UPQ3 | 267 | 319 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 267 | 319 | 66 | 276 | Region | Note=Small GTPase-like |
| Q9UPQ3 | 267 | 319 | 288 | 288 | Sequence conflict | Note=T->I;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9UPQ3 | 267 | 319 | 288 | 288 | Sequence conflict | Note=T->I;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9UPQ3 | 267 | 319 | 288 | 288 | Sequence conflict | Note=T->I;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9UPQ3 | 350 | 385 | 352 | 405 | Alternative sequence | ID=VSP_011181;Note=In isoform 3. MLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKV->LPFFVLALTASTYLRPAGARARQSSPWPGPRGGQTSPHCAEGPQSAQLSGAMMN;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UPQ3 | 350 | 385 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 350 | 385 | 346 | 588 | Domain | Note=PH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00145 |
| Q9UPQ3 | 442 | 494 | 406 | 857 | Alternative sequence | ID=VSP_011182;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UPQ3 | 442 | 494 | 442 | 494 | Alternative sequence | ID=VSP_011183;Note=In isoform 2. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:10470851,ECO:0000303|PubMed:12640130,ECO:0000303|Ref.2;Dbxref=PMID:10470851,PMID:12640130 |
| Q9UPQ3 | 442 | 494 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 442 | 494 | 346 | 588 | Domain | Note=PH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00145 |
| Q9UPQ3 | 495 | 548 | 406 | 857 | Alternative sequence | ID=VSP_011182;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UPQ3 | 495 | 548 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 495 | 548 | 346 | 588 | Domain | Note=PH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00145 |
| Q9UPQ3 | 495 | 548 | 521 | 521 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244,ECO:0000244;evidence=ECO:0000244|PubMed:23186163,ECO:0000244|PubMed:24275569;Dbxref=PMID:23186163,PMID:24275569 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9UPQ3 | 180 | 224 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 180 | 224 | 178 | 181 | Nucleotide binding | Note=GTP;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9UPQ3 | 180 | 224 | 66 | 276 | Region | Note=Small GTPase-like |
| Q9UPQ3 | 267 | 319 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 267 | 319 | 66 | 276 | Region | Note=Small GTPase-like |
| Q9UPQ3 | 267 | 319 | 288 | 288 | Sequence conflict | Note=T->I;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9UPQ3 | 267 | 319 | 288 | 288 | Sequence conflict | Note=T->I;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9UPQ3 | 267 | 319 | 288 | 288 | Sequence conflict | Note=T->I;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9UPQ3 | 442 | 494 | 406 | 857 | Alternative sequence | ID=VSP_011182;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UPQ3 | 442 | 494 | 442 | 494 | Alternative sequence | ID=VSP_011183;Note=In isoform 2. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:10470851,ECO:0000303|PubMed:12640130,ECO:0000303|Ref.2;Dbxref=PMID:10470851,PMID:12640130 |
| Q9UPQ3 | 442 | 494 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 442 | 494 | 346 | 588 | Domain | Note=PH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00145 |
| Q9UPQ3 | 495 | 548 | 406 | 857 | Alternative sequence | ID=VSP_011182;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UPQ3 | 495 | 548 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 495 | 548 | 346 | 588 | Domain | Note=PH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00145 |
| Q9UPQ3 | 495 | 548 | 521 | 521 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244,ECO:0000244;evidence=ECO:0000244|PubMed:23186163,ECO:0000244|PubMed:24275569;Dbxref=PMID:23186163,PMID:24275569 |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9UPQ3 | 180 | 224 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 180 | 224 | 178 | 181 | Nucleotide binding | Note=GTP;Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q9UPQ3 | 180 | 224 | 66 | 276 | Region | Note=Small GTPase-like |
| Q9UPQ3 | 267 | 319 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 267 | 319 | 66 | 276 | Region | Note=Small GTPase-like |
| Q9UPQ3 | 267 | 319 | 288 | 288 | Sequence conflict | Note=T->I;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9UPQ3 | 267 | 319 | 288 | 288 | Sequence conflict | Note=T->I;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9UPQ3 | 267 | 319 | 288 | 288 | Sequence conflict | Note=T->I;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| Q9UPQ3 | 350 | 385 | 352 | 405 | Alternative sequence | ID=VSP_011181;Note=In isoform 3. MLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKV->LPFFVLALTASTYLRPAGARARQSSPWPGPRGGQTSPHCAEGPQSAQLSGAMMN;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UPQ3 | 350 | 385 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 350 | 385 | 346 | 588 | Domain | Note=PH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00145 |
