FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9744

FusionGeneSummary for DENND4C_RHOBTB2

check button Fusion gene summary
Fusion gene informationFusion gene name: DENND4C_RHOBTB2
Fusion gene ID: 9744
HgeneTgene
Gene symbol

DENND4C

RHOBTB2

Gene ID

55667

23221

Gene nameDENN domain containing 4CRho related BTB domain containing 2
SynonymsC9orf55|C9orf55B|RAB10GEF|bA513M16.3DBC2
Cytomap

9p22.1

8p21.3

Type of geneprotein-codingprotein-coding
DescriptionDENN domain-containing protein 4CDENN/MADD domain containing 4A pseudogeneDENN/MADD domain containing 4Crho-related BTB domain-containing protein 2deleted in breast cancer 2 gene proteinp83
Modification date2018051920180523
UniProtAcc

Q5VZ89

Q9BYZ6

Ensembl transtripts involved in fusion geneENST00000434457, ENST00000602925, 
ENST00000380432, 
ENST00000519685, 
ENST00000522948, ENST00000251822, 
ENST00000523918, 
Fusion gene scores* DoF score6 X 5 X 5=1502 X 2 X 2=8
# samples 72
** MAII scorelog2(7/150*10)=-1.09953567355091
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: DENND4C [Title/Abstract] AND RHOBTB2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-EJ-7785-01ADENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000434457ENST00000519685DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
In-frameENST00000434457ENST00000522948DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
5CDS-5UTRENST00000434457ENST00000251822DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
5CDS-3UTRENST00000434457ENST00000523918DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
In-frameENST00000602925ENST00000519685DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
In-frameENST00000602925ENST00000522948DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
5CDS-5UTRENST00000602925ENST00000251822DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
5CDS-3UTRENST00000602925ENST00000523918DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
In-frameENST00000380432ENST00000519685DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
In-frameENST00000380432ENST00000522948DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
5CDS-5UTRENST00000380432ENST00000251822DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+
5CDS-3UTRENST00000380432ENST00000523918DENND4Cchr9

19357152

+RHOBTB2chr8

22861938

+

Top

FusionProtFeatures for DENND4C_RHOBTB2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DENND4C

Q5VZ89

RHOBTB2

Q9BYZ6


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDENND4Cchr9:19357152chr8:22861938ENST00000380432+2228191_36413691674DomainuDENN
HgeneDENND4Cchr9:19357152chr8:22861938ENST00000380432+2228385_52113691674DomaincDENN
HgeneDENND4Cchr9:19357152chr8:22861938ENST00000380432+222840_19913691674DomainMABP
HgeneDENND4Cchr9:19357152chr8:22861938ENST00000380432+2228523_64113691674DomaindDENN
HgeneDENND4Cchr9:19357152chr8:22861938ENST00000380432+2228821_85513691674RepeatNote=PPR
TgeneRHOBTB2chr9:19357152chr8:22861938ENST00000251822+010266_442-4728DomainBTB 1
TgeneRHOBTB2chr9:19357152chr8:22861938ENST00000251822+010500_567-4728DomainBTB 2
TgeneRHOBTB2chr9:19357152chr8:22861938ENST00000251822+010140_143-4728Nucleotide bindingGTP
TgeneRHOBTB2chr9:19357152chr8:22861938ENST00000251822+01021_28-4728Nucleotide bindingGTP
TgeneRHOBTB2chr9:19357152chr8:22861938ENST00000251822+01084_88-4728Nucleotide bindingGTP
TgeneRHOBTB2chr9:19357152chr8:22861938ENST00000251822+0101_210-4728RegionNote=Rho-like

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for DENND4C_RHOBTB2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DENND4C_ENST00000434457_chr9_19357152_+_RHOBTB2_ENST00000519685_chr8_22861938_+_2386aa
MIEDKGPRVTDYFVVAGLTDTSTLLDQEINRLDTKSTGPKAPITDIAIIIKSAGETVPEGYTCVEATPSALQANLNTGSLKSPELFLCTK
RGRDKPPLTDIGVLTEGKERLIPGCEVILATPTGRCANVNNSSTTSQRIFITTRRAPPVRPQNSLAVTDICVIVTSKGETPPHTFCKVDK
NLNCGMWGSSVFLCTKKSVPASNAIATKAGLIFRTPEEDTESFPLSESDVPLFCLPMGATIECWDPETKTPLPVFSTFVLTGSSAKKVTG
AAIQFTEPYSRELLSEKQLMHLGLLTPVERKMVSKSINTNKCICLLSHWPFFEAFRKFLMFIYKLSVSGPHPLPIEKHISHFMQNIPFPS
PQRPRILVQLSVHDALILSQPVSTPLPLSGANFSTLLMNLGPENCATLLLFVLLESKILLHSLRPAVLTGVAEAVVAMIFPFQWQCPTIP
LCPLSLAAVLSAPLPFIVGVDSRTFDLHDPPQDVVCIDLDTNMLTVSDEKKNMNWKQLPKKPCKNLLSTLKKLTPQLSSVHQKTQEGSAI
DMTPIEADFSWQKKMTQLEMEIQEAFLRFMASILKGTRTTLRPITEAPSNKATAADSLFDRQGFLKSRDRATAKFTTLLSKTQIFIRFIE
ECSFVSDKDTGLAFFDDCIEKLFPDKGTEKTDKVDFDSAEDTRLIELDDSQKSEHTVFIMPPEPPPDDGKDLSPKYSYKYFPRLDLKLFD
RPQELKLCFSRHPTGNSITKSPPLMAKRTKQEIKTAHKLAKRCTTNPPQWAKCLFSHCYSLWFICLPATVRVSHPKVRALQQATDVLIKM
RKTDVDPLDEVCTRVVMQLCGLWGHPVLAVRVLFEMKTARIKPNAITTGTTNKVVLESPWPSSTRSGIFLWTKVRNVVRGLAQFRQPLKK
TVQRSQVSSISALQNVTGGSDGDTVSHGSVDSSNDANNGEHTVFVRDLIRLESIDNHSSTGGQSDQGYGSKDELIKDDAEIHVPEEQAAR
ELITKTKMQTEEVCDASAIVAKHSQPSPEPHSPTEPPAWGSSIVKVPSGIFDVNSRKSSTGSISNVLFSTQDPVEDAVFGEATNLKKNGD
RGEKRQKHFPERSCSFSSESRAGMLLKKSSLDSNSSEMAIMMGADAKILTAALTCPKTSLLHIARTHSFENVSCHLPDSRTCMSESTWNP
EHRSSPVPEMLEESQELLEPVVDDVPKTTATVDTTESLLSDSNSNQSRDLKTVSKDLRNKRSSLTGIAKVVQREDVETGLDPLSLLATEC
TGGKTPDSEDKLFSPVIARNLADEIESTMNLKSPLGSKSSSMELHREENRESGMTTAFIHALERRSSLPLDHGSPAQENPESEKSSPAVS
RSKTFTGRFKQQTPSRTHKERSTSLSALVRSSPHGSLGSVVNSLSGLKLDNILSGPKIDVLKSGMKQAATVASKMWVAVASAYSYSDDEE
ETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHTPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSITQ
NCAMEVLMSSCSQCRACGALVTDEEIMAGWTADDSNLNTACPFCKSNFLPLLNIEFKDLRGSASFFLKPSTSGDSLQSGSIPLANESLEH
KPVSSLAEPDLINFMDFPKHNQIITEETGSAVEPRSRLMDSDMDTERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPT
VWAIDQTRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFATGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQL
DLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKELGIPYTETSVVAQFGIKDVFDNAIRAALISRRHLQFWKSHLRNVQRPLLQAP
FLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFAHKIYLSTSSSKFTDLFLMDLSEGELGGPSEPGGTHPEDHQGH
SDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLM
VVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDV
TFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQ
YTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADWCLHHICTNYNNVCRKFPRDMKAMSPENQETFEKHRWPPVWYLKEEDHYQRAR

>In-frame_DENND4C_ENST00000434457_chr9_19357152_+_RHOBTB2_ENST00000522948_chr8_22861938_+_2386aa
MIEDKGPRVTDYFVVAGLTDTSTLLDQEINRLDTKSTGPKAPITDIAIIIKSAGETVPEGYTCVEATPSALQANLNTGSLKSPELFLCTK
RGRDKPPLTDIGVLTEGKERLIPGCEVILATPTGRCANVNNSSTTSQRIFITTRRAPPVRPQNSLAVTDICVIVTSKGETPPHTFCKVDK
NLNCGMWGSSVFLCTKKSVPASNAIATKAGLIFRTPEEDTESFPLSESDVPLFCLPMGATIECWDPETKTPLPVFSTFVLTGSSAKKVTG
AAIQFTEPYSRELLSEKQLMHLGLLTPVERKMVSKSINTNKCICLLSHWPFFEAFRKFLMFIYKLSVSGPHPLPIEKHISHFMQNIPFPS
PQRPRILVQLSVHDALILSQPVSTPLPLSGANFSTLLMNLGPENCATLLLFVLLESKILLHSLRPAVLTGVAEAVVAMIFPFQWQCPTIP
LCPLSLAAVLSAPLPFIVGVDSRTFDLHDPPQDVVCIDLDTNMLTVSDEKKNMNWKQLPKKPCKNLLSTLKKLTPQLSSVHQKTQEGSAI
DMTPIEADFSWQKKMTQLEMEIQEAFLRFMASILKGTRTTLRPITEAPSNKATAADSLFDRQGFLKSRDRATAKFTTLLSKTQIFIRFIE
ECSFVSDKDTGLAFFDDCIEKLFPDKGTEKTDKVDFDSAEDTRLIELDDSQKSEHTVFIMPPEPPPDDGKDLSPKYSYKYFPRLDLKLFD
RPQELKLCFSRHPTGNSITKSPPLMAKRTKQEIKTAHKLAKRCTTNPPQWAKCLFSHCYSLWFICLPATVRVSHPKVRALQQATDVLIKM
RKTDVDPLDEVCTRVVMQLCGLWGHPVLAVRVLFEMKTARIKPNAITTGTTNKVVLESPWPSSTRSGIFLWTKVRNVVRGLAQFRQPLKK
TVQRSQVSSISALQNVTGGSDGDTVSHGSVDSSNDANNGEHTVFVRDLIRLESIDNHSSTGGQSDQGYGSKDELIKDDAEIHVPEEQAAR
ELITKTKMQTEEVCDASAIVAKHSQPSPEPHSPTEPPAWGSSIVKVPSGIFDVNSRKSSTGSISNVLFSTQDPVEDAVFGEATNLKKNGD
RGEKRQKHFPERSCSFSSESRAGMLLKKSSLDSNSSEMAIMMGADAKILTAALTCPKTSLLHIARTHSFENVSCHLPDSRTCMSESTWNP
EHRSSPVPEMLEESQELLEPVVDDVPKTTATVDTTESLLSDSNSNQSRDLKTVSKDLRNKRSSLTGIAKVVQREDVETGLDPLSLLATEC
TGGKTPDSEDKLFSPVIARNLADEIESTMNLKSPLGSKSSSMELHREENRESGMTTAFIHALERRSSLPLDHGSPAQENPESEKSSPAVS
RSKTFTGRFKQQTPSRTHKERSTSLSALVRSSPHGSLGSVVNSLSGLKLDNILSGPKIDVLKSGMKQAATVASKMWVAVASAYSYSDDEE
ETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHTPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSITQ
NCAMEVLMSSCSQCRACGALVTDEEIMAGWTADDSNLNTACPFCKSNFLPLLNIEFKDLRGSASFFLKPSTSGDSLQSGSIPLANESLEH
KPVSSLAEPDLINFMDFPKHNQIITEETGSAVEPRSRLMDSDMDTERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPT
VWAIDQTRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFATGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQL
DLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKELGIPYTETSVVAQFGIKDVFDNAIRAALISRRHLQFWKSHLRNVQRPLLQAP
FLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFAHKIYLSTSSSKFTDLFLMDLSEGELGGPSEPGGTHPEDHQGH
SDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLM
VVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDV
TFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQ
YTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADWCLHHICTNYNNVCRKFPRDMKAMSPENQETFEKHRWPPVWYLKEEDHYQRAR

>In-frame_DENND4C_ENST00000602925_chr9_19357152_+_RHOBTB2_ENST00000519685_chr8_22861938_+_2337aa
MIEDKGPRVTDYFVVAGLTDTSTLLDQEINRLDTKSTGPKAPITDIAIIIKSAGETVPEGYTCVEATPSALQANLNTGSLKSPELFLCTK
RGRDKPPLTDIGVLTEGKERLIPGCEVILATPTGRCANVNNSSTTSQRIFITTRRAPPVRPQNSLAVTDICVIVTSKGETPPHTFCKVDK
NLNCGMWGSSVFLCTKKSVPASNAIATKAGLIFRTPEEDTESFPLSESDVPLFCLPMGATIECWDPETKTPLPVFSTFVLTGSSAKKVTG
AAIQFTEPYSRELLSEKQLMHLGLLTPVERKMVSKSINTNKCICLLSHWPFFEAFRKFLMFIYKLSVSGPHPLPIEKHISHFMQNIPFPS
PQRPRILVQLSVHDALILSQPVSTPLPLSGANFSTLLMNLGPENCATLLLFVLLESKILLHSLRPAVLTGVAEAVVAMIFPFQWQCPTIP
LCPLSLAAVLSAPLPFIVGVDSRTFDLHDPPQDVVCIDLDTNMLTVSDEKKNMNWKQLPKKPCKNLLSTLKKLTPQLSSVHQKTQEGSAI
DMTPIEADFSWQKKMTQLEMEIQEAFLRFMASILKGTRTTLRPITEAPSNKATAADSLFDRQGFLKSRDRATAKFTTLLSKTQIFIRFIE
ECSFVSDKDTGLAFFDDCIEKLFPDKGTEKTDKVDFDSAEDTRLIELDDSQKSEHTVFIMPPEPPPDDGKDLSPKYSYKYFPRLDLKLFD
RPQELKLCFSRHPTGNSITKSPPLMAKRTKQEIKTAHKLAKRCTTNPPQWAKCLFSHCYSLWFICLPATVRVSHPKVRALQQATDVLIKM
RKTDVDPLDEVCTRVVMQLCGLWGHPVLAVRVLFEMKTARIKPNAITTGTTNKVVLESPWPSSTRSGIFLWTKVRNVVRGLAQFRQPLKK
TVQRSQVSSISGGQSDQGYGSKDELIKDDAEIHVPEEQAARELITKTKMQTEEVCDASAIVAKHSQPSPEPHSPTEPPAWGSSIVKVPSG
IFDVNSRKSSTGSISNVLFSTQDPVEDAVFGEATNLKKNGDRGEKRQKHFPERSCSFSSESRAGMLLKKSSLDSNSSEMAIMMGADAKIL
TAALTCPKTSLLHIARTHSFENVSCHLPDSRTCMSESTWNPEHRSSPVPEMLEESQELLEPVVDDVPKTTATVDTTESLLSDSNSNQSRD
LKTVSKDLRNKRSSLTGIAKVVQREDVETGLDPLSLLATECTGGKTPDSEDKLFSPVIARNLADEIESTMNLKSPLGSKSSSMELHREEN
RESGMTTAFIHALERRSSLPLDHGSPAQENPESEKSSPAVSRSKTFTGRFKQQTPSRTHKERSTSLSALVRSSPHGSLGSVVNSLSGLKL
DNILSGPKIDVLKSGMKQAATVASKMWVAVASAYSYSDDEEETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSG
DVGKLHTPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSITQNCAMEVLMSSCSQCRACGALVTDEEIMAGWTADDSNLNTACPFCKSNFL
PLLNIEFKDLRGSASFFLKPSTSGDSLQSGSIPLANESLEHKPVSSLAEPDLINFMDFPKHNQIITEETGSAVEPRSRLMDSDMDTERPN
VETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQTRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFATGRSD
VVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKELGIPYTETSVV
AQFGIKDVFDNAIRAALISRRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFAH
KIYLSTSSSKFTDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPAGLRASTSDGIL
RGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLR
MMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCM
RAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADWCLHHICTNYNN

>In-frame_DENND4C_ENST00000602925_chr9_19357152_+_RHOBTB2_ENST00000522948_chr8_22861938_+_2337aa
MIEDKGPRVTDYFVVAGLTDTSTLLDQEINRLDTKSTGPKAPITDIAIIIKSAGETVPEGYTCVEATPSALQANLNTGSLKSPELFLCTK
RGRDKPPLTDIGVLTEGKERLIPGCEVILATPTGRCANVNNSSTTSQRIFITTRRAPPVRPQNSLAVTDICVIVTSKGETPPHTFCKVDK
NLNCGMWGSSVFLCTKKSVPASNAIATKAGLIFRTPEEDTESFPLSESDVPLFCLPMGATIECWDPETKTPLPVFSTFVLTGSSAKKVTG
AAIQFTEPYSRELLSEKQLMHLGLLTPVERKMVSKSINTNKCICLLSHWPFFEAFRKFLMFIYKLSVSGPHPLPIEKHISHFMQNIPFPS
PQRPRILVQLSVHDALILSQPVSTPLPLSGANFSTLLMNLGPENCATLLLFVLLESKILLHSLRPAVLTGVAEAVVAMIFPFQWQCPTIP
LCPLSLAAVLSAPLPFIVGVDSRTFDLHDPPQDVVCIDLDTNMLTVSDEKKNMNWKQLPKKPCKNLLSTLKKLTPQLSSVHQKTQEGSAI
DMTPIEADFSWQKKMTQLEMEIQEAFLRFMASILKGTRTTLRPITEAPSNKATAADSLFDRQGFLKSRDRATAKFTTLLSKTQIFIRFIE
ECSFVSDKDTGLAFFDDCIEKLFPDKGTEKTDKVDFDSAEDTRLIELDDSQKSEHTVFIMPPEPPPDDGKDLSPKYSYKYFPRLDLKLFD
RPQELKLCFSRHPTGNSITKSPPLMAKRTKQEIKTAHKLAKRCTTNPPQWAKCLFSHCYSLWFICLPATVRVSHPKVRALQQATDVLIKM
RKTDVDPLDEVCTRVVMQLCGLWGHPVLAVRVLFEMKTARIKPNAITTGTTNKVVLESPWPSSTRSGIFLWTKVRNVVRGLAQFRQPLKK
TVQRSQVSSISGGQSDQGYGSKDELIKDDAEIHVPEEQAARELITKTKMQTEEVCDASAIVAKHSQPSPEPHSPTEPPAWGSSIVKVPSG
IFDVNSRKSSTGSISNVLFSTQDPVEDAVFGEATNLKKNGDRGEKRQKHFPERSCSFSSESRAGMLLKKSSLDSNSSEMAIMMGADAKIL
TAALTCPKTSLLHIARTHSFENVSCHLPDSRTCMSESTWNPEHRSSPVPEMLEESQELLEPVVDDVPKTTATVDTTESLLSDSNSNQSRD
LKTVSKDLRNKRSSLTGIAKVVQREDVETGLDPLSLLATECTGGKTPDSEDKLFSPVIARNLADEIESTMNLKSPLGSKSSSMELHREEN
RESGMTTAFIHALERRSSLPLDHGSPAQENPESEKSSPAVSRSKTFTGRFKQQTPSRTHKERSTSLSALVRSSPHGSLGSVVNSLSGLKL
DNILSGPKIDVLKSGMKQAATVASKMWVAVASAYSYSDDEEETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSG
DVGKLHTPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSITQNCAMEVLMSSCSQCRACGALVTDEEIMAGWTADDSNLNTACPFCKSNFL
PLLNIEFKDLRGSASFFLKPSTSGDSLQSGSIPLANESLEHKPVSSLAEPDLINFMDFPKHNQIITEETGSAVEPRSRLMDSDMDTERPN
VETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQTRVCQEVLERSRDVVDDVSVSLRLWDTFGDHHKDRRFATGRSD
VVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARRPLARPIKPNEILPPEKGREVAKELGIPYTETSVV
AQFGIKDVFDNAIRAALISRRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPDPPSSSEECPAHLLEDPLCADVILVLQERVRIFAH
KIYLSTSSSKFTDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPAGLRASTSDGIL
RGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVFDLR
MMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDVTFILDDGTISAHKPLLISSCDWMAAMFGGPFVESSTREVVFPYTSKSCM
RAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVDIDGDVLVFLELAQFHCAYQLADWCLHHICTNYNN

>In-frame_DENND4C_ENST00000380432_chr9_19357152_+_RHOBTB2_ENST00000519685_chr8_22861938_+_2101aa
MGATIECWDPETKTPLPVFSTFVLTGSSAKKVTGAAIQFTEPYSRELLSEKQLMHLGLLTPVERKMVSKSINTNKCICLLSHWPFFEAFR
KFLMFIYKLSVSGPHPLPIEKHISHFMQNIPFPSPQRPRILVQLSVHDALILSQPVSTPLPLSGANFSTLLMNLGPENCATLLLFVLLES
KILLHSLRPAVLTGVAEAVVAMIFPFQWQCPTIPLCPLSLAAVLSAPLPFIVGVDSRTFDLHDPPQDVVCIDLDTNMLTVSDEKKNMNWK
QLPKKPCKNLLSTLKKLTPQLSSVHQKTQEGSAIDMTPIEADFSWQKKMTQLEMEIQEAFLRFMASILKGTRTTLRPITEAPSNKATAAD
SLFDRQGFLKSRDRATAKFTTLLSKTQIFIRFIEECSFVSDKDTGLAFFDDCIEKLFPDKGTEKTDKVDFDSAEDTRLIELDDSQKSEHT
VFIMPPEPPPDDGKDLSPKYSYKYFPRLDLKLFDRPQELKLCFSRHPTGNSITKSPPLMAKRTKQEIKTAHKLAKRCTTNPPQWAKCLFS
HCYSLWFICLPATVRVSHPKVRALQQATDVLIKMRKTDVDPLDEVCTRVVMQLCGLWGHPVLAVRVLFEMKTARIKPNAITTGTTNKVVL
ESPWPSSTRSGIFLWTKVRNVVRGLAQFRQPLKKTVQRSQVSSISGGQSDQGYGSKDELIKDDAEIHVPEEQAARELITKTKMQTEEVCD
ASAIVAKHSQPSPEPHSPTEPPAWGSSIVKVPSGIFDVNSRKSSTGSISNVLFSTQDPVEDAVFGEATNLKKNGDRGEKRQKHFPERSCS
FSSESRAGMLLKKSSLDSNSSEMAIMMGADAKILTAALTCPKTSLLHIARTHSFENVSCHLPDSRTCMSESTWNPEHRSSPVPEMLEESQ
ELLEPVVDDVPKTTATVDTTESLLSDSNSNQSRDLKTVSKDLRNKRSSLTGIAKVVQREDVETGLDPLSLLATECTGGKTPDSEDKLFSP
VIARNLADEIESTMNLKSPLGSKSSSMELHREENRESGMTTAFIHALERRSSLPLDHGSPAQENPESEKSSPAVSRSKTFTGRFKQQTPS
RTHKERSTSLSALVRSSPHGSLGSVVNSLSGLKLDNILSGPKIDVLKSGMKQAATVASKMWVAVASAYSYSDDEEETNRDYSFPAGLEDH
ILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHTPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSITQNCAMEVLMSSCSQCR
ACGALVTDEEIMAGWTADDSNLNTACPFCKSNFLPLLNIEFKDLRGSASFFLKPSTSGDSLQSGSIPLANESLEHKPVSSLAEPDLINFM
DFPKHNQIITEETGSAVEPRSRLMDSDMDTERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQTRVCQEVLE
RSRDVVDDVSVSLRLWDTFGDHHKDRRFATGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARR
PLARPIKPNEILPPEKGREVAKELGIPYTETSVVAQFGIKDVFDNAIRAALISRRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPD
PPSSSEECPAHLLEDPLCADVILVLQERVRIFAHKIYLSTSSSKFTDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRD
FLLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSSIQPGPFR
AVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDVTFILDDGTISAHKPL
LISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVD
IDGDVLVFLELAQFHCAYQLADWCLHHICTNYNNVCRKFPRDMKAMSPENQETFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQP

>In-frame_DENND4C_ENST00000380432_chr9_19357152_+_RHOBTB2_ENST00000522948_chr8_22861938_+_2101aa
MGATIECWDPETKTPLPVFSTFVLTGSSAKKVTGAAIQFTEPYSRELLSEKQLMHLGLLTPVERKMVSKSINTNKCICLLSHWPFFEAFR
KFLMFIYKLSVSGPHPLPIEKHISHFMQNIPFPSPQRPRILVQLSVHDALILSQPVSTPLPLSGANFSTLLMNLGPENCATLLLFVLLES
KILLHSLRPAVLTGVAEAVVAMIFPFQWQCPTIPLCPLSLAAVLSAPLPFIVGVDSRTFDLHDPPQDVVCIDLDTNMLTVSDEKKNMNWK
QLPKKPCKNLLSTLKKLTPQLSSVHQKTQEGSAIDMTPIEADFSWQKKMTQLEMEIQEAFLRFMASILKGTRTTLRPITEAPSNKATAAD
SLFDRQGFLKSRDRATAKFTTLLSKTQIFIRFIEECSFVSDKDTGLAFFDDCIEKLFPDKGTEKTDKVDFDSAEDTRLIELDDSQKSEHT
VFIMPPEPPPDDGKDLSPKYSYKYFPRLDLKLFDRPQELKLCFSRHPTGNSITKSPPLMAKRTKQEIKTAHKLAKRCTTNPPQWAKCLFS
HCYSLWFICLPATVRVSHPKVRALQQATDVLIKMRKTDVDPLDEVCTRVVMQLCGLWGHPVLAVRVLFEMKTARIKPNAITTGTTNKVVL
ESPWPSSTRSGIFLWTKVRNVVRGLAQFRQPLKKTVQRSQVSSISGGQSDQGYGSKDELIKDDAEIHVPEEQAARELITKTKMQTEEVCD
ASAIVAKHSQPSPEPHSPTEPPAWGSSIVKVPSGIFDVNSRKSSTGSISNVLFSTQDPVEDAVFGEATNLKKNGDRGEKRQKHFPERSCS
FSSESRAGMLLKKSSLDSNSSEMAIMMGADAKILTAALTCPKTSLLHIARTHSFENVSCHLPDSRTCMSESTWNPEHRSSPVPEMLEESQ
ELLEPVVDDVPKTTATVDTTESLLSDSNSNQSRDLKTVSKDLRNKRSSLTGIAKVVQREDVETGLDPLSLLATECTGGKTPDSEDKLFSP
VIARNLADEIESTMNLKSPLGSKSSSMELHREENRESGMTTAFIHALERRSSLPLDHGSPAQENPESEKSSPAVSRSKTFTGRFKQQTPS
RTHKERSTSLSALVRSSPHGSLGSVVNSLSGLKLDNILSGPKIDVLKSGMKQAATVASKMWVAVASAYSYSDDEEETNRDYSFPAGLEDH
ILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHTPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSITQNCAMEVLMSSCSQCR
ACGALVTDEEIMAGWTADDSNLNTACPFCKSNFLPLLNIEFKDLRGSASFFLKPSTSGDSLQSGSIPLANESLEHKPVSSLAEPDLINFM
DFPKHNQIITEETGSAVEPRSRLMDSDMDTERPNVETIKCVVVGDNAVGKTRLICARACNATLTQYQLLATHVPTVWAIDQTRVCQEVLE
RSRDVVDDVSVSLRLWDTFGDHHKDRRFATGRSDVVVLCFSIANPNSLHHVKTMWYPEIKHFCPRAPVILVGCQLDLRYADLEAVNRARR
PLARPIKPNEILPPEKGREVAKELGIPYTETSVVAQFGIKDVFDNAIRAALISRRHLQFWKSHLRNVQRPLLQAPFLPPKPPPPIIVVPD
PPSSSEECPAHLLEDPLCADVILVLQERVRIFAHKIYLSTSSSKFTDLFLMDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRD
FLLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSSIQPGPFR
AVLKYLYTGELDENERDLMHIAHIAELLEVFDLRMMVANILNNEAFMNQEITKAFHVRRTNRVKECLAKGTFSDVTFILDDGTISAHKPL
LISSCDWMAAMFGGPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRLCLPHLVALTEQYTVTGLMEATQMMVD
IDGDVLVFLELAQFHCAYQLADWCLHHICTNYNNVCRKFPRDMKAMSPENQETFEKHRWPPVWYLKEEDHYQRARKEREKEDYLHLKRQP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DENND4C_ENST00000434457_chr9_19357152_+_RHOBTB2_ENST00000519685_chr8_22861938_+_7158nt
ATGATAGAAGACAAAGGACCAAGAGTGACAGACTACTTTGTCGTAGCTGGTCTCACTGACACATCTACTCTTTTGGATCAAGAAATAAAT
CGTTTAGATACTAAGTCAACTGGACCTAAAGCTCCAATTACAGACATTGCCATTATTATCAAATCAGCTGGAGAAACAGTACCTGAAGGT
TACACCTGTGTAGAAGCCACTCCATCAGCTCTCCAAGCAAACTTGAACTATGGAAGTCTGAAAAGCCCAGAACTTTTCCTCTGTTATAAG
AGAGGGAGAGATAAACCACCGCTTACAGATATTGGAGTTCTATATGAAGGGAAAGAACGGCTTATTCCAGGATGTGAAGTGATCCTAGCC
ACACCCTATGGTCGCTGTGCCAATGTCAACAATAGTTCAACTACTTCACAAAGAATCTTTATCACTTATCGAAGGGCTCCTCCAGTTCGA
CCCCAGAATTCCTTGGCTGTAACTGATATCTGTGTTATTGTAACCAGTAAAGGAGAAACTCCTCCTCATACCTTCTGCAAAGTTGACAAA
AACTTAAATTGTGGAATGTGGGGTTCCAGCGTGTTTCTGTGTTATAAGAAGTCTGTACCTGCTTCAAATGCAATAGCATATAAGGCTGGT
TTAATTTTTAGATATCCAGAAGAGGACTATGAGTCATTTCCACTCTCAGAATCAGATGTACCTCTTTTCTGCCTTCCTATGGGAGCTACT
ATTGAGTGCTGGGATCCTGAAACCAAATATCCACTTCCAGTTTTTTCAACTTTTGTCTTGACAGGTTCTTCAGCCAAAAAGGTATATGGA
GCTGCCATTCAGTTTTATGAACCTTACTCTCGGGAACTTCTATCAGAGAAACAGCTTATGCACCTGGGCTTGTTGACGCCTGTGGAGAGA
AAAATGGTCTCCAAATCCATCAATACAAACAAATGCATTTGTTTACTCTCACACTGGCCTTTTTTTGAAGCTTTTAGGAAATTTCTTATG
TTTATCTACAAACTTTCTGTGTCTGGACCACATCCTCTTCCCATTGAAAAGCACATTTCACATTTTATGCAAAACATCCCTTTTCCTTCA
CCACAAAGACCGAGAATCCTTGTCCAGCTGTCAGTCCATGATGCATTAATATTATCACAGCCAGTTTCTACACCTTTACCACTAAGTGGA
GCCAACTTTAGCACCTTGCTAATGAATCTGGGTCCTGAGAATTGTGCAACACTGCTGCTCTTTGTTTTACTTGAGAGTAAAATTCTGCTG
CATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAGCTGAAGCTGTTGTAGCTATGATCTTTCCATTTCAGTGGCAATGCCCATATATTCCC
CTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTGCACCTTTACCATTTATAGTTGGAGTTGACTCAAGGTATTTTGATCTTCATGACCCA
CCACAAGATGTTGTTTGCATTGACTTGGATACGAACATGTTATATGTATCAGATGAAAAGAAGAACATGAACTGGAAGCAACTTCCCAAA
AAGCCGTGCAAAAATCTACTTAGCACCTTAAAGAAATTGTATCCCCAGCTGTCTTCAGTTCACCAAAAAACTCAAGAAGGCTCAGCGATT
GACATGACTCCAATTGAAGCAGATTTCTCCTGGCAAAAGAAGATGACACAGCTTGAGATGGAAATTCAAGAGGCATTTTTGCGCTTTATG
GCGTCTATTTTAAAAGGATATAGAACATATCTCAGACCAATCACAGAGGCTCCTTCAAATAAAGCCACAGCTGCTGATTCATTGTTTGAC
CGACAGGGATTTTTAAAAAGTCGAGATCGTGCCTATGCAAAATTCTATACCCTTTTATCCAAAACACAGATTTTTATTCGTTTCATTGAA
GAATGCAGTTTTGTAAGTGATAAAGATACTGGATTAGCATTTTTTGATGACTGCATAGAAAAGTTGTTTCCTGATAAAGGCACAGAGAAA
ACAGATAAGGTTGATTTTGATTCAGCAGAAGATACCAGATTGATAGAACTAGATGATTCACAGAAAAGTGAGCATACTGTATTTATAATG
CCGCCAGAGCCACCTCCTGATGATGGAAAGGACCTGTCACCAAAGTACAGTTACAAATACTTTCCAAGACTGGACCTTAAGCTTTTTGAC
AGACCGCAGGAGTTGAAACTTTGTTTTAGTAGACACCCTACTGGGAATAGCATTACAAAGAGTCCACCTCTCATGGCTAAGAGAACTAAA
CAGGAAATAAAAACAGCTCATAAATTGGCGAAGAGATGTTATACAAATCCACCACAGTGGGCCAAGTGTCTGTTTAGTCATTGTTACAGT
TTATGGTTTATTTGTCTTCCGGCCTATGTTAGAGTTTCTCATCCTAAAGTCAGAGCACTTCAGCAGGCATATGATGTACTTATTAAGATG
AGGAAAACAGATGTGGATCCCTTAGATGAGGTGTGCTATCGAGTAGTGATGCAGCTTTGTGGACTTTGGGGTCATCCTGTTTTAGCAGTG
AGAGTCTTATTTGAAATGAAAACTGCTAGGATAAAGCCTAATGCTATTACTTATGGTTATTATAATAAGGTAGTCTTGGAGAGCCCGTGG
CCTAGCAGTACCCGCAGTGGTATTTTCTTATGGACGAAGGTACGGAATGTGGTACGTGGCTTGGCACAGTTTAGGCAGCCGCTTAAAAAG
ACTGTGCAAAGGTCACAGGTCTCCTCAATATCAGCTCTTCAAAATGTCACAGGTGGAAGTGATGGGGACACGGTGAGCCACGGTAGTGTG
GATAGTTCTAATGATGCTAACAATGGGGAGCACACAGTCTTCGTCAGAGATTTAATCAGGCTTGAGTCCATTGATAATCACTCTAGCACA
GGTGGTCAGTCTGACCAAGGATACGGGTCTAAGGATGAACTTATAAAGGATGATGCAGAAATTCATGTGCCTGAAGAACAGGCAGCAAGA
GAATTGATAACTAAAACAAAAATGCAAACAGAAGAGGTGTGTGATGCCTCTGCTATTGTGGCAAAACATTCACAACCTAGTCCAGAGCCT
CACAGTCCTACTGAACCTCCTGCATGGGGCAGCAGTATTGTGAAAGTTCCGTCTGGTATATTTGATGTCAACAGCAGGAAAAGTAGCACT
GGTAGTATATCAAATGTGCTGTTTTCTACTCAAGATCCAGTTGAAGATGCAGTCTTTGGCGAAGCTACTAATCTCAAGAAGAATGGTGAT
AGAGGAGAAAAAAGACAAAAGCATTTTCCTGAGAGGAGTTGTAGTTTTAGTTCTGAAAGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGT
TTGGATTCGAATTCAAGTGAAATGGCTATCATGATGGGAGCAGATGCCAAGATTCTCACAGCAGCATTGACATGTCCTAAGACTTCTCTA
CTTCATATTGCAAGAACCCATAGCTTTGAGAATGTTAGCTGTCACCTACCTGATAGTAGGACTTGTATGTCTGAAAGCACTTGGAATCCT
GAGCACAGATCATCTCCGGTGCCAGAGATGCTTGAGGAAAGCCAAGAACTCCTTGAGCCTGTGGTTGATGACGTACCTAAAACTACTGCA
ACAGTAGATACATATGAGAGTCTACTAAGTGATAGTAACAGTAATCAGTCCAGAGACTTGAAAACAGTATCCAAAGATCTGAGGAATAAG
AGAAGTAGTTTATATGGTATTGCTAAGGTGGTTCAGAGGGAAGATGTTGAAACTGGACTAGATCCTTTGTCTCTTTTAGCCACTGAATGT
ACAGGAGGAAAAACTCCTGATTCTGAAGATAAGTTGTTTTCTCCAGTTATTGCACGTAATCTGGCTGATGAAATAGAAAGCTATATGAAC
CTAAAAAGTCCCCTAGGTAGTAAATCTTCTAGTATGGAATTACACAGAGAGGAAAACAGAGAGTCTGGCATGACTACTGCATTTATTCAT
GCTCTAGAGAGGAGATCAAGCCTACCTTTAGATCATGGTTCACCAGCACAGGAAAATCCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCC
AGGTCTAAAACTTTTACTGGGCGTTTCAAGCAGCAAACCCCCTCTCGAACTCATAAAGAACGTTCAACTTCTTTGTCAGCACTGGTGCGT
TCTTCGCCACATGGCTCGTTGGGTTCTGTAGTAAATTCTTTGTCAGGGCTAAAGCTGGATAATATACTCTCAGGGCCCAAGATAGATGTC
CTGAAATCTGGTATGAAACAAGCAGCGACAGTAGCCAGTAAGATGTGGGTAGCTGTTGCGTCTGCCTACAGCTACTCAGATGATGAGGAA
GAAACTAATAGAGACTACAGCTTCCCAGCTGGCCTAGAAGACCATATTTTGGGGGAGAATATATCGCCTAACACAAGTATCTCAGGGTTG
GTCCCCAGTGAACTTACCCAGAGCAACACAAGTCTTGGCAGTAGCAGCAGTAGTGGAGATGTAGGAAAACTGCATTATCCAACAGGTGAA
GTTCCATTTCCAAGAGGCATGAAAGGGCAAGACTTTGAAAAATCAGATCATGGTTCTTCTCAAAATACCAGCATGTCTAGCATCTATCAG
AATTGTGCAATGGAGGTTTTGATGTCCAGTTGTTCACAGTGTAGAGCTTGTGGAGCTTTAGTTTATGATGAAGAAATTATGGCTGGATGG
ACAGCAGATGACTCAAATTTGAATACAGCTTGTCCATTCTGTAAAAGCAACTTCTTGCCTCTTCTCAATATAGAATTCAAAGATTTGAGA
GGTTCTGCAAGCTTTTTCCTGAAACCAAGTACCTCTGGTGACAGTTTACAAAGTGGAAGCATTCCATTGGCAAATGAATCCTTGGAGCAC
AAACCTGTATCCAGTTTAGCAGAACCTGACTTGATCAACTTTATGGACTTCCCAAAACATAACCAGATCATAACTGAAGAAACAGGCTCT
GCAGTTGAACCAAGGTCCCGTTTAATGGATTCTGACATGGATTATGAAAGGCCAAACGTAGAGACCATCAAGTGCGTTGTGGTGGGGGAC
AACGCCGTGGGTAAGACCAGGCTCATCTGTGCCCGCGCTTGCAATGCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTGCCCACA
GTATGGGCCATCGACCAATATCGTGTGTGCCAGGAGGTGCTGGAACGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTC
TGGGACACCTTTGGAGACCACCACAAAGACCGTCGCTTTGCTTATGGGAGATCTGATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCC
AATTCCCTCCACCATGTCAAGACCATGTGGTACCCAGAAATCAAGCACTTCTGCCCCCGAGCACCTGTCATCTTGGTGGGCTGCCAGTTG
GACCTGCGCTACGCTGACCTGGAGGCTGTCAACAGGGCTAGGCGACCCTTGGCTAGGCCCATCAAACCTAATGAAATCCTGCCCCCAGAG
AAGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCCCCTACTATGAGACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTTGACAAC
GCCATCCGAGCTGCACTCATCTCCCGCCGCCACCTGCAGTTCTGGAAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCC
TTCCTACCCCCCAAGCCACCGCCCCCGATCATCGTGGTGCCCGACCCTCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGAC
CCGCTCTGCGCGGACGTCATCCTGGTGCTGCAGGAGCGGGTGCGCATCTTTGCCCACAAGATCTACCTCTCCACCTCTTCCTCCAAGTTC
TATGACCTGTTCCTCATGGACCTGAGTGAGGGGGAGCTGGGGGGCCCCTCGGAGCCAGGGGGCACCCACCCAGAGGACCACCAGGGCCAC
TCTGATCAACACCACCACCATCACCACCACCACCATGGGCGAGACTTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGCGTGGAT
GAGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTGCTTCCACCAGCGACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGG
GGTCGTGTGCTGTCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAGGAAGAGATGGCAGAAGATCCTCTCACCTACAAATCCCGGCTGATG
GTGGTGGTGAAGATGGACAGTTCCATCCAGCCGGGGCCCTTCCGGGCTGTCCTCAAGTACCTGTACACGGGGGAGCTAGATGAGAACGAG
CGTGACCTCATGCACATTGCCCACATTGCTGAGCTGCTCGAGGTCTTTGATCTGCGCATGATGGTGGCCAACATTCTCAACAATGAGGCC
TTCATGAACCAGGAGATCACCAAGGCCTTCCACGTCCGCCGGACCAACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCAGATGTG
ACCTTCATCCTGGATGATGGCACCATCAGCGCCCACAAGCCCCTGTTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCA
TTTGTGGAGAGCTCCACCCGGGAGGTGGTGTTTCCCTACACAAGCAAGAGCTGCATGCGGGCCGTGCTGGAATACCTCTACACCGGCATG
TTCACCTCCAGCCCCGACCTGGATGACATGAAGCTCATCATTCTAGCCAACCGCCTCTGCCTGCCACACCTGGTTGCCCTCACAGAGCAG
TACACAGTGACCGGGCTGATGGAAGCGACCCAGATGATGGTGGACATCGATGGGGACGTCCTTGTGTTCCTGGAACTGGCTCAGTTCCAC
TGTGCGTACCAGCTGGCCGACTGGTGTCTCCACCACATCTGCACCAACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATGAAGGCC
ATGTCCCCAGAAAACCAGGAGTATTTCGAGAAGCATCGGTGGCCACCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGG
AAGGAGCGTGAGAAGGAGGACTACCTCCACCTCAAGCGGCAGCCCAAACGGCGTTGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCC

>In-frame_DENND4C_ENST00000434457_chr9_19357152_+_RHOBTB2_ENST00000522948_chr8_22861938_+_7158nt
ATGATAGAAGACAAAGGACCAAGAGTGACAGACTACTTTGTCGTAGCTGGTCTCACTGACACATCTACTCTTTTGGATCAAGAAATAAAT
CGTTTAGATACTAAGTCAACTGGACCTAAAGCTCCAATTACAGACATTGCCATTATTATCAAATCAGCTGGAGAAACAGTACCTGAAGGT
TACACCTGTGTAGAAGCCACTCCATCAGCTCTCCAAGCAAACTTGAACTATGGAAGTCTGAAAAGCCCAGAACTTTTCCTCTGTTATAAG
AGAGGGAGAGATAAACCACCGCTTACAGATATTGGAGTTCTATATGAAGGGAAAGAACGGCTTATTCCAGGATGTGAAGTGATCCTAGCC
ACACCCTATGGTCGCTGTGCCAATGTCAACAATAGTTCAACTACTTCACAAAGAATCTTTATCACTTATCGAAGGGCTCCTCCAGTTCGA
CCCCAGAATTCCTTGGCTGTAACTGATATCTGTGTTATTGTAACCAGTAAAGGAGAAACTCCTCCTCATACCTTCTGCAAAGTTGACAAA
AACTTAAATTGTGGAATGTGGGGTTCCAGCGTGTTTCTGTGTTATAAGAAGTCTGTACCTGCTTCAAATGCAATAGCATATAAGGCTGGT
TTAATTTTTAGATATCCAGAAGAGGACTATGAGTCATTTCCACTCTCAGAATCAGATGTACCTCTTTTCTGCCTTCCTATGGGAGCTACT
ATTGAGTGCTGGGATCCTGAAACCAAATATCCACTTCCAGTTTTTTCAACTTTTGTCTTGACAGGTTCTTCAGCCAAAAAGGTATATGGA
GCTGCCATTCAGTTTTATGAACCTTACTCTCGGGAACTTCTATCAGAGAAACAGCTTATGCACCTGGGCTTGTTGACGCCTGTGGAGAGA
AAAATGGTCTCCAAATCCATCAATACAAACAAATGCATTTGTTTACTCTCACACTGGCCTTTTTTTGAAGCTTTTAGGAAATTTCTTATG
TTTATCTACAAACTTTCTGTGTCTGGACCACATCCTCTTCCCATTGAAAAGCACATTTCACATTTTATGCAAAACATCCCTTTTCCTTCA
CCACAAAGACCGAGAATCCTTGTCCAGCTGTCAGTCCATGATGCATTAATATTATCACAGCCAGTTTCTACACCTTTACCACTAAGTGGA
GCCAACTTTAGCACCTTGCTAATGAATCTGGGTCCTGAGAATTGTGCAACACTGCTGCTCTTTGTTTTACTTGAGAGTAAAATTCTGCTG
CATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAGCTGAAGCTGTTGTAGCTATGATCTTTCCATTTCAGTGGCAATGCCCATATATTCCC
CTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTGCACCTTTACCATTTATAGTTGGAGTTGACTCAAGGTATTTTGATCTTCATGACCCA
CCACAAGATGTTGTTTGCATTGACTTGGATACGAACATGTTATATGTATCAGATGAAAAGAAGAACATGAACTGGAAGCAACTTCCCAAA
AAGCCGTGCAAAAATCTACTTAGCACCTTAAAGAAATTGTATCCCCAGCTGTCTTCAGTTCACCAAAAAACTCAAGAAGGCTCAGCGATT
GACATGACTCCAATTGAAGCAGATTTCTCCTGGCAAAAGAAGATGACACAGCTTGAGATGGAAATTCAAGAGGCATTTTTGCGCTTTATG
GCGTCTATTTTAAAAGGATATAGAACATATCTCAGACCAATCACAGAGGCTCCTTCAAATAAAGCCACAGCTGCTGATTCATTGTTTGAC
CGACAGGGATTTTTAAAAAGTCGAGATCGTGCCTATGCAAAATTCTATACCCTTTTATCCAAAACACAGATTTTTATTCGTTTCATTGAA
GAATGCAGTTTTGTAAGTGATAAAGATACTGGATTAGCATTTTTTGATGACTGCATAGAAAAGTTGTTTCCTGATAAAGGCACAGAGAAA
ACAGATAAGGTTGATTTTGATTCAGCAGAAGATACCAGATTGATAGAACTAGATGATTCACAGAAAAGTGAGCATACTGTATTTATAATG
CCGCCAGAGCCACCTCCTGATGATGGAAAGGACCTGTCACCAAAGTACAGTTACAAATACTTTCCAAGACTGGACCTTAAGCTTTTTGAC
AGACCGCAGGAGTTGAAACTTTGTTTTAGTAGACACCCTACTGGGAATAGCATTACAAAGAGTCCACCTCTCATGGCTAAGAGAACTAAA
CAGGAAATAAAAACAGCTCATAAATTGGCGAAGAGATGTTATACAAATCCACCACAGTGGGCCAAGTGTCTGTTTAGTCATTGTTACAGT
TTATGGTTTATTTGTCTTCCGGCCTATGTTAGAGTTTCTCATCCTAAAGTCAGAGCACTTCAGCAGGCATATGATGTACTTATTAAGATG
AGGAAAACAGATGTGGATCCCTTAGATGAGGTGTGCTATCGAGTAGTGATGCAGCTTTGTGGACTTTGGGGTCATCCTGTTTTAGCAGTG
AGAGTCTTATTTGAAATGAAAACTGCTAGGATAAAGCCTAATGCTATTACTTATGGTTATTATAATAAGGTAGTCTTGGAGAGCCCGTGG
CCTAGCAGTACCCGCAGTGGTATTTTCTTATGGACGAAGGTACGGAATGTGGTACGTGGCTTGGCACAGTTTAGGCAGCCGCTTAAAAAG
ACTGTGCAAAGGTCACAGGTCTCCTCAATATCAGCTCTTCAAAATGTCACAGGTGGAAGTGATGGGGACACGGTGAGCCACGGTAGTGTG
GATAGTTCTAATGATGCTAACAATGGGGAGCACACAGTCTTCGTCAGAGATTTAATCAGGCTTGAGTCCATTGATAATCACTCTAGCACA
GGTGGTCAGTCTGACCAAGGATACGGGTCTAAGGATGAACTTATAAAGGATGATGCAGAAATTCATGTGCCTGAAGAACAGGCAGCAAGA
GAATTGATAACTAAAACAAAAATGCAAACAGAAGAGGTGTGTGATGCCTCTGCTATTGTGGCAAAACATTCACAACCTAGTCCAGAGCCT
CACAGTCCTACTGAACCTCCTGCATGGGGCAGCAGTATTGTGAAAGTTCCGTCTGGTATATTTGATGTCAACAGCAGGAAAAGTAGCACT
GGTAGTATATCAAATGTGCTGTTTTCTACTCAAGATCCAGTTGAAGATGCAGTCTTTGGCGAAGCTACTAATCTCAAGAAGAATGGTGAT
AGAGGAGAAAAAAGACAAAAGCATTTTCCTGAGAGGAGTTGTAGTTTTAGTTCTGAAAGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGT
TTGGATTCGAATTCAAGTGAAATGGCTATCATGATGGGAGCAGATGCCAAGATTCTCACAGCAGCATTGACATGTCCTAAGACTTCTCTA
CTTCATATTGCAAGAACCCATAGCTTTGAGAATGTTAGCTGTCACCTACCTGATAGTAGGACTTGTATGTCTGAAAGCACTTGGAATCCT
GAGCACAGATCATCTCCGGTGCCAGAGATGCTTGAGGAAAGCCAAGAACTCCTTGAGCCTGTGGTTGATGACGTACCTAAAACTACTGCA
ACAGTAGATACATATGAGAGTCTACTAAGTGATAGTAACAGTAATCAGTCCAGAGACTTGAAAACAGTATCCAAAGATCTGAGGAATAAG
AGAAGTAGTTTATATGGTATTGCTAAGGTGGTTCAGAGGGAAGATGTTGAAACTGGACTAGATCCTTTGTCTCTTTTAGCCACTGAATGT
ACAGGAGGAAAAACTCCTGATTCTGAAGATAAGTTGTTTTCTCCAGTTATTGCACGTAATCTGGCTGATGAAATAGAAAGCTATATGAAC
CTAAAAAGTCCCCTAGGTAGTAAATCTTCTAGTATGGAATTACACAGAGAGGAAAACAGAGAGTCTGGCATGACTACTGCATTTATTCAT
GCTCTAGAGAGGAGATCAAGCCTACCTTTAGATCATGGTTCACCAGCACAGGAAAATCCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCC
AGGTCTAAAACTTTTACTGGGCGTTTCAAGCAGCAAACCCCCTCTCGAACTCATAAAGAACGTTCAACTTCTTTGTCAGCACTGGTGCGT
TCTTCGCCACATGGCTCGTTGGGTTCTGTAGTAAATTCTTTGTCAGGGCTAAAGCTGGATAATATACTCTCAGGGCCCAAGATAGATGTC
CTGAAATCTGGTATGAAACAAGCAGCGACAGTAGCCAGTAAGATGTGGGTAGCTGTTGCGTCTGCCTACAGCTACTCAGATGATGAGGAA
GAAACTAATAGAGACTACAGCTTCCCAGCTGGCCTAGAAGACCATATTTTGGGGGAGAATATATCGCCTAACACAAGTATCTCAGGGTTG
GTCCCCAGTGAACTTACCCAGAGCAACACAAGTCTTGGCAGTAGCAGCAGTAGTGGAGATGTAGGAAAACTGCATTATCCAACAGGTGAA
GTTCCATTTCCAAGAGGCATGAAAGGGCAAGACTTTGAAAAATCAGATCATGGTTCTTCTCAAAATACCAGCATGTCTAGCATCTATCAG
AATTGTGCAATGGAGGTTTTGATGTCCAGTTGTTCACAGTGTAGAGCTTGTGGAGCTTTAGTTTATGATGAAGAAATTATGGCTGGATGG
ACAGCAGATGACTCAAATTTGAATACAGCTTGTCCATTCTGTAAAAGCAACTTCTTGCCTCTTCTCAATATAGAATTCAAAGATTTGAGA
GGTTCTGCAAGCTTTTTCCTGAAACCAAGTACCTCTGGTGACAGTTTACAAAGTGGAAGCATTCCATTGGCAAATGAATCCTTGGAGCAC
AAACCTGTATCCAGTTTAGCAGAACCTGACTTGATCAACTTTATGGACTTCCCAAAACATAACCAGATCATAACTGAAGAAACAGGCTCT
GCAGTTGAACCAAGGTCCCGTTTAATGGATTCTGACATGGATTATGAAAGGCCAAACGTAGAGACCATCAAGTGCGTTGTGGTGGGGGAC
AACGCCGTGGGTAAGACCAGGCTCATCTGTGCCCGCGCTTGCAATGCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTGCCCACA
GTATGGGCCATCGACCAATATCGTGTGTGCCAGGAGGTGCTGGAACGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTC
TGGGACACCTTTGGAGACCACCACAAAGACCGTCGCTTTGCTTATGGGAGATCTGATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCC
AATTCCCTCCACCATGTCAAGACCATGTGGTACCCAGAAATCAAGCACTTCTGCCCCCGAGCACCTGTCATCTTGGTGGGCTGCCAGTTG
GACCTGCGCTACGCTGACCTGGAGGCTGTCAACAGGGCTAGGCGACCCTTGGCTAGGCCCATCAAACCTAATGAAATCCTGCCCCCAGAG
AAGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCCCCTACTATGAGACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTTGACAAC
GCCATCCGAGCTGCACTCATCTCCCGCCGCCACCTGCAGTTCTGGAAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCC
TTCCTACCCCCCAAGCCACCGCCCCCGATCATCGTGGTGCCCGACCCTCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGAC
CCGCTCTGCGCGGACGTCATCCTGGTGCTGCAGGAGCGGGTGCGCATCTTTGCCCACAAGATCTACCTCTCCACCTCTTCCTCCAAGTTC
TATGACCTGTTCCTCATGGACCTGAGTGAGGGGGAGCTGGGGGGCCCCTCGGAGCCAGGGGGCACCCACCCAGAGGACCACCAGGGCCAC
TCTGATCAACACCACCACCATCACCACCACCACCATGGGCGAGACTTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGCGTGGAT
GAGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTGCTTCCACCAGCGACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGG
GGTCGTGTGCTGTCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAGGAAGAGATGGCAGAAGATCCTCTCACCTACAAATCCCGGCTGATG
GTGGTGGTGAAGATGGACAGTTCCATCCAGCCGGGGCCCTTCCGGGCTGTCCTCAAGTACCTGTACACGGGGGAGCTAGATGAGAACGAG
CGTGACCTCATGCACATTGCCCACATTGCTGAGCTGCTCGAGGTCTTTGATCTGCGCATGATGGTGGCCAACATTCTCAACAATGAGGCC
TTCATGAACCAGGAGATCACCAAGGCCTTCCACGTCCGCCGGACCAACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCAGATGTG
ACCTTCATCCTGGATGATGGCACCATCAGCGCCCACAAGCCCCTGTTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCA
TTTGTGGAGAGCTCCACCCGGGAGGTGGTGTTTCCCTACACAAGCAAGAGCTGCATGCGGGCCGTGCTGGAATACCTCTACACCGGCATG
TTCACCTCCAGCCCCGACCTGGATGACATGAAGCTCATCATTCTAGCCAACCGCCTCTGCCTGCCACACCTGGTTGCCCTCACAGAGCAG
TACACAGTGACCGGGCTGATGGAAGCGACCCAGATGATGGTGGACATCGATGGGGACGTCCTTGTGTTCCTGGAACTGGCTCAGTTCCAC
TGTGCGTACCAGCTGGCCGACTGGTGTCTCCACCACATCTGCACCAACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATGAAGGCC
ATGTCCCCAGAAAACCAGGAGTATTTCGAGAAGCATCGGTGGCCACCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGG
AAGGAGCGTGAGAAGGAGGACTACCTCCACCTCAAGCGGCAGCCCAAACGGCGTTGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCC

>In-frame_DENND4C_ENST00000602925_chr9_19357152_+_RHOBTB2_ENST00000519685_chr8_22861938_+_7011nt
ATGATAGAAGACAAAGGACCAAGAGTGACAGACTACTTTGTCGTAGCTGGTCTCACTGACACATCTACTCTTTTGGATCAAGAAATAAAT
CGTTTAGATACTAAGTCAACTGGACCTAAAGCTCCAATTACAGACATTGCCATTATTATCAAATCAGCTGGAGAAACAGTACCTGAAGGT
TACACCTGTGTAGAAGCCACTCCATCAGCTCTCCAAGCAAACTTGAACTATGGAAGTCTGAAAAGCCCAGAACTTTTCCTCTGTTATAAG
AGAGGGAGAGATAAACCACCGCTTACAGATATTGGAGTTCTATATGAAGGGAAAGAACGGCTTATTCCAGGATGTGAAGTGATCCTAGCC
ACACCCTATGGTCGCTGTGCCAATGTCAACAATAGTTCAACTACTTCACAAAGAATCTTTATCACTTATCGAAGGGCTCCTCCAGTTCGA
CCCCAGAATTCCTTGGCTGTAACTGATATCTGTGTTATTGTAACCAGTAAAGGAGAAACTCCTCCTCATACCTTCTGCAAAGTTGACAAA
AACTTAAATTGTGGAATGTGGGGTTCCAGCGTGTTTCTGTGTTATAAGAAGTCTGTACCTGCTTCAAATGCAATAGCATATAAGGCTGGT
TTAATTTTTAGATATCCAGAAGAGGACTATGAGTCATTTCCACTCTCAGAATCAGATGTACCTCTTTTCTGCCTTCCTATGGGAGCTACT
ATTGAGTGCTGGGATCCTGAAACCAAATATCCACTTCCAGTTTTTTCAACTTTTGTCTTGACAGGTTCTTCAGCCAAAAAGGTATATGGA
GCTGCCATTCAGTTTTATGAACCTTACTCTCGGGAACTTCTATCAGAGAAACAGCTTATGCACCTGGGCTTGTTGACGCCTGTGGAGAGA
AAAATGGTCTCCAAATCCATCAATACAAACAAATGCATTTGTTTACTCTCACACTGGCCTTTTTTTGAAGCTTTTAGGAAATTTCTTATG
TTTATCTACAAACTTTCTGTGTCTGGACCACATCCTCTTCCCATTGAAAAGCACATTTCACATTTTATGCAAAACATCCCTTTTCCTTCA
CCACAAAGACCGAGAATCCTTGTCCAGCTGTCAGTCCATGATGCATTAATATTATCACAGCCAGTTTCTACACCTTTACCACTAAGTGGA
GCCAACTTTAGCACCTTGCTAATGAATCTGGGTCCTGAGAATTGTGCAACACTGCTGCTCTTTGTTTTACTTGAGAGTAAAATTCTGCTG
CATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAGCTGAAGCTGTTGTAGCTATGATCTTTCCATTTCAGTGGCAATGCCCATATATTCCC
CTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTGCACCTTTACCATTTATAGTTGGAGTTGACTCAAGGTATTTTGATCTTCATGACCCA
CCACAAGATGTTGTTTGCATTGACTTGGATACGAACATGTTATATGTATCAGATGAAAAGAAGAACATGAACTGGAAGCAACTTCCCAAA
AAGCCGTGCAAAAATCTACTTAGCACCTTAAAGAAATTGTATCCCCAGCTGTCTTCAGTTCACCAAAAAACTCAAGAAGGCTCAGCGATT
GACATGACTCCAATTGAAGCAGATTTCTCCTGGCAAAAGAAGATGACACAGCTTGAGATGGAAATTCAAGAGGCATTTTTGCGCTTTATG
GCGTCTATTTTAAAAGGATATAGAACATATCTCAGACCAATCACAGAGGCTCCTTCAAATAAAGCCACAGCTGCTGATTCATTGTTTGAC
CGACAGGGATTTTTAAAAAGTCGAGATCGTGCCTATGCAAAATTCTATACCCTTTTATCCAAAACACAGATTTTTATTCGTTTCATTGAA
GAATGCAGTTTTGTAAGTGATAAAGATACTGGATTAGCATTTTTTGATGACTGCATAGAAAAGTTGTTTCCTGATAAAGGCACAGAGAAA
ACAGATAAGGTTGATTTTGATTCAGCAGAAGATACCAGATTGATAGAACTAGATGATTCACAGAAAAGTGAGCATACTGTATTTATAATG
CCGCCAGAGCCACCTCCTGATGATGGAAAGGACCTGTCACCAAAGTACAGTTACAAATACTTTCCAAGACTGGACCTTAAGCTTTTTGAC
AGACCGCAGGAGTTGAAACTTTGTTTTAGTAGACACCCTACTGGGAATAGCATTACAAAGAGTCCACCTCTCATGGCTAAGAGAACTAAA
CAGGAAATAAAAACAGCTCATAAATTGGCGAAGAGATGTTATACAAATCCACCACAGTGGGCCAAGTGTCTGTTTAGTCATTGTTACAGT
TTATGGTTTATTTGTCTTCCGGCCTATGTTAGAGTTTCTCATCCTAAAGTCAGAGCACTTCAGCAGGCATATGATGTACTTATTAAGATG
AGGAAAACAGATGTGGATCCCTTAGATGAGGTGTGCTATCGAGTAGTGATGCAGCTTTGTGGACTTTGGGGTCATCCTGTTTTAGCAGTG
AGAGTCTTATTTGAAATGAAAACTGCTAGGATAAAGCCTAATGCTATTACTTATGGTTATTATAATAAGGTAGTCTTGGAGAGCCCGTGG
CCTAGCAGTACCCGCAGTGGTATTTTCTTATGGACGAAGGTACGGAATGTGGTACGTGGCTTGGCACAGTTTAGGCAGCCGCTTAAAAAG
ACTGTGCAAAGGTCACAGGTCTCCTCAATATCAGGTGGTCAGTCTGACCAAGGATACGGGTCTAAGGATGAACTTATAAAGGATGATGCA
GAAATTCATGTGCCTGAAGAACAGGCAGCAAGAGAATTGATAACTAAAACAAAAATGCAAACAGAAGAGGTGTGTGATGCCTCTGCTATT
GTGGCAAAACATTCACAACCTAGTCCAGAGCCTCACAGTCCTACTGAACCTCCTGCATGGGGCAGCAGTATTGTGAAAGTTCCGTCTGGT
ATATTTGATGTCAACAGCAGGAAAAGTAGCACTGGTAGTATATCAAATGTGCTGTTTTCTACTCAAGATCCAGTTGAAGATGCAGTCTTT
GGCGAAGCTACTAATCTCAAGAAGAATGGTGATAGAGGAGAAAAAAGACAAAAGCATTTTCCTGAGAGGAGTTGTAGTTTTAGTTCTGAA
AGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGTTTGGATTCGAATTCAAGTGAAATGGCTATCATGATGGGAGCAGATGCCAAGATTCTC
ACAGCAGCATTGACATGTCCTAAGACTTCTCTACTTCATATTGCAAGAACCCATAGCTTTGAGAATGTTAGCTGTCACCTACCTGATAGT
AGGACTTGTATGTCTGAAAGCACTTGGAATCCTGAGCACAGATCATCTCCGGTGCCAGAGATGCTTGAGGAAAGCCAAGAACTCCTTGAG
CCTGTGGTTGATGACGTACCTAAAACTACTGCAACAGTAGATACATATGAGAGTCTACTAAGTGATAGTAACAGTAATCAGTCCAGAGAC
TTGAAAACAGTATCCAAAGATCTGAGGAATAAGAGAAGTAGTTTATATGGTATTGCTAAGGTGGTTCAGAGGGAAGATGTTGAAACTGGA
CTAGATCCTTTGTCTCTTTTAGCCACTGAATGTACAGGAGGAAAAACTCCTGATTCTGAAGATAAGTTGTTTTCTCCAGTTATTGCACGT
AATCTGGCTGATGAAATAGAAAGCTATATGAACCTAAAAAGTCCCCTAGGTAGTAAATCTTCTAGTATGGAATTACACAGAGAGGAAAAC
AGAGAGTCTGGCATGACTACTGCATTTATTCATGCTCTAGAGAGGAGATCAAGCCTACCTTTAGATCATGGTTCACCAGCACAGGAAAAT
CCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCCAGGTCTAAAACTTTTACTGGGCGTTTCAAGCAGCAAACCCCCTCTCGAACTCATAAA
GAACGTTCAACTTCTTTGTCAGCACTGGTGCGTTCTTCGCCACATGGCTCGTTGGGTTCTGTAGTAAATTCTTTGTCAGGGCTAAAGCTG
GATAATATACTCTCAGGGCCCAAGATAGATGTCCTGAAATCTGGTATGAAACAAGCAGCGACAGTAGCCAGTAAGATGTGGGTAGCTGTT
GCGTCTGCCTACAGCTACTCAGATGATGAGGAAGAAACTAATAGAGACTACAGCTTCCCAGCTGGCCTAGAAGACCATATTTTGGGGGAG
AATATATCGCCTAACACAAGTATCTCAGGGTTGGTCCCCAGTGAACTTACCCAGAGCAACACAAGTCTTGGCAGTAGCAGCAGTAGTGGA
GATGTAGGAAAACTGCATTATCCAACAGGTGAAGTTCCATTTCCAAGAGGCATGAAAGGGCAAGACTTTGAAAAATCAGATCATGGTTCT
TCTCAAAATACCAGCATGTCTAGCATCTATCAGAATTGTGCAATGGAGGTTTTGATGTCCAGTTGTTCACAGTGTAGAGCTTGTGGAGCT
TTAGTTTATGATGAAGAAATTATGGCTGGATGGACAGCAGATGACTCAAATTTGAATACAGCTTGTCCATTCTGTAAAAGCAACTTCTTG
CCTCTTCTCAATATAGAATTCAAAGATTTGAGAGGTTCTGCAAGCTTTTTCCTGAAACCAAGTACCTCTGGTGACAGTTTACAAAGTGGA
AGCATTCCATTGGCAAATGAATCCTTGGAGCACAAACCTGTATCCAGTTTAGCAGAACCTGACTTGATCAACTTTATGGACTTCCCAAAA
CATAACCAGATCATAACTGAAGAAACAGGCTCTGCAGTTGAACCAAGGTCCCGTTTAATGGATTCTGACATGGATTATGAAAGGCCAAAC
GTAGAGACCATCAAGTGCGTTGTGGTGGGGGACAACGCCGTGGGTAAGACCAGGCTCATCTGTGCCCGCGCTTGCAATGCCACCCTCACC
CAGTACCAGCTGCTGGCCACGCATGTGCCCACAGTATGGGCCATCGACCAATATCGTGTGTGCCAGGAGGTGCTGGAACGCTCCCGAGAC
GTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCTGGGACACCTTTGGAGACCACCACAAAGACCGTCGCTTTGCTTATGGGAGATCTGAT
GTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCAATTCCCTCCACCATGTCAAGACCATGTGGTACCCAGAAATCAAGCACTTCTGCCCC
CGAGCACCTGTCATCTTGGTGGGCTGCCAGTTGGACCTGCGCTACGCTGACCTGGAGGCTGTCAACAGGGCTAGGCGACCCTTGGCTAGG
CCCATCAAACCTAATGAAATCCTGCCCCCAGAGAAGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCCCCTACTATGAGACCAGCGTGGTG
GCCCAGTTCGGCATCAAGGACGTCTTTGACAACGCCATCCGAGCTGCACTCATCTCCCGCCGCCACCTGCAGTTCTGGAAGTCCCACCTC
CGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCTTCCTACCCCCCAAGCCACCGCCCCCGATCATCGTGGTGCCCGACCCTCCCTCCAGC
AGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACCCGCTCTGCGCGGACGTCATCCTGGTGCTGCAGGAGCGGGTGCGCATCTTTGCCCAC
AAGATCTACCTCTCCACCTCTTCCTCCAAGTTCTATGACCTGTTCCTCATGGACCTGAGTGAGGGGGAGCTGGGGGGCCCCTCGGAGCCA
GGGGGCACCCACCCAGAGGACCACCAGGGCCACTCTGATCAACACCACCACCATCACCACCACCACCATGGGCGAGACTTCCTGCTCCGA
GCAGCCAGCTTTGACGTGTGCGAGAGCGTGGATGAGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTGCTTCCACCAGCGACGGGATCTTA
CGGGGCAACGGAACAGGGTACCTACCGGGCAGGGGTCGTGTGCTGTCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAGGAAGAGATGGCA
GAAGATCCTCTCACCTACAAATCCCGGCTGATGGTGGTGGTGAAGATGGACAGTTCCATCCAGCCGGGGCCCTTCCGGGCTGTCCTCAAG
TACCTGTACACGGGGGAGCTAGATGAGAACGAGCGTGACCTCATGCACATTGCCCACATTGCTGAGCTGCTCGAGGTCTTTGATCTGCGC
ATGATGGTGGCCAACATTCTCAACAATGAGGCCTTCATGAACCAGGAGATCACCAAGGCCTTCCACGTCCGCCGGACCAACCGGGTTAAG
GAGTGCTTGGCAAAAGGCACCTTCTCAGATGTGACCTTCATCCTGGATGATGGCACCATCAGCGCCCACAAGCCCCTGTTGATTTCCAGC
TGTGACTGGATGGCTGCCATGTTTGGGGGGCCATTTGTGGAGAGCTCCACCCGGGAGGTGGTGTTTCCCTACACAAGCAAGAGCTGCATG
CGGGCCGTGCTGGAATACCTCTACACCGGCATGTTCACCTCCAGCCCCGACCTGGATGACATGAAGCTCATCATTCTAGCCAACCGCCTC
TGCCTGCCACACCTGGTTGCCCTCACAGAGCAGTACACAGTGACCGGGCTGATGGAAGCGACCCAGATGATGGTGGACATCGATGGGGAC
GTCCTTGTGTTCCTGGAACTGGCTCAGTTCCACTGTGCGTACCAGCTGGCCGACTGGTGTCTCCACCACATCTGCACCAACTACAACAAC
GTGTGCCGCAAGTTCCCCCGAGACATGAAGGCCATGTCCCCAGAAAACCAGGAGTATTTCGAGAAGCATCGGTGGCCACCTGTGTGGTAC
CTGAAGGAGGAAGATCATTACCAGCGGGCACGGAAGGAGCGTGAGAAGGAGGACTACCTCCACCTCAAGCGGCAGCCCAAACGGCGTTGG

>In-frame_DENND4C_ENST00000602925_chr9_19357152_+_RHOBTB2_ENST00000522948_chr8_22861938_+_7011nt
ATGATAGAAGACAAAGGACCAAGAGTGACAGACTACTTTGTCGTAGCTGGTCTCACTGACACATCTACTCTTTTGGATCAAGAAATAAAT
CGTTTAGATACTAAGTCAACTGGACCTAAAGCTCCAATTACAGACATTGCCATTATTATCAAATCAGCTGGAGAAACAGTACCTGAAGGT
TACACCTGTGTAGAAGCCACTCCATCAGCTCTCCAAGCAAACTTGAACTATGGAAGTCTGAAAAGCCCAGAACTTTTCCTCTGTTATAAG
AGAGGGAGAGATAAACCACCGCTTACAGATATTGGAGTTCTATATGAAGGGAAAGAACGGCTTATTCCAGGATGTGAAGTGATCCTAGCC
ACACCCTATGGTCGCTGTGCCAATGTCAACAATAGTTCAACTACTTCACAAAGAATCTTTATCACTTATCGAAGGGCTCCTCCAGTTCGA
CCCCAGAATTCCTTGGCTGTAACTGATATCTGTGTTATTGTAACCAGTAAAGGAGAAACTCCTCCTCATACCTTCTGCAAAGTTGACAAA
AACTTAAATTGTGGAATGTGGGGTTCCAGCGTGTTTCTGTGTTATAAGAAGTCTGTACCTGCTTCAAATGCAATAGCATATAAGGCTGGT
TTAATTTTTAGATATCCAGAAGAGGACTATGAGTCATTTCCACTCTCAGAATCAGATGTACCTCTTTTCTGCCTTCCTATGGGAGCTACT
ATTGAGTGCTGGGATCCTGAAACCAAATATCCACTTCCAGTTTTTTCAACTTTTGTCTTGACAGGTTCTTCAGCCAAAAAGGTATATGGA
GCTGCCATTCAGTTTTATGAACCTTACTCTCGGGAACTTCTATCAGAGAAACAGCTTATGCACCTGGGCTTGTTGACGCCTGTGGAGAGA
AAAATGGTCTCCAAATCCATCAATACAAACAAATGCATTTGTTTACTCTCACACTGGCCTTTTTTTGAAGCTTTTAGGAAATTTCTTATG
TTTATCTACAAACTTTCTGTGTCTGGACCACATCCTCTTCCCATTGAAAAGCACATTTCACATTTTATGCAAAACATCCCTTTTCCTTCA
CCACAAAGACCGAGAATCCTTGTCCAGCTGTCAGTCCATGATGCATTAATATTATCACAGCCAGTTTCTACACCTTTACCACTAAGTGGA
GCCAACTTTAGCACCTTGCTAATGAATCTGGGTCCTGAGAATTGTGCAACACTGCTGCTCTTTGTTTTACTTGAGAGTAAAATTCTGCTG
CATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAGCTGAAGCTGTTGTAGCTATGATCTTTCCATTTCAGTGGCAATGCCCATATATTCCC
CTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTGCACCTTTACCATTTATAGTTGGAGTTGACTCAAGGTATTTTGATCTTCATGACCCA
CCACAAGATGTTGTTTGCATTGACTTGGATACGAACATGTTATATGTATCAGATGAAAAGAAGAACATGAACTGGAAGCAACTTCCCAAA
AAGCCGTGCAAAAATCTACTTAGCACCTTAAAGAAATTGTATCCCCAGCTGTCTTCAGTTCACCAAAAAACTCAAGAAGGCTCAGCGATT
GACATGACTCCAATTGAAGCAGATTTCTCCTGGCAAAAGAAGATGACACAGCTTGAGATGGAAATTCAAGAGGCATTTTTGCGCTTTATG
GCGTCTATTTTAAAAGGATATAGAACATATCTCAGACCAATCACAGAGGCTCCTTCAAATAAAGCCACAGCTGCTGATTCATTGTTTGAC
CGACAGGGATTTTTAAAAAGTCGAGATCGTGCCTATGCAAAATTCTATACCCTTTTATCCAAAACACAGATTTTTATTCGTTTCATTGAA
GAATGCAGTTTTGTAAGTGATAAAGATACTGGATTAGCATTTTTTGATGACTGCATAGAAAAGTTGTTTCCTGATAAAGGCACAGAGAAA
ACAGATAAGGTTGATTTTGATTCAGCAGAAGATACCAGATTGATAGAACTAGATGATTCACAGAAAAGTGAGCATACTGTATTTATAATG
CCGCCAGAGCCACCTCCTGATGATGGAAAGGACCTGTCACCAAAGTACAGTTACAAATACTTTCCAAGACTGGACCTTAAGCTTTTTGAC
AGACCGCAGGAGTTGAAACTTTGTTTTAGTAGACACCCTACTGGGAATAGCATTACAAAGAGTCCACCTCTCATGGCTAAGAGAACTAAA
CAGGAAATAAAAACAGCTCATAAATTGGCGAAGAGATGTTATACAAATCCACCACAGTGGGCCAAGTGTCTGTTTAGTCATTGTTACAGT
TTATGGTTTATTTGTCTTCCGGCCTATGTTAGAGTTTCTCATCCTAAAGTCAGAGCACTTCAGCAGGCATATGATGTACTTATTAAGATG
AGGAAAACAGATGTGGATCCCTTAGATGAGGTGTGCTATCGAGTAGTGATGCAGCTTTGTGGACTTTGGGGTCATCCTGTTTTAGCAGTG
AGAGTCTTATTTGAAATGAAAACTGCTAGGATAAAGCCTAATGCTATTACTTATGGTTATTATAATAAGGTAGTCTTGGAGAGCCCGTGG
CCTAGCAGTACCCGCAGTGGTATTTTCTTATGGACGAAGGTACGGAATGTGGTACGTGGCTTGGCACAGTTTAGGCAGCCGCTTAAAAAG
ACTGTGCAAAGGTCACAGGTCTCCTCAATATCAGGTGGTCAGTCTGACCAAGGATACGGGTCTAAGGATGAACTTATAAAGGATGATGCA
GAAATTCATGTGCCTGAAGAACAGGCAGCAAGAGAATTGATAACTAAAACAAAAATGCAAACAGAAGAGGTGTGTGATGCCTCTGCTATT
GTGGCAAAACATTCACAACCTAGTCCAGAGCCTCACAGTCCTACTGAACCTCCTGCATGGGGCAGCAGTATTGTGAAAGTTCCGTCTGGT
ATATTTGATGTCAACAGCAGGAAAAGTAGCACTGGTAGTATATCAAATGTGCTGTTTTCTACTCAAGATCCAGTTGAAGATGCAGTCTTT
GGCGAAGCTACTAATCTCAAGAAGAATGGTGATAGAGGAGAAAAAAGACAAAAGCATTTTCCTGAGAGGAGTTGTAGTTTTAGTTCTGAA
AGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGTTTGGATTCGAATTCAAGTGAAATGGCTATCATGATGGGAGCAGATGCCAAGATTCTC
ACAGCAGCATTGACATGTCCTAAGACTTCTCTACTTCATATTGCAAGAACCCATAGCTTTGAGAATGTTAGCTGTCACCTACCTGATAGT
AGGACTTGTATGTCTGAAAGCACTTGGAATCCTGAGCACAGATCATCTCCGGTGCCAGAGATGCTTGAGGAAAGCCAAGAACTCCTTGAG
CCTGTGGTTGATGACGTACCTAAAACTACTGCAACAGTAGATACATATGAGAGTCTACTAAGTGATAGTAACAGTAATCAGTCCAGAGAC
TTGAAAACAGTATCCAAAGATCTGAGGAATAAGAGAAGTAGTTTATATGGTATTGCTAAGGTGGTTCAGAGGGAAGATGTTGAAACTGGA
CTAGATCCTTTGTCTCTTTTAGCCACTGAATGTACAGGAGGAAAAACTCCTGATTCTGAAGATAAGTTGTTTTCTCCAGTTATTGCACGT
AATCTGGCTGATGAAATAGAAAGCTATATGAACCTAAAAAGTCCCCTAGGTAGTAAATCTTCTAGTATGGAATTACACAGAGAGGAAAAC
AGAGAGTCTGGCATGACTACTGCATTTATTCATGCTCTAGAGAGGAGATCAAGCCTACCTTTAGATCATGGTTCACCAGCACAGGAAAAT
CCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCCAGGTCTAAAACTTTTACTGGGCGTTTCAAGCAGCAAACCCCCTCTCGAACTCATAAA
GAACGTTCAACTTCTTTGTCAGCACTGGTGCGTTCTTCGCCACATGGCTCGTTGGGTTCTGTAGTAAATTCTTTGTCAGGGCTAAAGCTG
GATAATATACTCTCAGGGCCCAAGATAGATGTCCTGAAATCTGGTATGAAACAAGCAGCGACAGTAGCCAGTAAGATGTGGGTAGCTGTT
GCGTCTGCCTACAGCTACTCAGATGATGAGGAAGAAACTAATAGAGACTACAGCTTCCCAGCTGGCCTAGAAGACCATATTTTGGGGGAG
AATATATCGCCTAACACAAGTATCTCAGGGTTGGTCCCCAGTGAACTTACCCAGAGCAACACAAGTCTTGGCAGTAGCAGCAGTAGTGGA
GATGTAGGAAAACTGCATTATCCAACAGGTGAAGTTCCATTTCCAAGAGGCATGAAAGGGCAAGACTTTGAAAAATCAGATCATGGTTCT
TCTCAAAATACCAGCATGTCTAGCATCTATCAGAATTGTGCAATGGAGGTTTTGATGTCCAGTTGTTCACAGTGTAGAGCTTGTGGAGCT
TTAGTTTATGATGAAGAAATTATGGCTGGATGGACAGCAGATGACTCAAATTTGAATACAGCTTGTCCATTCTGTAAAAGCAACTTCTTG
CCTCTTCTCAATATAGAATTCAAAGATTTGAGAGGTTCTGCAAGCTTTTTCCTGAAACCAAGTACCTCTGGTGACAGTTTACAAAGTGGA
AGCATTCCATTGGCAAATGAATCCTTGGAGCACAAACCTGTATCCAGTTTAGCAGAACCTGACTTGATCAACTTTATGGACTTCCCAAAA
CATAACCAGATCATAACTGAAGAAACAGGCTCTGCAGTTGAACCAAGGTCCCGTTTAATGGATTCTGACATGGATTATGAAAGGCCAAAC
GTAGAGACCATCAAGTGCGTTGTGGTGGGGGACAACGCCGTGGGTAAGACCAGGCTCATCTGTGCCCGCGCTTGCAATGCCACCCTCACC
CAGTACCAGCTGCTGGCCACGCATGTGCCCACAGTATGGGCCATCGACCAATATCGTGTGTGCCAGGAGGTGCTGGAACGCTCCCGAGAC
GTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCTGGGACACCTTTGGAGACCACCACAAAGACCGTCGCTTTGCTTATGGGAGATCTGAT
GTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCAATTCCCTCCACCATGTCAAGACCATGTGGTACCCAGAAATCAAGCACTTCTGCCCC
CGAGCACCTGTCATCTTGGTGGGCTGCCAGTTGGACCTGCGCTACGCTGACCTGGAGGCTGTCAACAGGGCTAGGCGACCCTTGGCTAGG
CCCATCAAACCTAATGAAATCCTGCCCCCAGAGAAGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCCCCTACTATGAGACCAGCGTGGTG
GCCCAGTTCGGCATCAAGGACGTCTTTGACAACGCCATCCGAGCTGCACTCATCTCCCGCCGCCACCTGCAGTTCTGGAAGTCCCACCTC
CGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCTTCCTACCCCCCAAGCCACCGCCCCCGATCATCGTGGTGCCCGACCCTCCCTCCAGC
AGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACCCGCTCTGCGCGGACGTCATCCTGGTGCTGCAGGAGCGGGTGCGCATCTTTGCCCAC
AAGATCTACCTCTCCACCTCTTCCTCCAAGTTCTATGACCTGTTCCTCATGGACCTGAGTGAGGGGGAGCTGGGGGGCCCCTCGGAGCCA
GGGGGCACCCACCCAGAGGACCACCAGGGCCACTCTGATCAACACCACCACCATCACCACCACCACCATGGGCGAGACTTCCTGCTCCGA
GCAGCCAGCTTTGACGTGTGCGAGAGCGTGGATGAGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTGCTTCCACCAGCGACGGGATCTTA
CGGGGCAACGGAACAGGGTACCTACCGGGCAGGGGTCGTGTGCTGTCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAGGAAGAGATGGCA
GAAGATCCTCTCACCTACAAATCCCGGCTGATGGTGGTGGTGAAGATGGACAGTTCCATCCAGCCGGGGCCCTTCCGGGCTGTCCTCAAG
TACCTGTACACGGGGGAGCTAGATGAGAACGAGCGTGACCTCATGCACATTGCCCACATTGCTGAGCTGCTCGAGGTCTTTGATCTGCGC
ATGATGGTGGCCAACATTCTCAACAATGAGGCCTTCATGAACCAGGAGATCACCAAGGCCTTCCACGTCCGCCGGACCAACCGGGTTAAG
GAGTGCTTGGCAAAAGGCACCTTCTCAGATGTGACCTTCATCCTGGATGATGGCACCATCAGCGCCCACAAGCCCCTGTTGATTTCCAGC
TGTGACTGGATGGCTGCCATGTTTGGGGGGCCATTTGTGGAGAGCTCCACCCGGGAGGTGGTGTTTCCCTACACAAGCAAGAGCTGCATG
CGGGCCGTGCTGGAATACCTCTACACCGGCATGTTCACCTCCAGCCCCGACCTGGATGACATGAAGCTCATCATTCTAGCCAACCGCCTC
TGCCTGCCACACCTGGTTGCCCTCACAGAGCAGTACACAGTGACCGGGCTGATGGAAGCGACCCAGATGATGGTGGACATCGATGGGGAC
GTCCTTGTGTTCCTGGAACTGGCTCAGTTCCACTGTGCGTACCAGCTGGCCGACTGGTGTCTCCACCACATCTGCACCAACTACAACAAC
GTGTGCCGCAAGTTCCCCCGAGACATGAAGGCCATGTCCCCAGAAAACCAGGAGTATTTCGAGAAGCATCGGTGGCCACCTGTGTGGTAC
CTGAAGGAGGAAGATCATTACCAGCGGGCACGGAAGGAGCGTGAGAAGGAGGACTACCTCCACCTCAAGCGGCAGCCCAAACGGCGTTGG

>In-frame_DENND4C_ENST00000380432_chr9_19357152_+_RHOBTB2_ENST00000519685_chr8_22861938_+_6303nt
ATGGGAGCTACTATTGAGTGCTGGGATCCTGAAACCAAATATCCACTTCCAGTTTTTTCAACTTTTGTCTTGACAGGTTCTTCAGCCAAA
AAGGTATATGGAGCTGCCATTCAGTTTTATGAACCTTACTCTCGGGAACTTCTATCAGAGAAACAGCTTATGCACCTGGGCTTGTTGACG
CCTGTGGAGAGAAAAATGGTCTCCAAATCCATCAATACAAACAAATGCATTTGTTTACTCTCACACTGGCCTTTTTTTGAAGCTTTTAGG
AAATTTCTTATGTTTATCTACAAACTTTCTGTGTCTGGACCACATCCTCTTCCCATTGAAAAGCACATTTCACATTTTATGCAAAACATC
CCTTTTCCTTCACCACAAAGACCGAGAATCCTTGTCCAGCTGTCAGTCCATGATGCATTAATATTATCACAGCCAGTTTCTACACCTTTA
CCACTAAGTGGAGCCAACTTTAGCACCTTGCTAATGAATCTGGGTCCTGAGAATTGTGCAACACTGCTGCTCTTTGTTTTACTTGAGAGT
AAAATTCTGCTGCATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAGCTGAAGCTGTTGTAGCTATGATCTTTCCATTTCAGTGGCAATGC
CCATATATTCCCCTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTGCACCTTTACCATTTATAGTTGGAGTTGACTCAAGGTATTTTGAT
CTTCATGACCCACCACAAGATGTTGTTTGCATTGACTTGGATACGAACATGTTATATGTATCAGATGAAAAGAAGAACATGAACTGGAAG
CAACTTCCCAAAAAGCCGTGCAAAAATCTACTTAGCACCTTAAAGAAATTGTATCCCCAGCTGTCTTCAGTTCACCAAAAAACTCAAGAA
GGCTCAGCGATTGACATGACTCCAATTGAAGCAGATTTCTCCTGGCAAAAGAAGATGACACAGCTTGAGATGGAAATTCAAGAGGCATTT
TTGCGCTTTATGGCGTCTATTTTAAAAGGATATAGAACATATCTCAGACCAATCACAGAGGCTCCTTCAAATAAAGCCACAGCTGCTGAT
TCATTGTTTGACCGACAGGGATTTTTAAAAAGTCGAGATCGTGCCTATGCAAAATTCTATACCCTTTTATCCAAAACACAGATTTTTATT
CGTTTCATTGAAGAATGCAGTTTTGTAAGTGATAAAGATACTGGATTAGCATTTTTTGATGACTGCATAGAAAAGTTGTTTCCTGATAAA
GGCACAGAGAAAACAGATAAGGTTGATTTTGATTCAGCAGAAGATACCAGATTGATAGAACTAGATGATTCACAGAAAAGTGAGCATACT
GTATTTATAATGCCGCCAGAGCCACCTCCTGATGATGGAAAGGACCTGTCACCAAAGTACAGTTACAAATACTTTCCAAGACTGGACCTT
AAGCTTTTTGACAGACCGCAGGAGTTGAAACTTTGTTTTAGTAGACACCCTACTGGGAATAGCATTACAAAGAGTCCACCTCTCATGGCT
AAGAGAACTAAACAGGAAATAAAAACAGCTCATAAATTGGCGAAGAGATGTTATACAAATCCACCACAGTGGGCCAAGTGTCTGTTTAGT
CATTGTTACAGTTTATGGTTTATTTGTCTTCCGGCCTATGTTAGAGTTTCTCATCCTAAAGTCAGAGCACTTCAGCAGGCATATGATGTA
CTTATTAAGATGAGGAAAACAGATGTGGATCCCTTAGATGAGGTGTGCTATCGAGTAGTGATGCAGCTTTGTGGACTTTGGGGTCATCCT
GTTTTAGCAGTGAGAGTCTTATTTGAAATGAAAACTGCTAGGATAAAGCCTAATGCTATTACTTATGGTTATTATAATAAGGTAGTCTTG
GAGAGCCCGTGGCCTAGCAGTACCCGCAGTGGTATTTTCTTATGGACGAAGGTACGGAATGTGGTACGTGGCTTGGCACAGTTTAGGCAG
CCGCTTAAAAAGACTGTGCAAAGGTCACAGGTCTCCTCAATATCAGGTGGTCAGTCTGACCAAGGATACGGGTCTAAGGATGAACTTATA
AAGGATGATGCAGAAATTCATGTGCCTGAAGAACAGGCAGCAAGAGAATTGATAACTAAAACAAAAATGCAAACAGAAGAGGTGTGTGAT
GCCTCTGCTATTGTGGCAAAACATTCACAACCTAGTCCAGAGCCTCACAGTCCTACTGAACCTCCTGCATGGGGCAGCAGTATTGTGAAA
GTTCCGTCTGGTATATTTGATGTCAACAGCAGGAAAAGTAGCACTGGTAGTATATCAAATGTGCTGTTTTCTACTCAAGATCCAGTTGAA
GATGCAGTCTTTGGCGAAGCTACTAATCTCAAGAAGAATGGTGATAGAGGAGAAAAAAGACAAAAGCATTTTCCTGAGAGGAGTTGTAGT
TTTAGTTCTGAAAGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGTTTGGATTCGAATTCAAGTGAAATGGCTATCATGATGGGAGCAGAT
GCCAAGATTCTCACAGCAGCATTGACATGTCCTAAGACTTCTCTACTTCATATTGCAAGAACCCATAGCTTTGAGAATGTTAGCTGTCAC
CTACCTGATAGTAGGACTTGTATGTCTGAAAGCACTTGGAATCCTGAGCACAGATCATCTCCGGTGCCAGAGATGCTTGAGGAAAGCCAA
GAACTCCTTGAGCCTGTGGTTGATGACGTACCTAAAACTACTGCAACAGTAGATACATATGAGAGTCTACTAAGTGATAGTAACAGTAAT
CAGTCCAGAGACTTGAAAACAGTATCCAAAGATCTGAGGAATAAGAGAAGTAGTTTATATGGTATTGCTAAGGTGGTTCAGAGGGAAGAT
GTTGAAACTGGACTAGATCCTTTGTCTCTTTTAGCCACTGAATGTACAGGAGGAAAAACTCCTGATTCTGAAGATAAGTTGTTTTCTCCA
GTTATTGCACGTAATCTGGCTGATGAAATAGAAAGCTATATGAACCTAAAAAGTCCCCTAGGTAGTAAATCTTCTAGTATGGAATTACAC
AGAGAGGAAAACAGAGAGTCTGGCATGACTACTGCATTTATTCATGCTCTAGAGAGGAGATCAAGCCTACCTTTAGATCATGGTTCACCA
GCACAGGAAAATCCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCCAGGTCTAAAACTTTTACTGGGCGTTTCAAGCAGCAAACCCCCTCT
CGAACTCATAAAGAACGTTCAACTTCTTTGTCAGCACTGGTGCGTTCTTCGCCACATGGCTCGTTGGGTTCTGTAGTAAATTCTTTGTCA
GGGCTAAAGCTGGATAATATACTCTCAGGGCCCAAGATAGATGTCCTGAAATCTGGTATGAAACAAGCAGCGACAGTAGCCAGTAAGATG
TGGGTAGCTGTTGCGTCTGCCTACAGCTACTCAGATGATGAGGAAGAAACTAATAGAGACTACAGCTTCCCAGCTGGCCTAGAAGACCAT
ATTTTGGGGGAGAATATATCGCCTAACACAAGTATCTCAGGGTTGGTCCCCAGTGAACTTACCCAGAGCAACACAAGTCTTGGCAGTAGC
AGCAGTAGTGGAGATGTAGGAAAACTGCATTATCCAACAGGTGAAGTTCCATTTCCAAGAGGCATGAAAGGGCAAGACTTTGAAAAATCA
GATCATGGTTCTTCTCAAAATACCAGCATGTCTAGCATCTATCAGAATTGTGCAATGGAGGTTTTGATGTCCAGTTGTTCACAGTGTAGA
GCTTGTGGAGCTTTAGTTTATGATGAAGAAATTATGGCTGGATGGACAGCAGATGACTCAAATTTGAATACAGCTTGTCCATTCTGTAAA
AGCAACTTCTTGCCTCTTCTCAATATAGAATTCAAAGATTTGAGAGGTTCTGCAAGCTTTTTCCTGAAACCAAGTACCTCTGGTGACAGT
TTACAAAGTGGAAGCATTCCATTGGCAAATGAATCCTTGGAGCACAAACCTGTATCCAGTTTAGCAGAACCTGACTTGATCAACTTTATG
GACTTCCCAAAACATAACCAGATCATAACTGAAGAAACAGGCTCTGCAGTTGAACCAAGGTCCCGTTTAATGGATTCTGACATGGATTAT
GAAAGGCCAAACGTAGAGACCATCAAGTGCGTTGTGGTGGGGGACAACGCCGTGGGTAAGACCAGGCTCATCTGTGCCCGCGCTTGCAAT
GCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTGCCCACAGTATGGGCCATCGACCAATATCGTGTGTGCCAGGAGGTGCTGGAA
CGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCTGGGACACCTTTGGAGACCACCACAAAGACCGTCGCTTTGCTTAT
GGGAGATCTGATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCAATTCCCTCCACCATGTCAAGACCATGTGGTACCCAGAAATCAAG
CACTTCTGCCCCCGAGCACCTGTCATCTTGGTGGGCTGCCAGTTGGACCTGCGCTACGCTGACCTGGAGGCTGTCAACAGGGCTAGGCGA
CCCTTGGCTAGGCCCATCAAACCTAATGAAATCCTGCCCCCAGAGAAGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCCCCTACTATGAG
ACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTTGACAACGCCATCCGAGCTGCACTCATCTCCCGCCGCCACCTGCAGTTCTGG
AAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCTTCCTACCCCCCAAGCCACCGCCCCCGATCATCGTGGTGCCCGAC
CCTCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACCCGCTCTGCGCGGACGTCATCCTGGTGCTGCAGGAGCGGGTGCGC
ATCTTTGCCCACAAGATCTACCTCTCCACCTCTTCCTCCAAGTTCTATGACCTGTTCCTCATGGACCTGAGTGAGGGGGAGCTGGGGGGC
CCCTCGGAGCCAGGGGGCACCCACCCAGAGGACCACCAGGGCCACTCTGATCAACACCACCACCATCACCACCACCACCATGGGCGAGAC
TTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGCGTGGATGAGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTGCTTCCACCAGC
GACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGGGGTCGTGTGCTGTCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAG
GAAGAGATGGCAGAAGATCCTCTCACCTACAAATCCCGGCTGATGGTGGTGGTGAAGATGGACAGTTCCATCCAGCCGGGGCCCTTCCGG
GCTGTCCTCAAGTACCTGTACACGGGGGAGCTAGATGAGAACGAGCGTGACCTCATGCACATTGCCCACATTGCTGAGCTGCTCGAGGTC
TTTGATCTGCGCATGATGGTGGCCAACATTCTCAACAATGAGGCCTTCATGAACCAGGAGATCACCAAGGCCTTCCACGTCCGCCGGACC
AACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCAGATGTGACCTTCATCCTGGATGATGGCACCATCAGCGCCCACAAGCCCCTG
TTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCATTTGTGGAGAGCTCCACCCGGGAGGTGGTGTTTCCCTACACAAGC
AAGAGCTGCATGCGGGCCGTGCTGGAATACCTCTACACCGGCATGTTCACCTCCAGCCCCGACCTGGATGACATGAAGCTCATCATTCTA
GCCAACCGCCTCTGCCTGCCACACCTGGTTGCCCTCACAGAGCAGTACACAGTGACCGGGCTGATGGAAGCGACCCAGATGATGGTGGAC
ATCGATGGGGACGTCCTTGTGTTCCTGGAACTGGCTCAGTTCCACTGTGCGTACCAGCTGGCCGACTGGTGTCTCCACCACATCTGCACC
AACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATGAAGGCCATGTCCCCAGAAAACCAGGAGTATTTCGAGAAGCATCGGTGGCCA
CCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGGAAGGAGCGTGAGAAGGAGGACTACCTCCACCTCAAGCGGCAGCCC
AAACGGCGTTGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCCTCGGCAGCCTCCTCCTCATCCCCATCTTCCTCCTCGGCTGTGGTC

