FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9895

FusionGeneSummary for DHRSX_RPS4Y1

check button Fusion gene summary
Fusion gene informationFusion gene name: DHRSX_RPS4Y1
Fusion gene ID: 9895
HgeneTgene
Gene symbol

DHRSX

RPS4Y1

Gene ID

207063

6192

Gene namedehydrogenase/reductase X-linkedribosomal protein S4 Y-linked 1
SynonymsCXorf11|DHRS5X|DHRS5Y|DHRSXY|DHRSY|SDR46C1|SDR7C6RPS4Y|S4
Cytomap

Xp22.33 and Yp11.2

Yp11.2

Type of geneprotein-codingprotein-coding
Descriptiondehydrogenase/reductase SDR family member on chromosome Xdehydrogenase/reductase (SDR family) X chromosomedehydrogenase/reductase (SDR family) X-linkeddehydrogenase/reductase (SDR family) Y-linkedshort chain dehydrogenase/reductase family 46C member 140S ribosomal protein S4, Y isoform 140S ribosomal protein S4, Yribosomal protein S4, Y-linkedribosomal protein S4Ysmall ribosomal subunit protein eS4
Modification date2018052320180523
UniProtAcc

Q8N5I4

P22090

Ensembl transtripts involved in fusion geneENST00000334651, ENST00000464935, 
ENST00000250784, ENST00000477725, 
Fusion gene scores* DoF score2 X 1 X 2=45 X 5 X 3=75
# samples 26
** MAII scorelog2(2/4*10)=2.32192809488736log2(6/75*10)=-0.321928094887362
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DHRSX [Title/Abstract] AND RPS4Y1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPAADTCGA-F2-A7TX-01ADHRSXchrY

2159543

-RPS4Y1chrY

2733129

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000334651ENST00000250784DHRSXchrY

2159543

-RPS4Y1chrY

2733129

+
5CDS-3UTRENST00000334651ENST00000477725DHRSXchrY

2159543

-RPS4Y1chrY

2733129

+
intron-3CDSENST00000464935ENST00000250784DHRSXchrY

2159543

-RPS4Y1chrY

2733129

+
intron-3UTRENST00000464935ENST00000477725DHRSXchrY

2159543

-RPS4Y1chrY

2733129

+

Top

FusionProtFeatures for DHRSX_RPS4Y1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DHRSX

Q8N5I4

RPS4Y1

P22090

Involved in the positive regulation of starvation-induced autophagy (PubMed:25076851).{ECO:0000269|PubMed:25076851}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDHRSXchrY:2159543chrY:2733129ENST00000334651-4747_71129331Nucleotide bindingNAD or NADP

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRPS4Y1chrY:2159543chrY:2733129ENST00000250784+4742_104177264DomainNote=S4 RNA-binding


Top

FusionGeneSequence for DHRSX_RPS4Y1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DHRSX_ENST00000334651_chrY_2159543_-_RPS4Y1_ENST00000250784_chrY_2733129_+_216aa
MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGTSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEE
TLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DHRSX_ENST00000334651_chrY_2159543_-_RPS4Y1_ENST00000250784_chrY_2733129_+_648nt
ATGTCGCCATTGTCTGCGGCGCGGGCGGCCCTGCGGGTCTACGCGGTAGGCGCCGCGGTGATCCTGGCGCAGCTGCTGCGGCGCTGCCGC
GGGGGCTTCCTGGAGCCAGTTTTCCCCCCACGACCTGACCGTGTCGCTATAGTGACGGGAGGGACAGATGGCATTGGCTATTCTACAGCG
AAGCATCTGGCGAGACTTGGCATGCATGTTATCATAGCTGGAAATAATGACAGCAAAGCCAAACAAGTTGTAAGCAAAATAAAAGAAGAA
ACCTTGAACGACAAAGTGGAATTTTTATACTGTGACTTGGCTTCCATGACTTCCATCCGGCAGTTTGTGCAGAAGTTCAAGATGAAGAAG
ATTCCTCTCCATGTCCTGATCAACAATGGCAATTTGTGTATGGTGATTGGTGGAGCCAACCTCGGTCGTGTTGGTGTGATCACCAACAGG
GAAAGACATCCTGGTTCTTTTGATGTGGTGCATGTGAAGGATGCCAATGGCAACAGCTTTGCCACGAGGCTTTCCAACATTTTTGTCATT
GGCAATGGCAATAAACCTTGGATTTCCCTGCCCAGGGGAAAGGGCATTCGACTTACTGTTGCTGAAGAGAGAGATAAGAGGCTGGCCACC


* Fusion transcript sequences (Full-length transcript).
>In-frame_DHRSX_ENST00000334651_chrY_2159543_-_RPS4Y1_ENST00000250784_chrY_2733129_+_1075nt
GCGCAGAGTCCCGCGGGCGGCGCGGAAGCGGCGGCGGCGCGGCCGGGGCAGCCATGTCGCCATTGTCTGCGGCGCGGGCGGCCCTGCGGG
TCTACGCGGTAGGCGCCGCGGTGATCCTGGCGCAGCTGCTGCGGCGCTGCCGCGGGGGCTTCCTGGAGCCAGTTTTCCCCCCACGACCTG
ACCGTGTCGCTATAGTGACGGGAGGGACAGATGGCATTGGCTATTCTACAGCGAAGCATCTGGCGAGACTTGGCATGCATGTTATCATAG
CTGGAAATAATGACAGCAAAGCCAAACAAGTTGTAAGCAAAATAAAAGAAGAAACCTTGAACGACAAAGTGGAATTTTTATACTGTGACT
TGGCTTCCATGACTTCCATCCGGCAGTTTGTGCAGAAGTTCAAGATGAAGAAGATTCCTCTCCATGTCCTGATCAACAATGGCAATTTGT
GTATGGTGATTGGTGGAGCCAACCTCGGTCGTGTTGGTGTGATCACCAACAGGGAAAGACATCCTGGTTCTTTTGATGTGGTGCATGTGA
AGGATGCCAATGGCAACAGCTTTGCCACGAGGCTTTCCAACATTTTTGTCATTGGCAATGGCAATAAACCTTGGATTTCCCTGCCCAGGG
GAAAGGGCATTCGACTTACTGTTGCTGAAGAGAGAGATAAGAGGCTGGCCACCAAACAGAGCAGTGGCTAAATTGCAGTAGCAGCATATC
TTTTTTTCTTTGCACAAATAAACAGTGAATTCTCGTTTCTTAATGTGTTTTTTCCCCCTTGTGGATAATAGTAGGGTTTGAATTTGCTCA
TGATTTTGGCACTGTCTTAAGATCTCTAGGAATACCACCTATACTTCCTCTGACCCTCCAGTAAATAAACCTTTGCTTCCCTCATACATG
TTACCCACACCATCTCTGTGGGCAGAGTGATGGAGTAGCATTCCAAAACGAAGTACAAAAAACGTATGACATTTCAGAAAGGACGGCATT


Top

FusionGenePPI for DHRSX_RPS4Y1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DHRSXAPP, ATXN1, GCNT3, ZBED1RPS4Y1CALM1, CD81, IGSF8, ICAM1, RNF2, RPS4Y2, PRPS1, CLK1, ZNF746, CYLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DHRSX_RPS4Y1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DHRSX_RPS4Y1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource