|
||||||
|
 | |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| 3'-UTR located exon skipping events lost miRNA binding sites |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| |
| |
|
Gene summary for OLFM1 |
 Gene summary |
| Gene information | Gene symbol | OLFM1 | Gene ID | 10439 |
| Gene name | olfactomedin 1 | |
| Synonyms | AMY|NOE1|NOELIN1|OlfA | |
| Cytomap | 9q34.3 | |
| Type of gene | protein-coding | |
| Description | noelinneuroblastoma proteinneuronal olfactomedin-related ER localized proteinolfactomedin related ER localized proteinpancortin 1 | |
| Modification date | 20200313 | |
| UniProtAcc | ||
| Context |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| OLFM1 | GO:0043065 | positive regulation of apoptotic process | 16751333 |
Top |
Gene structures and expression levels for OLFM1 |
| Skipped exons in the ROSMAP, MSBB, and Mayo based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
ENSG00000130558
| Differentially expressed gene analysis across multiple brain tissues between AD and control. |
| Tissue type | DEG direction | Base mean exp. | log2FC(AD/control) | P-value | Adj. p-value |
| Differentially expressed isoform analysis across multiple brain tissues between AD and control. |
 |
| Tissue type | DEG direction | ENST | Transcript info. | Base mean exp. | log2FC(AD/control) | P-value | Adjc. p-value |
| IFG | UP | ENST00000252854.8 | OLFM1-201:protein_coding:OLFM1 | 6.496316e+00 | 2.096606e+01 | 3.802025e-12 | 2.540640e-08 |
| CB | UP | ENST00000371793.7 | OLFM1-204:protein_coding:OLFM1 | 7.804836e+02 | 1.058908e+00 | 7.724513e-05 | 5.959826e-04 |
| TC | DOWN | ENST00000539529.5 | OLFM1-210:protein_coding:OLFM1 | 1.795239e+01 | -1.338336e+00 | 1.888060e-03 | 1.606644e-02 |
| Landscape of isoform expressions across multiple brain tissues between AD and control. |
 |
Top |
Exon skipping events with PSIs in ROSMAP, MSBB, and Mayo for OLFM1 |
| Landscape of individual exon skipping event across AD tissues and controls (PSI heatmap). |
 |
| All exon skipping events in AD cohorts. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon |
| exon_skip_119750 | chr9 | 135098286:135098505:135106749:135106855:135119504:135119976 | 135106749:135106855 |
| exon_skip_137088 | chr9 | 135098435:135098505:135106749:135106855:135119504:135119558 | 135106749:135106855 |
| exon_skip_196905 | chr9 | 135075666:135075802:135090195:135090344:135095864:135096019 | 135090195:135090344 |
| exon_skip_258099 | chr9 | 135087739:135088139:135090195:135090344:135095864:135096019 | 135090195:135090344 |
| exon_skip_275789 | chr9 | 135098286:135098505:135106749:135106855:135119504:135119598 | 135106749:135106855 |
| exon_skip_291791 | chr9 | 135098286:135098505:135106749:135106855:135119504:135119543 | 135106749:135106855 |
| exon_skip_63434 | chr9 | 135095986:135096019:135098286:135098505:135106749:135106855 | 135098286:135098505 |
| exon_skip_74302 | chr9 | 135075666:135075802:135090195:135090344:135095864:135095977 | 135090195:135090344 |
| Differentially expressed PSI values of individual exon skipping events in multiple brain tissues between AD and control. |
| Exon skipping information | Tissue type | Avg(PSIs) in AD | Avg(PSIs) in control | Difference (PSI) | Adj. p-value |
Top |
Open reading frame (ORF) annotation in the exon skipping event for OLFM1 |
| Open reading frame (ORF) of individual exon skipping events in ROSMAP based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000371793 | 135098286 | 135098505 | Frame-shift |
| ENST00000371793 | 135106749 | 135106855 | Frame-shift |
| ENST00000371793 | 135090195 | 135090344 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in MSBB based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000371793 | 135098286 | 135098505 | Frame-shift |
| Open reading frame (ORF) of individual exon skipping events in Mayo based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000371793 | 135098286 | 135098505 | Frame-shift |
| ENST00000371793 | 135106749 | 135106855 | Frame-shift |
Top |
Infer the effects of exon skipping event on protein functional features for OLFM1 |
p-ENSG00000130558_img4.png |
| Loci of skipped exons in ROSMAP across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000371793 | 2461 | 485 | 135090195 | 135090344 | 403 | 551 | 50 | 100 |
| Loci of skipped exons in MSBB across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Loci of skipped exons in Mayo across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| Lost protein functional features of individual exon skipping events in ROSMAP. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q99784 | 50 | 100 | 1 | 50 | Alternative sequence | ID=VSP_003759;Note=In isoform 3 and isoform 4. MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTG->MPGRWRWQRDMHPARKLLSLLFLILMGTELTQ;Ontology_term=ECO:0000303,ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:15489334,ECO:0000303|PubMed:9039501,ECO:00003 |
| Q99784 | 50 | 100 | 1 | 50 | Alternative sequence | ID=VSP_055625;Note=In isoform 5. MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTG->MGEAPGREGRGPCPQLESPRRRR;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| Q99784 | 50 | 100 | 17 | 485 | Chain | ID=PRO_0000020074;Note=Noelin |
| Q99784 | 50 | 100 | 87 | 225 | Coiled coil | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Lost protein functional features of individual exon skipping events in MSBB. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Lost protein functional features of individual exon skipping events in Mayo. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
Top |
3'-UTR located exon skipping events that lost miRNA binding sites in OLFM1 |
| 3'-UTR exon skipping evnets lost miRNA binding. |
| Tissue type | ENST | Exon skip start | Exon skip end | microRNA | Binding site by TargetScan | Binding type by TargetScan | Bdinding site by miRanda | Score of miRanda | Energy by miRanda |
Top |
SNVs in the skipped exons for OLFM1 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Depth of Coverage in the skipped exon of the mutated samples. |
| - Sashimi plot in the skipped exon of the mutated samples. |
| - Non-synonymous mutations located in the skipped exons. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
AD stage-associated exon skippint events for OLFM1 |
| Associated exon skipping events with Braak staging or Clinical Dementia Rating (CDR). |
| AD stage info | Cohort | Tissue | SE id | Coefficient | P-value | Chromosome | Strand | E1 start | E1 end | Skipped start | Skipped end | E2 start | E2 end |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for OLFM1 |
| sQTL information located at the skipped exons. |
| Tissue type | Exon skip ID | SNP id | Location | P-value | FDR |
Top |
Correlation with RNA binding proteins (RBPs) for OLFM1 |
| Correlated RBP and related information. |
| Tissue type | RBP name | Exon skip ID | Correlation coeifficient | P-value |
Top |
RelatedDrugs for OLFM1 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for OLFM1 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|