>In-frame_DENND4C_ENST00000380432_chr9_19357152_+_RHOBTB2_ENST00000522948_chr8_22861938_+_6303nt
ATGGGAGCTACTATTGAGTGCTGGGATCCTGAAACCAAATATCCACTTCCAGTTTTTTCAACTTTTGTCTTGACAGGTTCTTCAGCCAAA
AAGGTATATGGAGCTGCCATTCAGTTTTATGAACCTTACTCTCGGGAACTTCTATCAGAGAAACAGCTTATGCACCTGGGCTTGTTGACG
CCTGTGGAGAGAAAAATGGTCTCCAAATCCATCAATACAAACAAATGCATTTGTTTACTCTCACACTGGCCTTTTTTTGAAGCTTTTAGG
AAATTTCTTATGTTTATCTACAAACTTTCTGTGTCTGGACCACATCCTCTTCCCATTGAAAAGCACATTTCACATTTTATGCAAAACATC
CCTTTTCCTTCACCACAAAGACCGAGAATCCTTGTCCAGCTGTCAGTCCATGATGCATTAATATTATCACAGCCAGTTTCTACACCTTTA
CCACTAAGTGGAGCCAACTTTAGCACCTTGCTAATGAATCTGGGTCCTGAGAATTGTGCAACACTGCTGCTCTTTGTTTTACTTGAGAGT
AAAATTCTGCTGCATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAGCTGAAGCTGTTGTAGCTATGATCTTTCCATTTCAGTGGCAATGC
CCATATATTCCCCTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTGCACCTTTACCATTTATAGTTGGAGTTGACTCAAGGTATTTTGAT
CTTCATGACCCACCACAAGATGTTGTTTGCATTGACTTGGATACGAACATGTTATATGTATCAGATGAAAAGAAGAACATGAACTGGAAG
CAACTTCCCAAAAAGCCGTGCAAAAATCTACTTAGCACCTTAAAGAAATTGTATCCCCAGCTGTCTTCAGTTCACCAAAAAACTCAAGAA
GGCTCAGCGATTGACATGACTCCAATTGAAGCAGATTTCTCCTGGCAAAAGAAGATGACACAGCTTGAGATGGAAATTCAAGAGGCATTT
TTGCGCTTTATGGCGTCTATTTTAAAAGGATATAGAACATATCTCAGACCAATCACAGAGGCTCCTTCAAATAAAGCCACAGCTGCTGAT
TCATTGTTTGACCGACAGGGATTTTTAAAAAGTCGAGATCGTGCCTATGCAAAATTCTATACCCTTTTATCCAAAACACAGATTTTTATT
CGTTTCATTGAAGAATGCAGTTTTGTAAGTGATAAAGATACTGGATTAGCATTTTTTGATGACTGCATAGAAAAGTTGTTTCCTGATAAA
GGCACAGAGAAAACAGATAAGGTTGATTTTGATTCAGCAGAAGATACCAGATTGATAGAACTAGATGATTCACAGAAAAGTGAGCATACT
GTATTTATAATGCCGCCAGAGCCACCTCCTGATGATGGAAAGGACCTGTCACCAAAGTACAGTTACAAATACTTTCCAAGACTGGACCTT
AAGCTTTTTGACAGACCGCAGGAGTTGAAACTTTGTTTTAGTAGACACCCTACTGGGAATAGCATTACAAAGAGTCCACCTCTCATGGCT
AAGAGAACTAAACAGGAAATAAAAACAGCTCATAAATTGGCGAAGAGATGTTATACAAATCCACCACAGTGGGCCAAGTGTCTGTTTAGT
CATTGTTACAGTTTATGGTTTATTTGTCTTCCGGCCTATGTTAGAGTTTCTCATCCTAAAGTCAGAGCACTTCAGCAGGCATATGATGTA
CTTATTAAGATGAGGAAAACAGATGTGGATCCCTTAGATGAGGTGTGCTATCGAGTAGTGATGCAGCTTTGTGGACTTTGGGGTCATCCT
GTTTTAGCAGTGAGAGTCTTATTTGAAATGAAAACTGCTAGGATAAAGCCTAATGCTATTACTTATGGTTATTATAATAAGGTAGTCTTG
GAGAGCCCGTGGCCTAGCAGTACCCGCAGTGGTATTTTCTTATGGACGAAGGTACGGAATGTGGTACGTGGCTTGGCACAGTTTAGGCAG
CCGCTTAAAAAGACTGTGCAAAGGTCACAGGTCTCCTCAATATCAGGTGGTCAGTCTGACCAAGGATACGGGTCTAAGGATGAACTTATA
AAGGATGATGCAGAAATTCATGTGCCTGAAGAACAGGCAGCAAGAGAATTGATAACTAAAACAAAAATGCAAACAGAAGAGGTGTGTGAT
GCCTCTGCTATTGTGGCAAAACATTCACAACCTAGTCCAGAGCCTCACAGTCCTACTGAACCTCCTGCATGGGGCAGCAGTATTGTGAAA
GTTCCGTCTGGTATATTTGATGTCAACAGCAGGAAAAGTAGCACTGGTAGTATATCAAATGTGCTGTTTTCTACTCAAGATCCAGTTGAA
GATGCAGTCTTTGGCGAAGCTACTAATCTCAAGAAGAATGGTGATAGAGGAGAAAAAAGACAAAAGCATTTTCCTGAGAGGAGTTGTAGT
TTTAGTTCTGAAAGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGTTTGGATTCGAATTCAAGTGAAATGGCTATCATGATGGGAGCAGAT
GCCAAGATTCTCACAGCAGCATTGACATGTCCTAAGACTTCTCTACTTCATATTGCAAGAACCCATAGCTTTGAGAATGTTAGCTGTCAC
CTACCTGATAGTAGGACTTGTATGTCTGAAAGCACTTGGAATCCTGAGCACAGATCATCTCCGGTGCCAGAGATGCTTGAGGAAAGCCAA
GAACTCCTTGAGCCTGTGGTTGATGACGTACCTAAAACTACTGCAACAGTAGATACATATGAGAGTCTACTAAGTGATAGTAACAGTAAT
CAGTCCAGAGACTTGAAAACAGTATCCAAAGATCTGAGGAATAAGAGAAGTAGTTTATATGGTATTGCTAAGGTGGTTCAGAGGGAAGAT
GTTGAAACTGGACTAGATCCTTTGTCTCTTTTAGCCACTGAATGTACAGGAGGAAAAACTCCTGATTCTGAAGATAAGTTGTTTTCTCCA
GTTATTGCACGTAATCTGGCTGATGAAATAGAAAGCTATATGAACCTAAAAAGTCCCCTAGGTAGTAAATCTTCTAGTATGGAATTACAC
AGAGAGGAAAACAGAGAGTCTGGCATGACTACTGCATTTATTCATGCTCTAGAGAGGAGATCAAGCCTACCTTTAGATCATGGTTCACCA
GCACAGGAAAATCCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCCAGGTCTAAAACTTTTACTGGGCGTTTCAAGCAGCAAACCCCCTCT
CGAACTCATAAAGAACGTTCAACTTCTTTGTCAGCACTGGTGCGTTCTTCGCCACATGGCTCGTTGGGTTCTGTAGTAAATTCTTTGTCA
GGGCTAAAGCTGGATAATATACTCTCAGGGCCCAAGATAGATGTCCTGAAATCTGGTATGAAACAAGCAGCGACAGTAGCCAGTAAGATG
TGGGTAGCTGTTGCGTCTGCCTACAGCTACTCAGATGATGAGGAAGAAACTAATAGAGACTACAGCTTCCCAGCTGGCCTAGAAGACCAT
ATTTTGGGGGAGAATATATCGCCTAACACAAGTATCTCAGGGTTGGTCCCCAGTGAACTTACCCAGAGCAACACAAGTCTTGGCAGTAGC
AGCAGTAGTGGAGATGTAGGAAAACTGCATTATCCAACAGGTGAAGTTCCATTTCCAAGAGGCATGAAAGGGCAAGACTTTGAAAAATCA
GATCATGGTTCTTCTCAAAATACCAGCATGTCTAGCATCTATCAGAATTGTGCAATGGAGGTTTTGATGTCCAGTTGTTCACAGTGTAGA
GCTTGTGGAGCTTTAGTTTATGATGAAGAAATTATGGCTGGATGGACAGCAGATGACTCAAATTTGAATACAGCTTGTCCATTCTGTAAA
AGCAACTTCTTGCCTCTTCTCAATATAGAATTCAAAGATTTGAGAGGTTCTGCAAGCTTTTTCCTGAAACCAAGTACCTCTGGTGACAGT
TTACAAAGTGGAAGCATTCCATTGGCAAATGAATCCTTGGAGCACAAACCTGTATCCAGTTTAGCAGAACCTGACTTGATCAACTTTATG
GACTTCCCAAAACATAACCAGATCATAACTGAAGAAACAGGCTCTGCAGTTGAACCAAGGTCCCGTTTAATGGATTCTGACATGGATTAT
GAAAGGCCAAACGTAGAGACCATCAAGTGCGTTGTGGTGGGGGACAACGCCGTGGGTAAGACCAGGCTCATCTGTGCCCGCGCTTGCAAT
GCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTGCCCACAGTATGGGCCATCGACCAATATCGTGTGTGCCAGGAGGTGCTGGAA
CGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCTGGGACACCTTTGGAGACCACCACAAAGACCGTCGCTTTGCTTAT
GGGAGATCTGATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCAATTCCCTCCACCATGTCAAGACCATGTGGTACCCAGAAATCAAG
CACTTCTGCCCCCGAGCACCTGTCATCTTGGTGGGCTGCCAGTTGGACCTGCGCTACGCTGACCTGGAGGCTGTCAACAGGGCTAGGCGA
CCCTTGGCTAGGCCCATCAAACCTAATGAAATCCTGCCCCCAGAGAAGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCCCCTACTATGAG
ACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTTGACAACGCCATCCGAGCTGCACTCATCTCCCGCCGCCACCTGCAGTTCTGG
AAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCTTCCTACCCCCCAAGCCACCGCCCCCGATCATCGTGGTGCCCGAC
CCTCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACCCGCTCTGCGCGGACGTCATCCTGGTGCTGCAGGAGCGGGTGCGC
ATCTTTGCCCACAAGATCTACCTCTCCACCTCTTCCTCCAAGTTCTATGACCTGTTCCTCATGGACCTGAGTGAGGGGGAGCTGGGGGGC
CCCTCGGAGCCAGGGGGCACCCACCCAGAGGACCACCAGGGCCACTCTGATCAACACCACCACCATCACCACCACCACCATGGGCGAGAC
TTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGCGTGGATGAGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTGCTTCCACCAGC
GACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGGGGTCGTGTGCTGTCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAG
GAAGAGATGGCAGAAGATCCTCTCACCTACAAATCCCGGCTGATGGTGGTGGTGAAGATGGACAGTTCCATCCAGCCGGGGCCCTTCCGG
GCTGTCCTCAAGTACCTGTACACGGGGGAGCTAGATGAGAACGAGCGTGACCTCATGCACATTGCCCACATTGCTGAGCTGCTCGAGGTC
TTTGATCTGCGCATGATGGTGGCCAACATTCTCAACAATGAGGCCTTCATGAACCAGGAGATCACCAAGGCCTTCCACGTCCGCCGGACC
AACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCAGATGTGACCTTCATCCTGGATGATGGCACCATCAGCGCCCACAAGCCCCTG
TTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCATTTGTGGAGAGCTCCACCCGGGAGGTGGTGTTTCCCTACACAAGC
AAGAGCTGCATGCGGGCCGTGCTGGAATACCTCTACACCGGCATGTTCACCTCCAGCCCCGACCTGGATGACATGAAGCTCATCATTCTA
GCCAACCGCCTCTGCCTGCCACACCTGGTTGCCCTCACAGAGCAGTACACAGTGACCGGGCTGATGGAAGCGACCCAGATGATGGTGGAC
ATCGATGGGGACGTCCTTGTGTTCCTGGAACTGGCTCAGTTCCACTGTGCGTACCAGCTGGCCGACTGGTGTCTCCACCACATCTGCACC
AACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATGAAGGCCATGTCCCCAGAAAACCAGGAGTATTTCGAGAAGCATCGGTGGCCA
CCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGGAAGGAGCGTGAGAAGGAGGACTACCTCCACCTCAAGCGGCAGCCC
AAACGGCGTTGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCCTCGGCAGCCTCCTCCTCATCCCCATCTTCCTCCTCGGCTGTGGTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_DENND4C_ENST00000434457_chr9_19357152_+_RHOBTB2_ENST00000519685_chr8_22861938_+_8546nt
GGAGGAAAGGGAGAGGGAGGGGGAAAAGAAAGTGCTGTTTTGTGGAAAGGGGCGGAAGGCGGGGGAGAAAAAGGGAACAGAAACATGGCG
GTCAGGTCTTGGGACGGCTGCGCCGCGGGCAGCTCCTAGGCGACGCGCCGCCCGCACTGTCCGACGGCTCACAGCGCGGAGGCACCCGCG
CGGGCCAGCGCTCCGGCCATCGCCCCTGGCTGTAGGCGGCGCCCCTCGGAGACCCTGCCCGCGAGGCGGCGCAGGCGCAGACCGGACTGA
GGCGGCGGCGGCCGCTGGAGCTAGTCCCCCGCCCTGCCCTGCCGAGCGCGCCCAGTCCGCGAATCCGGTGCTTTCTTGCCCCAGGAAGAA
GCCGTGTCGGGGCTGCGCTGACAGAGGAGCAGGCAGCAGAAAATACAGTAGCAGCCATGATAGAAGACAAAGGACCAAGAGTGACAGACT
ACTTTGTCGTAGCTGGTCTCACTGACACATCTACTCTTTTGGATCAAGAAATAAATCGTTTAGATACTAAGTCAACTGGACCTAAAGCTC
CAATTACAGACATTGCCATTATTATCAAATCAGCTGGAGAAACAGTACCTGAAGGTTACACCTGTGTAGAAGCCACTCCATCAGCTCTCC
AAGCAAACTTGAACTATGGAAGTCTGAAAAGCCCAGAACTTTTCCTCTGTTATAAGAGAGGGAGAGATAAACCACCGCTTACAGATATTG
GAGTTCTATATGAAGGGAAAGAACGGCTTATTCCAGGATGTGAAGTGATCCTAGCCACACCCTATGGTCGCTGTGCCAATGTCAACAATA
GTTCAACTACTTCACAAAGAATCTTTATCACTTATCGAAGGGCTCCTCCAGTTCGACCCCAGAATTCCTTGGCTGTAACTGATATCTGTG
TTATTGTAACCAGTAAAGGAGAAACTCCTCCTCATACCTTCTGCAAAGTTGACAAAAACTTAAATTGTGGAATGTGGGGTTCCAGCGTGT
TTCTGTGTTATAAGAAGTCTGTACCTGCTTCAAATGCAATAGCATATAAGGCTGGTTTAATTTTTAGATATCCAGAAGAGGACTATGAGT
CATTTCCACTCTCAGAATCAGATGTACCTCTTTTCTGCCTTCCTATGGGAGCTACTATTGAGTGCTGGGATCCTGAAACCAAATATCCAC
TTCCAGTTTTTTCAACTTTTGTCTTGACAGGTTCTTCAGCCAAAAAGGTATATGGAGCTGCCATTCAGTTTTATGAACCTTACTCTCGGG
AACTTCTATCAGAGAAACAGCTTATGCACCTGGGCTTGTTGACGCCTGTGGAGAGAAAAATGGTCTCCAAATCCATCAATACAAACAAAT
GCATTTGTTTACTCTCACACTGGCCTTTTTTTGAAGCTTTTAGGAAATTTCTTATGTTTATCTACAAACTTTCTGTGTCTGGACCACATC
CTCTTCCCATTGAAAAGCACATTTCACATTTTATGCAAAACATCCCTTTTCCTTCACCACAAAGACCGAGAATCCTTGTCCAGCTGTCAG
TCCATGATGCATTAATATTATCACAGCCAGTTTCTACACCTTTACCACTAAGTGGAGCCAACTTTAGCACCTTGCTAATGAATCTGGGTC
CTGAGAATTGTGCAACACTGCTGCTCTTTGTTTTACTTGAGAGTAAAATTCTGCTGCATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAG
CTGAAGCTGTTGTAGCTATGATCTTTCCATTTCAGTGGCAATGCCCATATATTCCCCTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTG
CACCTTTACCATTTATAGTTGGAGTTGACTCAAGGTATTTTGATCTTCATGACCCACCACAAGATGTTGTTTGCATTGACTTGGATACGA
ACATGTTATATGTATCAGATGAAAAGAAGAACATGAACTGGAAGCAACTTCCCAAAAAGCCGTGCAAAAATCTACTTAGCACCTTAAAGA
AATTGTATCCCCAGCTGTCTTCAGTTCACCAAAAAACTCAAGAAGGCTCAGCGATTGACATGACTCCAATTGAAGCAGATTTCTCCTGGC
AAAAGAAGATGACACAGCTTGAGATGGAAATTCAAGAGGCATTTTTGCGCTTTATGGCGTCTATTTTAAAAGGATATAGAACATATCTCA
GACCAATCACAGAGGCTCCTTCAAATAAAGCCACAGCTGCTGATTCATTGTTTGACCGACAGGGATTTTTAAAAAGTCGAGATCGTGCCT
ATGCAAAATTCTATACCCTTTTATCCAAAACACAGATTTTTATTCGTTTCATTGAAGAATGCAGTTTTGTAAGTGATAAAGATACTGGAT
TAGCATTTTTTGATGACTGCATAGAAAAGTTGTTTCCTGATAAAGGCACAGAGAAAACAGATAAGGTTGATTTTGATTCAGCAGAAGATA
CCAGATTGATAGAACTAGATGATTCACAGAAAAGTGAGCATACTGTATTTATAATGCCGCCAGAGCCACCTCCTGATGATGGAAAGGACC
TGTCACCAAAGTACAGTTACAAATACTTTCCAAGACTGGACCTTAAGCTTTTTGACAGACCGCAGGAGTTGAAACTTTGTTTTAGTAGAC
ACCCTACTGGGAATAGCATTACAAAGAGTCCACCTCTCATGGCTAAGAGAACTAAACAGGAAATAAAAACAGCTCATAAATTGGCGAAGA
GATGTTATACAAATCCACCACAGTGGGCCAAGTGTCTGTTTAGTCATTGTTACAGTTTATGGTTTATTTGTCTTCCGGCCTATGTTAGAG
TTTCTCATCCTAAAGTCAGAGCACTTCAGCAGGCATATGATGTACTTATTAAGATGAGGAAAACAGATGTGGATCCCTTAGATGAGGTGT
GCTATCGAGTAGTGATGCAGCTTTGTGGACTTTGGGGTCATCCTGTTTTAGCAGTGAGAGTCTTATTTGAAATGAAAACTGCTAGGATAA
AGCCTAATGCTATTACTTATGGTTATTATAATAAGGTAGTCTTGGAGAGCCCGTGGCCTAGCAGTACCCGCAGTGGTATTTTCTTATGGA
CGAAGGTACGGAATGTGGTACGTGGCTTGGCACAGTTTAGGCAGCCGCTTAAAAAGACTGTGCAAAGGTCACAGGTCTCCTCAATATCAG
CTCTTCAAAATGTCACAGGTGGAAGTGATGGGGACACGGTGAGCCACGGTAGTGTGGATAGTTCTAATGATGCTAACAATGGGGAGCACA
CAGTCTTCGTCAGAGATTTAATCAGGCTTGAGTCCATTGATAATCACTCTAGCACAGGTGGTCAGTCTGACCAAGGATACGGGTCTAAGG
ATGAACTTATAAAGGATGATGCAGAAATTCATGTGCCTGAAGAACAGGCAGCAAGAGAATTGATAACTAAAACAAAAATGCAAACAGAAG
AGGTGTGTGATGCCTCTGCTATTGTGGCAAAACATTCACAACCTAGTCCAGAGCCTCACAGTCCTACTGAACCTCCTGCATGGGGCAGCA
GTATTGTGAAAGTTCCGTCTGGTATATTTGATGTCAACAGCAGGAAAAGTAGCACTGGTAGTATATCAAATGTGCTGTTTTCTACTCAAG
ATCCAGTTGAAGATGCAGTCTTTGGCGAAGCTACTAATCTCAAGAAGAATGGTGATAGAGGAGAAAAAAGACAAAAGCATTTTCCTGAGA
GGAGTTGTAGTTTTAGTTCTGAAAGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGTTTGGATTCGAATTCAAGTGAAATGGCTATCATGA
TGGGAGCAGATGCCAAGATTCTCACAGCAGCATTGACATGTCCTAAGACTTCTCTACTTCATATTGCAAGAACCCATAGCTTTGAGAATG
TTAGCTGTCACCTACCTGATAGTAGGACTTGTATGTCTGAAAGCACTTGGAATCCTGAGCACAGATCATCTCCGGTGCCAGAGATGCTTG
AGGAAAGCCAAGAACTCCTTGAGCCTGTGGTTGATGACGTACCTAAAACTACTGCAACAGTAGATACATATGAGAGTCTACTAAGTGATA
GTAACAGTAATCAGTCCAGAGACTTGAAAACAGTATCCAAAGATCTGAGGAATAAGAGAAGTAGTTTATATGGTATTGCTAAGGTGGTTC
AGAGGGAAGATGTTGAAACTGGACTAGATCCTTTGTCTCTTTTAGCCACTGAATGTACAGGAGGAAAAACTCCTGATTCTGAAGATAAGT
TGTTTTCTCCAGTTATTGCACGTAATCTGGCTGATGAAATAGAAAGCTATATGAACCTAAAAAGTCCCCTAGGTAGTAAATCTTCTAGTA
TGGAATTACACAGAGAGGAAAACAGAGAGTCTGGCATGACTACTGCATTTATTCATGCTCTAGAGAGGAGATCAAGCCTACCTTTAGATC
ATGGTTCACCAGCACAGGAAAATCCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCCAGGTCTAAAACTTTTACTGGGCGTTTCAAGCAGC
AAACCCCCTCTCGAACTCATAAAGAACGTTCAACTTCTTTGTCAGCACTGGTGCGTTCTTCGCCACATGGCTCGTTGGGTTCTGTAGTAA
ATTCTTTGTCAGGGCTAAAGCTGGATAATATACTCTCAGGGCCCAAGATAGATGTCCTGAAATCTGGTATGAAACAAGCAGCGACAGTAG
CCAGTAAGATGTGGGTAGCTGTTGCGTCTGCCTACAGCTACTCAGATGATGAGGAAGAAACTAATAGAGACTACAGCTTCCCAGCTGGCC
TAGAAGACCATATTTTGGGGGAGAATATATCGCCTAACACAAGTATCTCAGGGTTGGTCCCCAGTGAACTTACCCAGAGCAACACAAGTC
TTGGCAGTAGCAGCAGTAGTGGAGATGTAGGAAAACTGCATTATCCAACAGGTGAAGTTCCATTTCCAAGAGGCATGAAAGGGCAAGACT
TTGAAAAATCAGATCATGGTTCTTCTCAAAATACCAGCATGTCTAGCATCTATCAGAATTGTGCAATGGAGGTTTTGATGTCCAGTTGTT
CACAGTGTAGAGCTTGTGGAGCTTTAGTTTATGATGAAGAAATTATGGCTGGATGGACAGCAGATGACTCAAATTTGAATACAGCTTGTC
CATTCTGTAAAAGCAACTTCTTGCCTCTTCTCAATATAGAATTCAAAGATTTGAGAGGTTCTGCAAGCTTTTTCCTGAAACCAAGTACCT
CTGGTGACAGTTTACAAAGTGGAAGCATTCCATTGGCAAATGAATCCTTGGAGCACAAACCTGTATCCAGTTTAGCAGAACCTGACTTGA
TCAACTTTATGGACTTCCCAAAACATAACCAGATCATAACTGAAGAAACAGGCTCTGCAGTTGAACCAAGGTCCCGTTTAATGGATTCTG
ACATGGATTATGAAAGGCCAAACGTAGAGACCATCAAGTGCGTTGTGGTGGGGGACAACGCCGTGGGTAAGACCAGGCTCATCTGTGCCC
GCGCTTGCAATGCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTGCCCACAGTATGGGCCATCGACCAATATCGTGTGTGCCAGG
AGGTGCTGGAACGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCTGGGACACCTTTGGAGACCACCACAAAGACCGTC
GCTTTGCTTATGGGAGATCTGATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCAATTCCCTCCACCATGTCAAGACCATGTGGTACC
CAGAAATCAAGCACTTCTGCCCCCGAGCACCTGTCATCTTGGTGGGCTGCCAGTTGGACCTGCGCTACGCTGACCTGGAGGCTGTCAACA
GGGCTAGGCGACCCTTGGCTAGGCCCATCAAACCTAATGAAATCCTGCCCCCAGAGAAGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCC
CCTACTATGAGACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTTGACAACGCCATCCGAGCTGCACTCATCTCCCGCCGCCACC
TGCAGTTCTGGAAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCTTCCTACCCCCCAAGCCACCGCCCCCGATCATCG
TGGTGCCCGACCCTCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACCCGCTCTGCGCGGACGTCATCCTGGTGCTGCAGG
AGCGGGTGCGCATCTTTGCCCACAAGATCTACCTCTCCACCTCTTCCTCCAAGTTCTATGACCTGTTCCTCATGGACCTGAGTGAGGGGG
AGCTGGGGGGCCCCTCGGAGCCAGGGGGCACCCACCCAGAGGACCACCAGGGCCACTCTGATCAACACCACCACCATCACCACCACCACC
ATGGGCGAGACTTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGCGTGGATGAGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTG
CTTCCACCAGCGACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGGGGTCGTGTGCTGTCTTCCTGGAGCCGAGCTTTTG
TGAGCATCCAGGAAGAGATGGCAGAAGATCCTCTCACCTACAAATCCCGGCTGATGGTGGTGGTGAAGATGGACAGTTCCATCCAGCCGG
GGCCCTTCCGGGCTGTCCTCAAGTACCTGTACACGGGGGAGCTAGATGAGAACGAGCGTGACCTCATGCACATTGCCCACATTGCTGAGC
TGCTCGAGGTCTTTGATCTGCGCATGATGGTGGCCAACATTCTCAACAATGAGGCCTTCATGAACCAGGAGATCACCAAGGCCTTCCACG
TCCGCCGGACCAACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCAGATGTGACCTTCATCCTGGATGATGGCACCATCAGCGCCC
ACAAGCCCCTGTTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCATTTGTGGAGAGCTCCACCCGGGAGGTGGTGTTTC
CCTACACAAGCAAGAGCTGCATGCGGGCCGTGCTGGAATACCTCTACACCGGCATGTTCACCTCCAGCCCCGACCTGGATGACATGAAGC
TCATCATTCTAGCCAACCGCCTCTGCCTGCCACACCTGGTTGCCCTCACAGAGCAGTACACAGTGACCGGGCTGATGGAAGCGACCCAGA
TGATGGTGGACATCGATGGGGACGTCCTTGTGTTCCTGGAACTGGCTCAGTTCCACTGTGCGTACCAGCTGGCCGACTGGTGTCTCCACC
ACATCTGCACCAACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATGAAGGCCATGTCCCCAGAAAACCAGGAGTATTTCGAGAAGC
ATCGGTGGCCACCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGGAAGGAGCGTGAGAAGGAGGACTACCTCCACCTCA
AGCGGCAGCCCAAACGGCGTTGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCCTCGGCAGCCTCCTCCTCATCCCCATCTTCCTCCT
CGGCTGTGGTCTGAGATGCTGCCACCCTCTTCTGACCCTGCTGCTGTTGTCCCCATCCGCCTTCACCCCTCTGCTCTTCCGCATCACCCC
ATCCACCTTACAGGGACCAGGGGGCCCACGTAACCAGGACCCAGAGGGTGGAGCTCTTCTTACCAGCCACCGTGGCTCAGCCAGAGAGGA
GCTGAGCCCTGTGGAGCAGAACGGGAACCACCTGCAGAGGTCCCCAGACCCAAAGCAGGACGGGAGACAACTGCTTGGAGGAGCGAAGAG
CCCTGGCATTTTATCTCTGGGTTTGAGAGCCCTAGAGTCAAAGGGAAAGCCTCCCAGCCTCCAGGGCTTCTCTGTGTGTCTTGGTTGCTG
CTCTGGCCAGGGAGGCAGCCCCACTCCCAGCAAGCAGAAGTGATCCTCGAGGGTCCTGCCCCTGTTGGCCATATCTTTCCACCGACGGAC
TTGAGTGTTGCATTTGTTTTGTGGGCATTTCCACACGAAGCCTACTCACACCCTCACTGGAGAAGTCAGGGTAGAAATTGAGCCTTCAGA
GCCCAACTCAAGGCTTCTACATCCTGGGGTGCAGCTGCAAAAGGCCAGACGTGGAAAGGCCTGTATCCTGCCAGTGTCCCTCCGTCCCAG
GGGGCTGTGCTAGCACAGACCTGAGAATGGGGACACAGGTCATTCAGAGCTCCAGGCCTGGAAGCAGTGCCTCTTGGTGCAACAAGAAAC
TTCTCCCTCACCCCCTCCTTTACCCTCAGATTTGGAGATGGTAACCAAAGGAAGCAGCTGGGACAGGTGGAGAAGGAAGTAGGAATGAGT
GCACGGCGACCCCGTGCTCCTCAGGGCCCTCCCCTGCCTCTGGGTGGCACTGCTTTTTATAGGGTGGGGCAAAATTAGCAAAAAACAAAA

