|
||||||
|
 | |
| |
| |
| |
| |
|
Fusion gene ID: 9895 |
FusionGeneSummary for DHRSX_RPS4Y1 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: DHRSX_RPS4Y1 | Fusion gene ID: 9895 | Hgene | Tgene | Gene symbol | DHRSX | RPS4Y1 | Gene ID | 207063 | 6192 |
| Gene name | dehydrogenase/reductase X-linked | ribosomal protein S4 Y-linked 1 | |
| Synonyms | CXorf11|DHRS5X|DHRS5Y|DHRSXY|DHRSY|SDR46C1|SDR7C6 | RPS4Y|S4 | |
| Cytomap | Xp22.33 and Yp11.2 | Yp11.2 | |
| Type of gene | protein-coding | protein-coding | |
| Description | dehydrogenase/reductase SDR family member on chromosome Xdehydrogenase/reductase (SDR family) X chromosomedehydrogenase/reductase (SDR family) X-linkeddehydrogenase/reductase (SDR family) Y-linkedshort chain dehydrogenase/reductase family 46C member 1 | 40S ribosomal protein S4, Y isoform 140S ribosomal protein S4, Yribosomal protein S4, Y-linkedribosomal protein S4Ysmall ribosomal subunit protein eS4 | |
| Modification date | 20180523 | 20180523 | |
| UniProtAcc | Q8N5I4 | P22090 | |
| Ensembl transtripts involved in fusion gene | ENST00000334651, ENST00000464935, | ENST00000250784, ENST00000477725, | |
| Fusion gene scores | * DoF score | 2 X 1 X 2=4 | 5 X 5 X 3=75 |
| # samples | 2 | 6 | |
| ** MAII score | log2(2/4*10)=2.32192809488736 | log2(6/75*10)=-0.321928094887362 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: DHRSX [Title/Abstract] AND RPS4Y1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Functional or gene categories assigned by FusionGDB annotation | |||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Fusion gene information from three resources (ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018)) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Data type | Source | Cancer type | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| TCGA | LD | PAAD | TCGA-F2-A7TX-01A | DHRSX | chrY | 2159543 | - | RPS4Y1 | chrY | 2733129 | + |
| * LD: Li Ding group's fusion gene list RV: Roel Verhaak group's fusion gene list ChiTaRs fusion database |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| In-frame | ENST00000334651 | ENST00000250784 | DHRSX | chrY | 2159543 | - | RPS4Y1 | chrY | 2733129 | + |
| 5CDS-3UTR | ENST00000334651 | ENST00000477725 | DHRSX | chrY | 2159543 | - | RPS4Y1 | chrY | 2733129 | + |
| intron-3CDS | ENST00000464935 | ENST00000250784 | DHRSX | chrY | 2159543 | - | RPS4Y1 | chrY | 2733129 | + |
| intron-3UTR | ENST00000464935 | ENST00000477725 | DHRSX | chrY | 2159543 | - | RPS4Y1 | chrY | 2733129 | + |
Top |
FusionProtFeatures for DHRSX_RPS4Y1 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| DHRSX | RPS4Y1 |
| Involved in the positive regulation of starvation-induced autophagy (PubMed:25076851).{ECO:0000269|PubMed:25076851}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at . * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | DHRSX | chrY:2159543 | chrY:2733129 | ENST00000334651 | - | 4 | 7 | 47_71 | 129 | 331 | Nucleotide binding | NAD or NADP |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | RPS4Y1 | chrY:2159543 | chrY:2733129 | ENST00000250784 | + | 4 | 7 | 42_104 | 177 | 264 | Domain | Note=S4 RNA-binding |
Top |
FusionGeneSequence for DHRSX_RPS4Y1 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. (nt: nucleotides, aa: amino acids) |
| * Fusion amino acid sequences. |
| >In-frame_DHRSX_ENST00000334651_chrY_2159543_-_RPS4Y1_ENST00000250784_chrY_2733129_+_216aa MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEE TLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVI |
| * Fusion transcript sequences (only coding sequence (CDS) region). |
| >In-frame_DHRSX_ENST00000334651_chrY_2159543_-_RPS4Y1_ENST00000250784_chrY_2733129_+_648nt ATGTCGCCATTGTCTGCGGCGCGGGCGGCCCTGCGGGTCTACGCGGTAGGCGCCGCGGTGATCCTGGCGCAGCTGCTGCGGCGCTGCCGC GGGGGCTTCCTGGAGCCAGTTTTCCCCCCACGACCTGACCGTGTCGCTATAGTGACGGGAGGGACAGATGGCATTGGCTATTCTACAGCG AAGCATCTGGCGAGACTTGGCATGCATGTTATCATAGCTGGAAATAATGACAGCAAAGCCAAACAAGTTGTAAGCAAAATAAAAGAAGAA ACCTTGAACGACAAAGTGGAATTTTTATACTGTGACTTGGCTTCCATGACTTCCATCCGGCAGTTTGTGCAGAAGTTCAAGATGAAGAAG ATTCCTCTCCATGTCCTGATCAACAATGGCAATTTGTGTATGGTGATTGGTGGAGCCAACCTCGGTCGTGTTGGTGTGATCACCAACAGG GAAAGACATCCTGGTTCTTTTGATGTGGTGCATGTGAAGGATGCCAATGGCAACAGCTTTGCCACGAGGCTTTCCAACATTTTTGTCATT GGCAATGGCAATAAACCTTGGATTTCCCTGCCCAGGGGAAAGGGCATTCGACTTACTGTTGCTGAAGAGAGAGATAAGAGGCTGGCCACC |
| * Fusion transcript sequences (Full-length transcript). |
| >In-frame_DHRSX_ENST00000334651_chrY_2159543_-_RPS4Y1_ENST00000250784_chrY_2733129_+_1075nt GCGCAGAGTCCCGCGGGCGGCGCGGAAGCGGCGGCGGCGCGGCCGGGGCAGCCATGTCGCCATTGTCTGCGGCGCGGGCGGCCCTGCGGG TCTACGCGGTAGGCGCCGCGGTGATCCTGGCGCAGCTGCTGCGGCGCTGCCGCGGGGGCTTCCTGGAGCCAGTTTTCCCCCCACGACCTG ACCGTGTCGCTATAGTGACGGGAGGGACAGATGGCATTGGCTATTCTACAGCGAAGCATCTGGCGAGACTTGGCATGCATGTTATCATAG CTGGAAATAATGACAGCAAAGCCAAACAAGTTGTAAGCAAAATAAAAGAAGAAACCTTGAACGACAAAGTGGAATTTTTATACTGTGACT TGGCTTCCATGACTTCCATCCGGCAGTTTGTGCAGAAGTTCAAGATGAAGAAGATTCCTCTCCATGTCCTGATCAACAATGGCAATTTGT GTATGGTGATTGGTGGAGCCAACCTCGGTCGTGTTGGTGTGATCACCAACAGGGAAAGACATCCTGGTTCTTTTGATGTGGTGCATGTGA AGGATGCCAATGGCAACAGCTTTGCCACGAGGCTTTCCAACATTTTTGTCATTGGCAATGGCAATAAACCTTGGATTTCCCTGCCCAGGG GAAAGGGCATTCGACTTACTGTTGCTGAAGAGAGAGATAAGAGGCTGGCCACCAAACAGAGCAGTGGCTAAATTGCAGTAGCAGCATATC TTTTTTTCTTTGCACAAATAAACAGTGAATTCTCGTTTCTTAATGTGTTTTTTCCCCCTTGTGGATAATAGTAGGGTTTGAATTTGCTCA TGATTTTGGCACTGTCTTAAGATCTCTAGGAATACCACCTATACTTCCTCTGACCCTCCAGTAAATAAACCTTTGCTTCCCTCATACATG TTACCCACACCATCTCTGTGGGCAGAGTGATGGAGTAGCATTCCAAAACGAAGTACAAAAAACGTATGACATTTCAGAAAGGACGGCATT |
Top |
FusionGenePPI for DHRSX_RPS4Y1 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in . |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| DHRSX | APP, ATXN1, GCNT3, ZBED1 | RPS4Y1 | CALM1, CD81, IGSF8, ICAM1, RNF2, RPS4Y2, PRPS1, CLK1, ZNF746, CYLD |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
RelatedDrugs for DHRSX_RPS4Y1 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.0 2018-04-02) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for DHRSX_RPS4Y1 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|