| Q9UPQ3 | 442 | 494 | 406 | 857 | Alternative sequence | ID=VSP_011182;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UPQ3 | 442 | 494 | 442 | 494 | Alternative sequence | ID=VSP_011183;Note=In isoform 2. Missing;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:10470851,ECO:0000303|PubMed:12640130,ECO:0000303|Ref.2;Dbxref=PMID:10470851,PMID:12640130 |
| Q9UPQ3 | 442 | 494 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 442 | 494 | 346 | 588 | Domain | Note=PH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00145 |
| Q9UPQ3 | 495 | 548 | 406 | 857 | Alternative sequence | ID=VSP_011182;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q9UPQ3 | 495 | 548 | 1 | 857 | Chain | ID=PRO_0000074218;Note=Arf-GAP with GTPase%2C ANK repeat and PH domain-containing protein 1 |
| Q9UPQ3 | 495 | 548 | 346 | 588 | Domain | Note=PH;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00145 |
| Q9UPQ3 | 495 | 548 | 521 | 521 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244,ECO:0000244;evidence=ECO:0000244|PubMed:23186163,ECO:0000244|PubMed:24275569;Dbxref=PMID:23186163,PMID:24275569 |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in AGAP1 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for AGAP1 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for AGAP1 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for AGAP1 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
| HCC | exon_skip_14948 | rs7571708 | chr2:235923929 | 2.615090e-04 | 2.017412e-02 |
| HCC | exon_skip_14948 | rs10182604 | chr2:235925171 | 4.770980e-04 | 3.267102e-02 |
| HCC | exon_skip_14948 | rs7572513 | chr2:235918447 | 4.822650e-04 | 3.297020e-02 |
| HCC | exon_skip_14948 | rs9653218 | chr2:235903765 | 5.434118e-04 | 3.621826e-02 |
| HCC | exon_skip_14948 | rs6722180 | chr2:235924714 | 5.543821e-04 | 3.680430e-02 |
Top |
Correlation with RNA binding proteins (RBPs) for AGAP1 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
| CB | RBM4 | exon_skip_14948 | 5.384292e-01 | 4.179174e-13 |
| CB | SRSF11 | exon_skip_134516 | 4.594665e-01 | 1.258936e-09 |
| CB | HNRNPK | exon_skip_134516 | 5.141649e-01 | 4.851517e-12 |
| CB | HNRNPDL | exon_skip_134516 | 4.424075e-01 | 5.885614e-09 |
| CB | HNRNPD | exon_skip_134516 | 4.619637e-01 | 9.973009e-10 |
| CB | HNRNPL | exon_skip_134516 | 4.084867e-01 | 9.923371e-08 |
| CB | SRSF9 | exon_skip_134516 | 4.544974e-01 | 1.990315e-09 |
| FL | SRSF9 | exon_skip_125204 | 4.008159e-01 | 4.872706e-09 |
| HCC | DAZAP1 | exon_skip_134516 | -5.706855e-01 | 1.207962e-24 |
| HCC | RBMS2 | exon_skip_134516 | -6.080752e-01 | 1.367981e-28 |
| HCC | RBMS1 | exon_skip_134516 | -4.109036e-01 | 2.211547e-12 |
| HCC | RBMS3 | exon_skip_134516 | -5.141290e-01 | 1.496624e-19 |
| HCC | ZNF638 | exon_skip_134516 | -5.173767e-01 | 8.087875e-20 |
| HCC | SRSF11 | exon_skip_134516 | -5.352755e-01 | 2.411286e-21 |
| HCC | CNOT4 | exon_skip_134516 | -4.164816e-01 | 1.038115e-12 |
| HCC | KHDRBS3 | exon_skip_134516 | -5.842631e-01 | 5.103123e-26 |
| HCC | FUBP3 | exon_skip_134516 | -5.039170e-01 | 9.935447e-19 |
| HCC | SRSF5 | exon_skip_134516 | -4.918809e-01 | 8.539007e-18 |
| IFG | KHDRBS3 | exon_skip_182611 | 4.685577e-01 | 1.190672e-02 |
| PCC | RBMS2 | exon_skip_134516 | -6.409931e-01 | 8.288824e-26 |
| PCC | RBMS1 | exon_skip_134516 | -5.433463e-01 | 1.326631e-17 |
| PCC | ZNF638 | exon_skip_134516 | -4.326547e-01 | 4.903831e-11 |
| PCC | SRSF11 | exon_skip_134516 | -4.277891e-01 | 8.479618e-11 |
| PCC | FUBP3 | exon_skip_134516 | -4.223401e-01 | 1.549802e-10 |
| STG | SRSF2 | exon_skip_182611 | 4.271324e-01 | 3.478975e-04 |
| STG | CNOT4 | exon_skip_182611 | 4.105249e-01 | 6.178552e-04 |
| STG | HNRNPK | exon_skip_182611 | 4.733398e-01 | 5.973322e-05 |
| STG | KHDRBS3 | exon_skip_182611 | 5.387291e-01 | 3.066987e-06 |
| STG | HNRNPDL | exon_skip_182611 | 4.087141e-01 | 6.566255e-04 |
| STG | HNRNPL | exon_skip_182611 | 4.506308e-01 | 1.465355e-04 |
| TC | CNOT4 | exon_skip_134516 | 4.007218e-01 | 1.514728e-07 |
| TC | KHDRBS2 | exon_skip_134516 | 7.523257e-01 | 1.930323e-30 |
| TC | KHDRBS3 | exon_skip_134516 | 6.272835e-01 | 6.996470e-19 |
| TC | HNRNPD | exon_skip_134516 | 5.028878e-01 | 1.229895e-11 |
Top |
RelatedDrugs for AGAP1 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for AGAP1 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|