>In-frame_DENND4C_ENST00000434457_chr9_19357152_+_RHOBTB2_ENST00000522948_chr8_22861938_+_10297nt
GGAGGAAAGGGAGAGGGAGGGGGAAAAGAAAGTGCTGTTTTGTGGAAAGGGGCGGAAGGCGGGGGAGAAAAAGGGAACAGAAACATGGCG
GTCAGGTCTTGGGACGGCTGCGCCGCGGGCAGCTCCTAGGCGACGCGCCGCCCGCACTGTCCGACGGCTCACAGCGCGGAGGCACCCGCG
CGGGCCAGCGCTCCGGCCATCGCCCCTGGCTGTAGGCGGCGCCCCTCGGAGACCCTGCCCGCGAGGCGGCGCAGGCGCAGACCGGACTGA
GGCGGCGGCGGCCGCTGGAGCTAGTCCCCCGCCCTGCCCTGCCGAGCGCGCCCAGTCCGCGAATCCGGTGCTTTCTTGCCCCAGGAAGAA
GCCGTGTCGGGGCTGCGCTGACAGAGGAGCAGGCAGCAGAAAATACAGTAGCAGCCATGATAGAAGACAAAGGACCAAGAGTGACAGACT
ACTTTGTCGTAGCTGGTCTCACTGACACATCTACTCTTTTGGATCAAGAAATAAATCGTTTAGATACTAAGTCAACTGGACCTAAAGCTC
CAATTACAGACATTGCCATTATTATCAAATCAGCTGGAGAAACAGTACCTGAAGGTTACACCTGTGTAGAAGCCACTCCATCAGCTCTCC
AAGCAAACTTGAACTATGGAAGTCTGAAAAGCCCAGAACTTTTCCTCTGTTATAAGAGAGGGAGAGATAAACCACCGCTTACAGATATTG
GAGTTCTATATGAAGGGAAAGAACGGCTTATTCCAGGATGTGAAGTGATCCTAGCCACACCCTATGGTCGCTGTGCCAATGTCAACAATA
GTTCAACTACTTCACAAAGAATCTTTATCACTTATCGAAGGGCTCCTCCAGTTCGACCCCAGAATTCCTTGGCTGTAACTGATATCTGTG
TTATTGTAACCAGTAAAGGAGAAACTCCTCCTCATACCTTCTGCAAAGTTGACAAAAACTTAAATTGTGGAATGTGGGGTTCCAGCGTGT
TTCTGTGTTATAAGAAGTCTGTACCTGCTTCAAATGCAATAGCATATAAGGCTGGTTTAATTTTTAGATATCCAGAAGAGGACTATGAGT
CATTTCCACTCTCAGAATCAGATGTACCTCTTTTCTGCCTTCCTATGGGAGCTACTATTGAGTGCTGGGATCCTGAAACCAAATATCCAC
TTCCAGTTTTTTCAACTTTTGTCTTGACAGGTTCTTCAGCCAAAAAGGTATATGGAGCTGCCATTCAGTTTTATGAACCTTACTCTCGGG
AACTTCTATCAGAGAAACAGCTTATGCACCTGGGCTTGTTGACGCCTGTGGAGAGAAAAATGGTCTCCAAATCCATCAATACAAACAAAT
GCATTTGTTTACTCTCACACTGGCCTTTTTTTGAAGCTTTTAGGAAATTTCTTATGTTTATCTACAAACTTTCTGTGTCTGGACCACATC
CTCTTCCCATTGAAAAGCACATTTCACATTTTATGCAAAACATCCCTTTTCCTTCACCACAAAGACCGAGAATCCTTGTCCAGCTGTCAG
TCCATGATGCATTAATATTATCACAGCCAGTTTCTACACCTTTACCACTAAGTGGAGCCAACTTTAGCACCTTGCTAATGAATCTGGGTC
CTGAGAATTGTGCAACACTGCTGCTCTTTGTTTTACTTGAGAGTAAAATTCTGCTGCATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAG
CTGAAGCTGTTGTAGCTATGATCTTTCCATTTCAGTGGCAATGCCCATATATTCCCCTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTG
CACCTTTACCATTTATAGTTGGAGTTGACTCAAGGTATTTTGATCTTCATGACCCACCACAAGATGTTGTTTGCATTGACTTGGATACGA
ACATGTTATATGTATCAGATGAAAAGAAGAACATGAACTGGAAGCAACTTCCCAAAAAGCCGTGCAAAAATCTACTTAGCACCTTAAAGA
AATTGTATCCCCAGCTGTCTTCAGTTCACCAAAAAACTCAAGAAGGCTCAGCGATTGACATGACTCCAATTGAAGCAGATTTCTCCTGGC
AAAAGAAGATGACACAGCTTGAGATGGAAATTCAAGAGGCATTTTTGCGCTTTATGGCGTCTATTTTAAAAGGATATAGAACATATCTCA
GACCAATCACAGAGGCTCCTTCAAATAAAGCCACAGCTGCTGATTCATTGTTTGACCGACAGGGATTTTTAAAAAGTCGAGATCGTGCCT
ATGCAAAATTCTATACCCTTTTATCCAAAACACAGATTTTTATTCGTTTCATTGAAGAATGCAGTTTTGTAAGTGATAAAGATACTGGAT
TAGCATTTTTTGATGACTGCATAGAAAAGTTGTTTCCTGATAAAGGCACAGAGAAAACAGATAAGGTTGATTTTGATTCAGCAGAAGATA
CCAGATTGATAGAACTAGATGATTCACAGAAAAGTGAGCATACTGTATTTATAATGCCGCCAGAGCCACCTCCTGATGATGGAAAGGACC
TGTCACCAAAGTACAGTTACAAATACTTTCCAAGACTGGACCTTAAGCTTTTTGACAGACCGCAGGAGTTGAAACTTTGTTTTAGTAGAC
ACCCTACTGGGAATAGCATTACAAAGAGTCCACCTCTCATGGCTAAGAGAACTAAACAGGAAATAAAAACAGCTCATAAATTGGCGAAGA
GATGTTATACAAATCCACCACAGTGGGCCAAGTGTCTGTTTAGTCATTGTTACAGTTTATGGTTTATTTGTCTTCCGGCCTATGTTAGAG
TTTCTCATCCTAAAGTCAGAGCACTTCAGCAGGCATATGATGTACTTATTAAGATGAGGAAAACAGATGTGGATCCCTTAGATGAGGTGT
GCTATCGAGTAGTGATGCAGCTTTGTGGACTTTGGGGTCATCCTGTTTTAGCAGTGAGAGTCTTATTTGAAATGAAAACTGCTAGGATAA
AGCCTAATGCTATTACTTATGGTTATTATAATAAGGTAGTCTTGGAGAGCCCGTGGCCTAGCAGTACCCGCAGTGGTATTTTCTTATGGA
CGAAGGTACGGAATGTGGTACGTGGCTTGGCACAGTTTAGGCAGCCGCTTAAAAAGACTGTGCAAAGGTCACAGGTCTCCTCAATATCAG
CTCTTCAAAATGTCACAGGTGGAAGTGATGGGGACACGGTGAGCCACGGTAGTGTGGATAGTTCTAATGATGCTAACAATGGGGAGCACA
CAGTCTTCGTCAGAGATTTAATCAGGCTTGAGTCCATTGATAATCACTCTAGCACAGGTGGTCAGTCTGACCAAGGATACGGGTCTAAGG
ATGAACTTATAAAGGATGATGCAGAAATTCATGTGCCTGAAGAACAGGCAGCAAGAGAATTGATAACTAAAACAAAAATGCAAACAGAAG
AGGTGTGTGATGCCTCTGCTATTGTGGCAAAACATTCACAACCTAGTCCAGAGCCTCACAGTCCTACTGAACCTCCTGCATGGGGCAGCA
GTATTGTGAAAGTTCCGTCTGGTATATTTGATGTCAACAGCAGGAAAAGTAGCACTGGTAGTATATCAAATGTGCTGTTTTCTACTCAAG
ATCCAGTTGAAGATGCAGTCTTTGGCGAAGCTACTAATCTCAAGAAGAATGGTGATAGAGGAGAAAAAAGACAAAAGCATTTTCCTGAGA
GGAGTTGTAGTTTTAGTTCTGAAAGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGTTTGGATTCGAATTCAAGTGAAATGGCTATCATGA
TGGGAGCAGATGCCAAGATTCTCACAGCAGCATTGACATGTCCTAAGACTTCTCTACTTCATATTGCAAGAACCCATAGCTTTGAGAATG
TTAGCTGTCACCTACCTGATAGTAGGACTTGTATGTCTGAAAGCACTTGGAATCCTGAGCACAGATCATCTCCGGTGCCAGAGATGCTTG
AGGAAAGCCAAGAACTCCTTGAGCCTGTGGTTGATGACGTACCTAAAACTACTGCAACAGTAGATACATATGAGAGTCTACTAAGTGATA
GTAACAGTAATCAGTCCAGAGACTTGAAAACAGTATCCAAAGATCTGAGGAATAAGAGAAGTAGTTTATATGGTATTGCTAAGGTGGTTC
AGAGGGAAGATGTTGAAACTGGACTAGATCCTTTGTCTCTTTTAGCCACTGAATGTACAGGAGGAAAAACTCCTGATTCTGAAGATAAGT
TGTTTTCTCCAGTTATTGCACGTAATCTGGCTGATGAAATAGAAAGCTATATGAACCTAAAAAGTCCCCTAGGTAGTAAATCTTCTAGTA
TGGAATTACACAGAGAGGAAAACAGAGAGTCTGGCATGACTACTGCATTTATTCATGCTCTAGAGAGGAGATCAAGCCTACCTTTAGATC
ATGGTTCACCAGCACAGGAAAATCCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCCAGGTCTAAAACTTTTACTGGGCGTTTCAAGCAGC
AAACCCCCTCTCGAACTCATAAAGAACGTTCAACTTCTTTGTCAGCACTGGTGCGTTCTTCGCCACATGGCTCGTTGGGTTCTGTAGTAA
ATTCTTTGTCAGGGCTAAAGCTGGATAATATACTCTCAGGGCCCAAGATAGATGTCCTGAAATCTGGTATGAAACAAGCAGCGACAGTAG
CCAGTAAGATGTGGGTAGCTGTTGCGTCTGCCTACAGCTACTCAGATGATGAGGAAGAAACTAATAGAGACTACAGCTTCCCAGCTGGCC
TAGAAGACCATATTTTGGGGGAGAATATATCGCCTAACACAAGTATCTCAGGGTTGGTCCCCAGTGAACTTACCCAGAGCAACACAAGTC
TTGGCAGTAGCAGCAGTAGTGGAGATGTAGGAAAACTGCATTATCCAACAGGTGAAGTTCCATTTCCAAGAGGCATGAAAGGGCAAGACT
TTGAAAAATCAGATCATGGTTCTTCTCAAAATACCAGCATGTCTAGCATCTATCAGAATTGTGCAATGGAGGTTTTGATGTCCAGTTGTT
CACAGTGTAGAGCTTGTGGAGCTTTAGTTTATGATGAAGAAATTATGGCTGGATGGACAGCAGATGACTCAAATTTGAATACAGCTTGTC
CATTCTGTAAAAGCAACTTCTTGCCTCTTCTCAATATAGAATTCAAAGATTTGAGAGGTTCTGCAAGCTTTTTCCTGAAACCAAGTACCT
CTGGTGACAGTTTACAAAGTGGAAGCATTCCATTGGCAAATGAATCCTTGGAGCACAAACCTGTATCCAGTTTAGCAGAACCTGACTTGA
TCAACTTTATGGACTTCCCAAAACATAACCAGATCATAACTGAAGAAACAGGCTCTGCAGTTGAACCAAGGTCCCGTTTAATGGATTCTG
ACATGGATTATGAAAGGCCAAACGTAGAGACCATCAAGTGCGTTGTGGTGGGGGACAACGCCGTGGGTAAGACCAGGCTCATCTGTGCCC
GCGCTTGCAATGCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTGCCCACAGTATGGGCCATCGACCAATATCGTGTGTGCCAGG
AGGTGCTGGAACGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCTGGGACACCTTTGGAGACCACCACAAAGACCGTC
GCTTTGCTTATGGGAGATCTGATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCAATTCCCTCCACCATGTCAAGACCATGTGGTACC
CAGAAATCAAGCACTTCTGCCCCCGAGCACCTGTCATCTTGGTGGGCTGCCAGTTGGACCTGCGCTACGCTGACCTGGAGGCTGTCAACA
GGGCTAGGCGACCCTTGGCTAGGCCCATCAAACCTAATGAAATCCTGCCCCCAGAGAAGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCC
CCTACTATGAGACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTTGACAACGCCATCCGAGCTGCACTCATCTCCCGCCGCCACC
TGCAGTTCTGGAAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCTTCCTACCCCCCAAGCCACCGCCCCCGATCATCG
TGGTGCCCGACCCTCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACCCGCTCTGCGCGGACGTCATCCTGGTGCTGCAGG
AGCGGGTGCGCATCTTTGCCCACAAGATCTACCTCTCCACCTCTTCCTCCAAGTTCTATGACCTGTTCCTCATGGACCTGAGTGAGGGGG
AGCTGGGGGGCCCCTCGGAGCCAGGGGGCACCCACCCAGAGGACCACCAGGGCCACTCTGATCAACACCACCACCATCACCACCACCACC
ATGGGCGAGACTTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGCGTGGATGAGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTG
CTTCCACCAGCGACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGGGGTCGTGTGCTGTCTTCCTGGAGCCGAGCTTTTG
TGAGCATCCAGGAAGAGATGGCAGAAGATCCTCTCACCTACAAATCCCGGCTGATGGTGGTGGTGAAGATGGACAGTTCCATCCAGCCGG
GGCCCTTCCGGGCTGTCCTCAAGTACCTGTACACGGGGGAGCTAGATGAGAACGAGCGTGACCTCATGCACATTGCCCACATTGCTGAGC
TGCTCGAGGTCTTTGATCTGCGCATGATGGTGGCCAACATTCTCAACAATGAGGCCTTCATGAACCAGGAGATCACCAAGGCCTTCCACG
TCCGCCGGACCAACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCAGATGTGACCTTCATCCTGGATGATGGCACCATCAGCGCCC
ACAAGCCCCTGTTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCATTTGTGGAGAGCTCCACCCGGGAGGTGGTGTTTC
CCTACACAAGCAAGAGCTGCATGCGGGCCGTGCTGGAATACCTCTACACCGGCATGTTCACCTCCAGCCCCGACCTGGATGACATGAAGC
TCATCATTCTAGCCAACCGCCTCTGCCTGCCACACCTGGTTGCCCTCACAGAGCAGTACACAGTGACCGGGCTGATGGAAGCGACCCAGA
TGATGGTGGACATCGATGGGGACGTCCTTGTGTTCCTGGAACTGGCTCAGTTCCACTGTGCGTACCAGCTGGCCGACTGGTGTCTCCACC
ACATCTGCACCAACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATGAAGGCCATGTCCCCAGAAAACCAGGAGTATTTCGAGAAGC
ATCGGTGGCCACCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGGAAGGAGCGTGAGAAGGAGGACTACCTCCACCTCA
AGCGGCAGCCCAAACGGCGTTGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCCTCGGCAGCCTCCTCCTCATCCCCATCTTCCTCCT
CGGCTGTGGTCTGAGATGCTGCCACCCTCTTCTGACCCTGCTGCTGTTGTCCCCATCCGCCTTCACCCCTCTGCTCTTCCGCATCACCCC
ATCCACCTTACAGGGACCAGGGGGCCCACGTAACCAGGACCCAGAGGGTGGAGCTCTTCTTACCAGCCACCGTGGCTCAGCCAGAGAGGA
GCTGAGCCCTGTGGAGCAGAACGGGAACCACCTGCAGAGGTCCCCAGACCCAAAGCAGGACGGGAGACAACTGCTTGGAGGAGCGAAGAG
CCCTGGCATTTTATCTCTGGGTTTGAGAGCCCTAGAGTCAAAGGGAAAGCCTCCCAGCCTCCAGGGCTTCTCTGTGTGTCTTGGTTGCTG
CTCTGGCCAGGGAGGCAGCCCCACTCCCAGCAAGCAGAAGTGATCCTCGAGGGTCCTGCCCCTGTTGGCCATATCTTTCCACCGACGGAC
TTGAGTGTTGCATTTGTTTTGTGGGCATTTCCACACGAAGCCTACTCACACCCTCACTGGAGAAGTCAGGGTAGAAATTGAGCCTTCAGA
GCCCAACTCAAGGCTTCTACATCCTGGGGTGCAGCTGCAAAAGGCCAGACGTGGAAAGGCCTGTATCCTGCCAGTGTCCCTCCGTCCCAG
GGGGCTGTGCTAGCACAGACCTGAGAATGGGGACACAGGTCATTCAGAGCTCCAGGCCTGGAAGCAGTGCCTCTTGGTGCAACAAGAAAC
TTCTCCCTCACCCCCTCCTTTACCCTCAGATTTGGAGATGGTAACCAAAGGAAGCAGCTGGGACAGGTGGAGAAGGAAGTAGGAATGAGT
GCACGGCGACCCCGTGCTCCTCAGGGCCCTCCCCTGCCTCTGGGTGGCACTGCTTTTTATAGGGTGGGGCAAAATTAGCAAAAAACAAAA
ACCAATGACAACCAAACTGAAACCGAAACGAAAAATCAACAAACACTCTGTCCTCTATCCCTCCAAAGAATGAAAATCAGAAAAAGCCCC
TGCCTAGCTCACATTTCTATAAACAGAGGCCCCCATGATGAGGAGGTGAAGATTTAGGTTGCAGAATCGACTCCAATGCCTTTCAGGAAA
GGACTCGGCACTTCTCTGACTGCGGAGGCCCTGACCCTGCCAGCTGGCTCCGAGGGCAACACAGGGGCCTGGCCTCTAGAGGGCTGGTGA
TTGAGGGGCCCGGGCTGGCGGCAAAGAGGGGTTTGGTCTCGGGGCTTAAATGGCACCAGACTCTTGCTTTTGCCCATCTGGAGACTGCAG
GCTCCCTTCCTTACCCTCAGAGAGTGCTTATGGTGGGTGTTTTTGCGGGGCTGCAATAGGGGCCAAAAGTCAGGGAAAGGGGCACTGACC
TGTAGTGAAAGGCCACAGGACACAGCCTTATTACTGCTGGGGTGGGATAAGGGGAAGGAGAAGAGGGAGAATGGAGCAGGAGGAAAAGCA
GAGTTGGTCTAGAGAGGAGGAGGGCGGGGCTGGAGGAATGTGGGGGATTGAAACTAGCTCCCAGCCCCCATGGGGCAGCAGCTGGGCCAC
AATTGCCCCTTTCCGTTTTCTAACCCCGACTCAGATTTCACCACCCACACTCTTTTTAGGTGTAAAAGATGGAGTCCCACGGAGGAGGGG
CAGAGCCAGGAGGCAGTGGGGCTGTGGGCTCAGAGCTCAGGAGTCGCCTTACCTGAGAGAGATGTTCTAGCTGAGAGGGCCTGGCCCTGG
GGTGGGCTCCAGGAAAACGCTGGTTAGGCCTGGGATTGAGCTAACCTGAAACAAAGGTAGCAGGCAGGACCTAATGACCAGAGGTTAAAT
CCTCATCAAGAGAGACCAGGCGGCTGGAGGACAAGCGGCTCTAACCCTGGGGGCGGCCATGTTGTCCAGGCCCAGGCCCCTCCAGGACTG
TGGCTGCCTCCCCTCCACGGCCTCCAGGGCGGCTGGCTGGAAAGCCACGCGTATGCTGCCCTCTACAGGCTGCTCGGCCTCCCTGCAGCT
CAGCGCAGCCCAGGGCTCCAAGTGAGGCCCAGAAGCCCATGGGCAGGGCTGGGGGGACGAAGGGGGAACCCGGAGCACCTCCACTTCTAG
GGAAGATGGACAGCGTGGGGGCACACCTGGGCCTCCCGGAAGCTGTGGACGAAAGGGAGAGCGGGTCCTCCAGGGCAAGGGGAACGGGAA
ATAGGTCTCCTAGGTGCCTGAAGCGCTGAGCAACCTGGGTACCCTGGTGGGGATGCAGGGAAGGCCGGGGCAGAGAAAGTGAAGGTCGAC
CCAGGGCTGTAGGAAGCCATAGGAGAGTGACCACGGGATTCCCTGAGAAACAGGGCCGGCCCCCCAACTTCAGGGACCCACCGCCCATTC
CCCGAGAGCTGTCGGAACCAGATGCAACCCGGCAGCCCAGAGAACTCTCCTGGGAGGCTGTGGGTGAGCCAGGCCAACATTGGTGTCCCT
GTCCCCAGAGGGAGGAGCAGGCAGGAGAGAGAGGGGAAGGAGGTATGAATCCCAGTCCCCAGGAACCTAGCTCTTTAAACTCTGGGGAGT
CGGATTCAGGAAACACCCCCAGGAGGCCAAGCCTGAAAACAGAGGGGAGGGAGGAAGGAAGGAGTCCCAGCAGGAGCACAGCCCTGGTTT
CCTGTCACTCAGAGCTGATTCACAGGAGGAGGGGAGGTTGGGGGGCGGGAGACAAAAACCACACCTCTTTTTATATAAGGTTTCATATTT

>In-frame_DENND4C_ENST00000602925_chr9_19357152_+_RHOBTB2_ENST00000519685_chr8_22861938_+_8399nt
GGAGGAAAGGGAGAGGGAGGGGGAAAAGAAAGTGCTGTTTTGTGGAAAGGGGCGGAAGGCGGGGGAGAAAAAGGGAACAGAAACATGGCG
GTCAGGTCTTGGGACGGCTGCGCCGCGGGCAGCTCCTAGGCGACGCGCCGCCCGCACTGTCCGACGGCTCACAGCGCGGAGGCACCCGCG
CGGGCCAGCGCTCCGGCCATCGCCCCTGGCTGTAGGCGGCGCCCCTCGGAGACCCTGCCCGCGAGGCGGCGCAGGCGCAGACCGGACTGA
GGCGGCGGCGGCCGCTGGAGCTAGTCCCCCGCCCTGCCCTGCCGAGCGCGCCCAGTCCGCGAATCCGGTGCTTTCTTGCCCCAGGAAGAA
GCCGTGTCGGGGCTGCGCTGACAGAGGAGCAGGCAGCAGAAAATACAGTAGCAGCCATGATAGAAGACAAAGGACCAAGAGTGACAGACT
ACTTTGTCGTAGCTGGTCTCACTGACACATCTACTCTTTTGGATCAAGAAATAAATCGTTTAGATACTAAGTCAACTGGACCTAAAGCTC
CAATTACAGACATTGCCATTATTATCAAATCAGCTGGAGAAACAGTACCTGAAGGTTACACCTGTGTAGAAGCCACTCCATCAGCTCTCC
AAGCAAACTTGAACTATGGAAGTCTGAAAAGCCCAGAACTTTTCCTCTGTTATAAGAGAGGGAGAGATAAACCACCGCTTACAGATATTG
GAGTTCTATATGAAGGGAAAGAACGGCTTATTCCAGGATGTGAAGTGATCCTAGCCACACCCTATGGTCGCTGTGCCAATGTCAACAATA
GTTCAACTACTTCACAAAGAATCTTTATCACTTATCGAAGGGCTCCTCCAGTTCGACCCCAGAATTCCTTGGCTGTAACTGATATCTGTG
TTATTGTAACCAGTAAAGGAGAAACTCCTCCTCATACCTTCTGCAAAGTTGACAAAAACTTAAATTGTGGAATGTGGGGTTCCAGCGTGT
TTCTGTGTTATAAGAAGTCTGTACCTGCTTCAAATGCAATAGCATATAAGGCTGGTTTAATTTTTAGATATCCAGAAGAGGACTATGAGT
CATTTCCACTCTCAGAATCAGATGTACCTCTTTTCTGCCTTCCTATGGGAGCTACTATTGAGTGCTGGGATCCTGAAACCAAATATCCAC
TTCCAGTTTTTTCAACTTTTGTCTTGACAGGTTCTTCAGCCAAAAAGGTATATGGAGCTGCCATTCAGTTTTATGAACCTTACTCTCGGG
AACTTCTATCAGAGAAACAGCTTATGCACCTGGGCTTGTTGACGCCTGTGGAGAGAAAAATGGTCTCCAAATCCATCAATACAAACAAAT
GCATTTGTTTACTCTCACACTGGCCTTTTTTTGAAGCTTTTAGGAAATTTCTTATGTTTATCTACAAACTTTCTGTGTCTGGACCACATC
CTCTTCCCATTGAAAAGCACATTTCACATTTTATGCAAAACATCCCTTTTCCTTCACCACAAAGACCGAGAATCCTTGTCCAGCTGTCAG
TCCATGATGCATTAATATTATCACAGCCAGTTTCTACACCTTTACCACTAAGTGGAGCCAACTTTAGCACCTTGCTAATGAATCTGGGTC
CTGAGAATTGTGCAACACTGCTGCTCTTTGTTTTACTTGAGAGTAAAATTCTGCTGCATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAG
CTGAAGCTGTTGTAGCTATGATCTTTCCATTTCAGTGGCAATGCCCATATATTCCCCTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTG
CACCTTTACCATTTATAGTTGGAGTTGACTCAAGGTATTTTGATCTTCATGACCCACCACAAGATGTTGTTTGCATTGACTTGGATACGA
ACATGTTATATGTATCAGATGAAAAGAAGAACATGAACTGGAAGCAACTTCCCAAAAAGCCGTGCAAAAATCTACTTAGCACCTTAAAGA
AATTGTATCCCCAGCTGTCTTCAGTTCACCAAAAAACTCAAGAAGGCTCAGCGATTGACATGACTCCAATTGAAGCAGATTTCTCCTGGC
AAAAGAAGATGACACAGCTTGAGATGGAAATTCAAGAGGCATTTTTGCGCTTTATGGCGTCTATTTTAAAAGGATATAGAACATATCTCA
GACCAATCACAGAGGCTCCTTCAAATAAAGCCACAGCTGCTGATTCATTGTTTGACCGACAGGGATTTTTAAAAAGTCGAGATCGTGCCT
ATGCAAAATTCTATACCCTTTTATCCAAAACACAGATTTTTATTCGTTTCATTGAAGAATGCAGTTTTGTAAGTGATAAAGATACTGGAT
TAGCATTTTTTGATGACTGCATAGAAAAGTTGTTTCCTGATAAAGGCACAGAGAAAACAGATAAGGTTGATTTTGATTCAGCAGAAGATA
CCAGATTGATAGAACTAGATGATTCACAGAAAAGTGAGCATACTGTATTTATAATGCCGCCAGAGCCACCTCCTGATGATGGAAAGGACC
TGTCACCAAAGTACAGTTACAAATACTTTCCAAGACTGGACCTTAAGCTTTTTGACAGACCGCAGGAGTTGAAACTTTGTTTTAGTAGAC
ACCCTACTGGGAATAGCATTACAAAGAGTCCACCTCTCATGGCTAAGAGAACTAAACAGGAAATAAAAACAGCTCATAAATTGGCGAAGA
GATGTTATACAAATCCACCACAGTGGGCCAAGTGTCTGTTTAGTCATTGTTACAGTTTATGGTTTATTTGTCTTCCGGCCTATGTTAGAG
TTTCTCATCCTAAAGTCAGAGCACTTCAGCAGGCATATGATGTACTTATTAAGATGAGGAAAACAGATGTGGATCCCTTAGATGAGGTGT
GCTATCGAGTAGTGATGCAGCTTTGTGGACTTTGGGGTCATCCTGTTTTAGCAGTGAGAGTCTTATTTGAAATGAAAACTGCTAGGATAA
AGCCTAATGCTATTACTTATGGTTATTATAATAAGGTAGTCTTGGAGAGCCCGTGGCCTAGCAGTACCCGCAGTGGTATTTTCTTATGGA
CGAAGGTACGGAATGTGGTACGTGGCTTGGCACAGTTTAGGCAGCCGCTTAAAAAGACTGTGCAAAGGTCACAGGTCTCCTCAATATCAG
GTGGTCAGTCTGACCAAGGATACGGGTCTAAGGATGAACTTATAAAGGATGATGCAGAAATTCATGTGCCTGAAGAACAGGCAGCAAGAG
AATTGATAACTAAAACAAAAATGCAAACAGAAGAGGTGTGTGATGCCTCTGCTATTGTGGCAAAACATTCACAACCTAGTCCAGAGCCTC
ACAGTCCTACTGAACCTCCTGCATGGGGCAGCAGTATTGTGAAAGTTCCGTCTGGTATATTTGATGTCAACAGCAGGAAAAGTAGCACTG
GTAGTATATCAAATGTGCTGTTTTCTACTCAAGATCCAGTTGAAGATGCAGTCTTTGGCGAAGCTACTAATCTCAAGAAGAATGGTGATA
GAGGAGAAAAAAGACAAAAGCATTTTCCTGAGAGGAGTTGTAGTTTTAGTTCTGAAAGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGTT
TGGATTCGAATTCAAGTGAAATGGCTATCATGATGGGAGCAGATGCCAAGATTCTCACAGCAGCATTGACATGTCCTAAGACTTCTCTAC
TTCATATTGCAAGAACCCATAGCTTTGAGAATGTTAGCTGTCACCTACCTGATAGTAGGACTTGTATGTCTGAAAGCACTTGGAATCCTG
AGCACAGATCATCTCCGGTGCCAGAGATGCTTGAGGAAAGCCAAGAACTCCTTGAGCCTGTGGTTGATGACGTACCTAAAACTACTGCAA
CAGTAGATACATATGAGAGTCTACTAAGTGATAGTAACAGTAATCAGTCCAGAGACTTGAAAACAGTATCCAAAGATCTGAGGAATAAGA
GAAGTAGTTTATATGGTATTGCTAAGGTGGTTCAGAGGGAAGATGTTGAAACTGGACTAGATCCTTTGTCTCTTTTAGCCACTGAATGTA
CAGGAGGAAAAACTCCTGATTCTGAAGATAAGTTGTTTTCTCCAGTTATTGCACGTAATCTGGCTGATGAAATAGAAAGCTATATGAACC
TAAAAAGTCCCCTAGGTAGTAAATCTTCTAGTATGGAATTACACAGAGAGGAAAACAGAGAGTCTGGCATGACTACTGCATTTATTCATG
CTCTAGAGAGGAGATCAAGCCTACCTTTAGATCATGGTTCACCAGCACAGGAAAATCCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCCA
GGTCTAAAACTTTTACTGGGCGTTTCAAGCAGCAAACCCCCTCTCGAACTCATAAAGAACGTTCAACTTCTTTGTCAGCACTGGTGCGTT
CTTCGCCACATGGCTCGTTGGGTTCTGTAGTAAATTCTTTGTCAGGGCTAAAGCTGGATAATATACTCTCAGGGCCCAAGATAGATGTCC
TGAAATCTGGTATGAAACAAGCAGCGACAGTAGCCAGTAAGATGTGGGTAGCTGTTGCGTCTGCCTACAGCTACTCAGATGATGAGGAAG
AAACTAATAGAGACTACAGCTTCCCAGCTGGCCTAGAAGACCATATTTTGGGGGAGAATATATCGCCTAACACAAGTATCTCAGGGTTGG
TCCCCAGTGAACTTACCCAGAGCAACACAAGTCTTGGCAGTAGCAGCAGTAGTGGAGATGTAGGAAAACTGCATTATCCAACAGGTGAAG
TTCCATTTCCAAGAGGCATGAAAGGGCAAGACTTTGAAAAATCAGATCATGGTTCTTCTCAAAATACCAGCATGTCTAGCATCTATCAGA
ATTGTGCAATGGAGGTTTTGATGTCCAGTTGTTCACAGTGTAGAGCTTGTGGAGCTTTAGTTTATGATGAAGAAATTATGGCTGGATGGA
CAGCAGATGACTCAAATTTGAATACAGCTTGTCCATTCTGTAAAAGCAACTTCTTGCCTCTTCTCAATATAGAATTCAAAGATTTGAGAG
GTTCTGCAAGCTTTTTCCTGAAACCAAGTACCTCTGGTGACAGTTTACAAAGTGGAAGCATTCCATTGGCAAATGAATCCTTGGAGCACA
AACCTGTATCCAGTTTAGCAGAACCTGACTTGATCAACTTTATGGACTTCCCAAAACATAACCAGATCATAACTGAAGAAACAGGCTCTG
CAGTTGAACCAAGGTCCCGTTTAATGGATTCTGACATGGATTATGAAAGGCCAAACGTAGAGACCATCAAGTGCGTTGTGGTGGGGGACA
ACGCCGTGGGTAAGACCAGGCTCATCTGTGCCCGCGCTTGCAATGCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTGCCCACAG
TATGGGCCATCGACCAATATCGTGTGTGCCAGGAGGTGCTGGAACGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCT
GGGACACCTTTGGAGACCACCACAAAGACCGTCGCTTTGCTTATGGGAGATCTGATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCA
ATTCCCTCCACCATGTCAAGACCATGTGGTACCCAGAAATCAAGCACTTCTGCCCCCGAGCACCTGTCATCTTGGTGGGCTGCCAGTTGG
ACCTGCGCTACGCTGACCTGGAGGCTGTCAACAGGGCTAGGCGACCCTTGGCTAGGCCCATCAAACCTAATGAAATCCTGCCCCCAGAGA
AGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCCCCTACTATGAGACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTTGACAACG
CCATCCGAGCTGCACTCATCTCCCGCCGCCACCTGCAGTTCTGGAAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCT
TCCTACCCCCCAAGCCACCGCCCCCGATCATCGTGGTGCCCGACCCTCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACC
CGCTCTGCGCGGACGTCATCCTGGTGCTGCAGGAGCGGGTGCGCATCTTTGCCCACAAGATCTACCTCTCCACCTCTTCCTCCAAGTTCT
ATGACCTGTTCCTCATGGACCTGAGTGAGGGGGAGCTGGGGGGCCCCTCGGAGCCAGGGGGCACCCACCCAGAGGACCACCAGGGCCACT
CTGATCAACACCACCACCATCACCACCACCACCATGGGCGAGACTTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGCGTGGATG
AGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTGCTTCCACCAGCGACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGGG
GTCGTGTGCTGTCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAGGAAGAGATGGCAGAAGATCCTCTCACCTACAAATCCCGGCTGATGG
TGGTGGTGAAGATGGACAGTTCCATCCAGCCGGGGCCCTTCCGGGCTGTCCTCAAGTACCTGTACACGGGGGAGCTAGATGAGAACGAGC
GTGACCTCATGCACATTGCCCACATTGCTGAGCTGCTCGAGGTCTTTGATCTGCGCATGATGGTGGCCAACATTCTCAACAATGAGGCCT
TCATGAACCAGGAGATCACCAAGGCCTTCCACGTCCGCCGGACCAACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCAGATGTGA
CCTTCATCCTGGATGATGGCACCATCAGCGCCCACAAGCCCCTGTTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCAT
TTGTGGAGAGCTCCACCCGGGAGGTGGTGTTTCCCTACACAAGCAAGAGCTGCATGCGGGCCGTGCTGGAATACCTCTACACCGGCATGT
TCACCTCCAGCCCCGACCTGGATGACATGAAGCTCATCATTCTAGCCAACCGCCTCTGCCTGCCACACCTGGTTGCCCTCACAGAGCAGT
ACACAGTGACCGGGCTGATGGAAGCGACCCAGATGATGGTGGACATCGATGGGGACGTCCTTGTGTTCCTGGAACTGGCTCAGTTCCACT
GTGCGTACCAGCTGGCCGACTGGTGTCTCCACCACATCTGCACCAACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATGAAGGCCA
TGTCCCCAGAAAACCAGGAGTATTTCGAGAAGCATCGGTGGCCACCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGGA
AGGAGCGTGAGAAGGAGGACTACCTCCACCTCAAGCGGCAGCCCAAACGGCGTTGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCCT
CGGCAGCCTCCTCCTCATCCCCATCTTCCTCCTCGGCTGTGGTCTGAGATGCTGCCACCCTCTTCTGACCCTGCTGCTGTTGTCCCCATC
CGCCTTCACCCCTCTGCTCTTCCGCATCACCCCATCCACCTTACAGGGACCAGGGGGCCCACGTAACCAGGACCCAGAGGGTGGAGCTCT
TCTTACCAGCCACCGTGGCTCAGCCAGAGAGGAGCTGAGCCCTGTGGAGCAGAACGGGAACCACCTGCAGAGGTCCCCAGACCCAAAGCA
GGACGGGAGACAACTGCTTGGAGGAGCGAAGAGCCCTGGCATTTTATCTCTGGGTTTGAGAGCCCTAGAGTCAAAGGGAAAGCCTCCCAG
CCTCCAGGGCTTCTCTGTGTGTCTTGGTTGCTGCTCTGGCCAGGGAGGCAGCCCCACTCCCAGCAAGCAGAAGTGATCCTCGAGGGTCCT
GCCCCTGTTGGCCATATCTTTCCACCGACGGACTTGAGTGTTGCATTTGTTTTGTGGGCATTTCCACACGAAGCCTACTCACACCCTCAC
TGGAGAAGTCAGGGTAGAAATTGAGCCTTCAGAGCCCAACTCAAGGCTTCTACATCCTGGGGTGCAGCTGCAAAAGGCCAGACGTGGAAA
GGCCTGTATCCTGCCAGTGTCCCTCCGTCCCAGGGGGCTGTGCTAGCACAGACCTGAGAATGGGGACACAGGTCATTCAGAGCTCCAGGC
CTGGAAGCAGTGCCTCTTGGTGCAACAAGAAACTTCTCCCTCACCCCCTCCTTTACCCTCAGATTTGGAGATGGTAACCAAAGGAAGCAG
CTGGGACAGGTGGAGAAGGAAGTAGGAATGAGTGCACGGCGACCCCGTGCTCCTCAGGGCCCTCCCCTGCCTCTGGGTGGCACTGCTTTT
TATAGGGTGGGGCAAAATTAGCAAAAAACAAAAACCAATGACAACCAAACTGAAACCGAAACGAAAAATCAACAAACACTCTGTCCTCTA

>In-frame_DENND4C_ENST00000602925_chr9_19357152_+_RHOBTB2_ENST00000522948_chr8_22861938_+_10150nt
GGAGGAAAGGGAGAGGGAGGGGGAAAAGAAAGTGCTGTTTTGTGGAAAGGGGCGGAAGGCGGGGGAGAAAAAGGGAACAGAAACATGGCG
GTCAGGTCTTGGGACGGCTGCGCCGCGGGCAGCTCCTAGGCGACGCGCCGCCCGCACTGTCCGACGGCTCACAGCGCGGAGGCACCCGCG
CGGGCCAGCGCTCCGGCCATCGCCCCTGGCTGTAGGCGGCGCCCCTCGGAGACCCTGCCCGCGAGGCGGCGCAGGCGCAGACCGGACTGA
GGCGGCGGCGGCCGCTGGAGCTAGTCCCCCGCCCTGCCCTGCCGAGCGCGCCCAGTCCGCGAATCCGGTGCTTTCTTGCCCCAGGAAGAA
GCCGTGTCGGGGCTGCGCTGACAGAGGAGCAGGCAGCAGAAAATACAGTAGCAGCCATGATAGAAGACAAAGGACCAAGAGTGACAGACT
ACTTTGTCGTAGCTGGTCTCACTGACACATCTACTCTTTTGGATCAAGAAATAAATCGTTTAGATACTAAGTCAACTGGACCTAAAGCTC
CAATTACAGACATTGCCATTATTATCAAATCAGCTGGAGAAACAGTACCTGAAGGTTACACCTGTGTAGAAGCCACTCCATCAGCTCTCC
AAGCAAACTTGAACTATGGAAGTCTGAAAAGCCCAGAACTTTTCCTCTGTTATAAGAGAGGGAGAGATAAACCACCGCTTACAGATATTG
GAGTTCTATATGAAGGGAAAGAACGGCTTATTCCAGGATGTGAAGTGATCCTAGCCACACCCTATGGTCGCTGTGCCAATGTCAACAATA
GTTCAACTACTTCACAAAGAATCTTTATCACTTATCGAAGGGCTCCTCCAGTTCGACCCCAGAATTCCTTGGCTGTAACTGATATCTGTG
TTATTGTAACCAGTAAAGGAGAAACTCCTCCTCATACCTTCTGCAAAGTTGACAAAAACTTAAATTGTGGAATGTGGGGTTCCAGCGTGT
TTCTGTGTTATAAGAAGTCTGTACCTGCTTCAAATGCAATAGCATATAAGGCTGGTTTAATTTTTAGATATCCAGAAGAGGACTATGAGT
CATTTCCACTCTCAGAATCAGATGTACCTCTTTTCTGCCTTCCTATGGGAGCTACTATTGAGTGCTGGGATCCTGAAACCAAATATCCAC
TTCCAGTTTTTTCAACTTTTGTCTTGACAGGTTCTTCAGCCAAAAAGGTATATGGAGCTGCCATTCAGTTTTATGAACCTTACTCTCGGG
AACTTCTATCAGAGAAACAGCTTATGCACCTGGGCTTGTTGACGCCTGTGGAGAGAAAAATGGTCTCCAAATCCATCAATACAAACAAAT
GCATTTGTTTACTCTCACACTGGCCTTTTTTTGAAGCTTTTAGGAAATTTCTTATGTTTATCTACAAACTTTCTGTGTCTGGACCACATC
CTCTTCCCATTGAAAAGCACATTTCACATTTTATGCAAAACATCCCTTTTCCTTCACCACAAAGACCGAGAATCCTTGTCCAGCTGTCAG
TCCATGATGCATTAATATTATCACAGCCAGTTTCTACACCTTTACCACTAAGTGGAGCCAACTTTAGCACCTTGCTAATGAATCTGGGTC
CTGAGAATTGTGCAACACTGCTGCTCTTTGTTTTACTTGAGAGTAAAATTCTGCTGCATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAG
CTGAAGCTGTTGTAGCTATGATCTTTCCATTTCAGTGGCAATGCCCATATATTCCCCTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTG
CACCTTTACCATTTATAGTTGGAGTTGACTCAAGGTATTTTGATCTTCATGACCCACCACAAGATGTTGTTTGCATTGACTTGGATACGA
ACATGTTATATGTATCAGATGAAAAGAAGAACATGAACTGGAAGCAACTTCCCAAAAAGCCGTGCAAAAATCTACTTAGCACCTTAAAGA
AATTGTATCCCCAGCTGTCTTCAGTTCACCAAAAAACTCAAGAAGGCTCAGCGATTGACATGACTCCAATTGAAGCAGATTTCTCCTGGC
AAAAGAAGATGACACAGCTTGAGATGGAAATTCAAGAGGCATTTTTGCGCTTTATGGCGTCTATTTTAAAAGGATATAGAACATATCTCA
GACCAATCACAGAGGCTCCTTCAAATAAAGCCACAGCTGCTGATTCATTGTTTGACCGACAGGGATTTTTAAAAAGTCGAGATCGTGCCT
ATGCAAAATTCTATACCCTTTTATCCAAAACACAGATTTTTATTCGTTTCATTGAAGAATGCAGTTTTGTAAGTGATAAAGATACTGGAT
TAGCATTTTTTGATGACTGCATAGAAAAGTTGTTTCCTGATAAAGGCACAGAGAAAACAGATAAGGTTGATTTTGATTCAGCAGAAGATA
CCAGATTGATAGAACTAGATGATTCACAGAAAAGTGAGCATACTGTATTTATAATGCCGCCAGAGCCACCTCCTGATGATGGAAAGGACC
TGTCACCAAAGTACAGTTACAAATACTTTCCAAGACTGGACCTTAAGCTTTTTGACAGACCGCAGGAGTTGAAACTTTGTTTTAGTAGAC
ACCCTACTGGGAATAGCATTACAAAGAGTCCACCTCTCATGGCTAAGAGAACTAAACAGGAAATAAAAACAGCTCATAAATTGGCGAAGA
GATGTTATACAAATCCACCACAGTGGGCCAAGTGTCTGTTTAGTCATTGTTACAGTTTATGGTTTATTTGTCTTCCGGCCTATGTTAGAG
TTTCTCATCCTAAAGTCAGAGCACTTCAGCAGGCATATGATGTACTTATTAAGATGAGGAAAACAGATGTGGATCCCTTAGATGAGGTGT
GCTATCGAGTAGTGATGCAGCTTTGTGGACTTTGGGGTCATCCTGTTTTAGCAGTGAGAGTCTTATTTGAAATGAAAACTGCTAGGATAA
AGCCTAATGCTATTACTTATGGTTATTATAATAAGGTAGTCTTGGAGAGCCCGTGGCCTAGCAGTACCCGCAGTGGTATTTTCTTATGGA
CGAAGGTACGGAATGTGGTACGTGGCTTGGCACAGTTTAGGCAGCCGCTTAAAAAGACTGTGCAAAGGTCACAGGTCTCCTCAATATCAG
GTGGTCAGTCTGACCAAGGATACGGGTCTAAGGATGAACTTATAAAGGATGATGCAGAAATTCATGTGCCTGAAGAACAGGCAGCAAGAG
AATTGATAACTAAAACAAAAATGCAAACAGAAGAGGTGTGTGATGCCTCTGCTATTGTGGCAAAACATTCACAACCTAGTCCAGAGCCTC
ACAGTCCTACTGAACCTCCTGCATGGGGCAGCAGTATTGTGAAAGTTCCGTCTGGTATATTTGATGTCAACAGCAGGAAAAGTAGCACTG
GTAGTATATCAAATGTGCTGTTTTCTACTCAAGATCCAGTTGAAGATGCAGTCTTTGGCGAAGCTACTAATCTCAAGAAGAATGGTGATA
GAGGAGAAAAAAGACAAAAGCATTTTCCTGAGAGGAGTTGTAGTTTTAGTTCTGAAAGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGTT
TGGATTCGAATTCAAGTGAAATGGCTATCATGATGGGAGCAGATGCCAAGATTCTCACAGCAGCATTGACATGTCCTAAGACTTCTCTAC
TTCATATTGCAAGAACCCATAGCTTTGAGAATGTTAGCTGTCACCTACCTGATAGTAGGACTTGTATGTCTGAAAGCACTTGGAATCCTG
AGCACAGATCATCTCCGGTGCCAGAGATGCTTGAGGAAAGCCAAGAACTCCTTGAGCCTGTGGTTGATGACGTACCTAAAACTACTGCAA
CAGTAGATACATATGAGAGTCTACTAAGTGATAGTAACAGTAATCAGTCCAGAGACTTGAAAACAGTATCCAAAGATCTGAGGAATAAGA
GAAGTAGTTTATATGGTATTGCTAAGGTGGTTCAGAGGGAAGATGTTGAAACTGGACTAGATCCTTTGTCTCTTTTAGCCACTGAATGTA
CAGGAGGAAAAACTCCTGATTCTGAAGATAAGTTGTTTTCTCCAGTTATTGCACGTAATCTGGCTGATGAAATAGAAAGCTATATGAACC
TAAAAAGTCCCCTAGGTAGTAAATCTTCTAGTATGGAATTACACAGAGAGGAAAACAGAGAGTCTGGCATGACTACTGCATTTATTCATG
CTCTAGAGAGGAGATCAAGCCTACCTTTAGATCATGGTTCACCAGCACAGGAAAATCCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCCA
GGTCTAAAACTTTTACTGGGCGTTTCAAGCAGCAAACCCCCTCTCGAACTCATAAAGAACGTTCAACTTCTTTGTCAGCACTGGTGCGTT
CTTCGCCACATGGCTCGTTGGGTTCTGTAGTAAATTCTTTGTCAGGGCTAAAGCTGGATAATATACTCTCAGGGCCCAAGATAGATGTCC
TGAAATCTGGTATGAAACAAGCAGCGACAGTAGCCAGTAAGATGTGGGTAGCTGTTGCGTCTGCCTACAGCTACTCAGATGATGAGGAAG
AAACTAATAGAGACTACAGCTTCCCAGCTGGCCTAGAAGACCATATTTTGGGGGAGAATATATCGCCTAACACAAGTATCTCAGGGTTGG
TCCCCAGTGAACTTACCCAGAGCAACACAAGTCTTGGCAGTAGCAGCAGTAGTGGAGATGTAGGAAAACTGCATTATCCAACAGGTGAAG
TTCCATTTCCAAGAGGCATGAAAGGGCAAGACTTTGAAAAATCAGATCATGGTTCTTCTCAAAATACCAGCATGTCTAGCATCTATCAGA
ATTGTGCAATGGAGGTTTTGATGTCCAGTTGTTCACAGTGTAGAGCTTGTGGAGCTTTAGTTTATGATGAAGAAATTATGGCTGGATGGA
CAGCAGATGACTCAAATTTGAATACAGCTTGTCCATTCTGTAAAAGCAACTTCTTGCCTCTTCTCAATATAGAATTCAAAGATTTGAGAG
GTTCTGCAAGCTTTTTCCTGAAACCAAGTACCTCTGGTGACAGTTTACAAAGTGGAAGCATTCCATTGGCAAATGAATCCTTGGAGCACA
AACCTGTATCCAGTTTAGCAGAACCTGACTTGATCAACTTTATGGACTTCCCAAAACATAACCAGATCATAACTGAAGAAACAGGCTCTG
CAGTTGAACCAAGGTCCCGTTTAATGGATTCTGACATGGATTATGAAAGGCCAAACGTAGAGACCATCAAGTGCGTTGTGGTGGGGGACA
ACGCCGTGGGTAAGACCAGGCTCATCTGTGCCCGCGCTTGCAATGCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTGCCCACAG
TATGGGCCATCGACCAATATCGTGTGTGCCAGGAGGTGCTGGAACGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCT
GGGACACCTTTGGAGACCACCACAAAGACCGTCGCTTTGCTTATGGGAGATCTGATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCA
ATTCCCTCCACCATGTCAAGACCATGTGGTACCCAGAAATCAAGCACTTCTGCCCCCGAGCACCTGTCATCTTGGTGGGCTGCCAGTTGG
ACCTGCGCTACGCTGACCTGGAGGCTGTCAACAGGGCTAGGCGACCCTTGGCTAGGCCCATCAAACCTAATGAAATCCTGCCCCCAGAGA
AGGGTCGGGAGGTGGCCAAGGAGCTGGGCATCCCCTACTATGAGACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTTGACAACG
CCATCCGAGCTGCACTCATCTCCCGCCGCCACCTGCAGTTCTGGAAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCT
TCCTACCCCCCAAGCCACCGCCCCCGATCATCGTGGTGCCCGACCCTCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACC
CGCTCTGCGCGGACGTCATCCTGGTGCTGCAGGAGCGGGTGCGCATCTTTGCCCACAAGATCTACCTCTCCACCTCTTCCTCCAAGTTCT
ATGACCTGTTCCTCATGGACCTGAGTGAGGGGGAGCTGGGGGGCCCCTCGGAGCCAGGGGGCACCCACCCAGAGGACCACCAGGGCCACT
CTGATCAACACCACCACCATCACCACCACCACCATGGGCGAGACTTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGCGTGGATG
AGGCTGGGGGCTCCGGTCCTGCTGGCCTCCGTGCTTCCACCAGCGACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGGG
GTCGTGTGCTGTCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAGGAAGAGATGGCAGAAGATCCTCTCACCTACAAATCCCGGCTGATGG
TGGTGGTGAAGATGGACAGTTCCATCCAGCCGGGGCCCTTCCGGGCTGTCCTCAAGTACCTGTACACGGGGGAGCTAGATGAGAACGAGC
GTGACCTCATGCACATTGCCCACATTGCTGAGCTGCTCGAGGTCTTTGATCTGCGCATGATGGTGGCCAACATTCTCAACAATGAGGCCT
TCATGAACCAGGAGATCACCAAGGCCTTCCACGTCCGCCGGACCAACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCAGATGTGA
CCTTCATCCTGGATGATGGCACCATCAGCGCCCACAAGCCCCTGTTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCAT
TTGTGGAGAGCTCCACCCGGGAGGTGGTGTTTCCCTACACAAGCAAGAGCTGCATGCGGGCCGTGCTGGAATACCTCTACACCGGCATGT
TCACCTCCAGCCCCGACCTGGATGACATGAAGCTCATCATTCTAGCCAACCGCCTCTGCCTGCCACACCTGGTTGCCCTCACAGAGCAGT
ACACAGTGACCGGGCTGATGGAAGCGACCCAGATGATGGTGGACATCGATGGGGACGTCCTTGTGTTCCTGGAACTGGCTCAGTTCCACT
GTGCGTACCAGCTGGCCGACTGGTGTCTCCACCACATCTGCACCAACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATGAAGGCCA
TGTCCCCAGAAAACCAGGAGTATTTCGAGAAGCATCGGTGGCCACCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGGA
AGGAGCGTGAGAAGGAGGACTACCTCCACCTCAAGCGGCAGCCCAAACGGCGTTGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCCT
CGGCAGCCTCCTCCTCATCCCCATCTTCCTCCTCGGCTGTGGTCTGAGATGCTGCCACCCTCTTCTGACCCTGCTGCTGTTGTCCCCATC
CGCCTTCACCCCTCTGCTCTTCCGCATCACCCCATCCACCTTACAGGGACCAGGGGGCCCACGTAACCAGGACCCAGAGGGTGGAGCTCT
TCTTACCAGCCACCGTGGCTCAGCCAGAGAGGAGCTGAGCCCTGTGGAGCAGAACGGGAACCACCTGCAGAGGTCCCCAGACCCAAAGCA
GGACGGGAGACAACTGCTTGGAGGAGCGAAGAGCCCTGGCATTTTATCTCTGGGTTTGAGAGCCCTAGAGTCAAAGGGAAAGCCTCCCAG
CCTCCAGGGCTTCTCTGTGTGTCTTGGTTGCTGCTCTGGCCAGGGAGGCAGCCCCACTCCCAGCAAGCAGAAGTGATCCTCGAGGGTCCT
GCCCCTGTTGGCCATATCTTTCCACCGACGGACTTGAGTGTTGCATTTGTTTTGTGGGCATTTCCACACGAAGCCTACTCACACCCTCAC
TGGAGAAGTCAGGGTAGAAATTGAGCCTTCAGAGCCCAACTCAAGGCTTCTACATCCTGGGGTGCAGCTGCAAAAGGCCAGACGTGGAAA
GGCCTGTATCCTGCCAGTGTCCCTCCGTCCCAGGGGGCTGTGCTAGCACAGACCTGAGAATGGGGACACAGGTCATTCAGAGCTCCAGGC
CTGGAAGCAGTGCCTCTTGGTGCAACAAGAAACTTCTCCCTCACCCCCTCCTTTACCCTCAGATTTGGAGATGGTAACCAAAGGAAGCAG
CTGGGACAGGTGGAGAAGGAAGTAGGAATGAGTGCACGGCGACCCCGTGCTCCTCAGGGCCCTCCCCTGCCTCTGGGTGGCACTGCTTTT
TATAGGGTGGGGCAAAATTAGCAAAAAACAAAAACCAATGACAACCAAACTGAAACCGAAACGAAAAATCAACAAACACTCTGTCCTCTA
TCCCTCCAAAGAATGAAAATCAGAAAAAGCCCCTGCCTAGCTCACATTTCTATAAACAGAGGCCCCCATGATGAGGAGGTGAAGATTTAG
GTTGCAGAATCGACTCCAATGCCTTTCAGGAAAGGACTCGGCACTTCTCTGACTGCGGAGGCCCTGACCCTGCCAGCTGGCTCCGAGGGC
AACACAGGGGCCTGGCCTCTAGAGGGCTGGTGATTGAGGGGCCCGGGCTGGCGGCAAAGAGGGGTTTGGTCTCGGGGCTTAAATGGCACC
AGACTCTTGCTTTTGCCCATCTGGAGACTGCAGGCTCCCTTCCTTACCCTCAGAGAGTGCTTATGGTGGGTGTTTTTGCGGGGCTGCAAT
AGGGGCCAAAAGTCAGGGAAAGGGGCACTGACCTGTAGTGAAAGGCCACAGGACACAGCCTTATTACTGCTGGGGTGGGATAAGGGGAAG
GAGAAGAGGGAGAATGGAGCAGGAGGAAAAGCAGAGTTGGTCTAGAGAGGAGGAGGGCGGGGCTGGAGGAATGTGGGGGATTGAAACTAG
CTCCCAGCCCCCATGGGGCAGCAGCTGGGCCACAATTGCCCCTTTCCGTTTTCTAACCCCGACTCAGATTTCACCACCCACACTCTTTTT
AGGTGTAAAAGATGGAGTCCCACGGAGGAGGGGCAGAGCCAGGAGGCAGTGGGGCTGTGGGCTCAGAGCTCAGGAGTCGCCTTACCTGAG
AGAGATGTTCTAGCTGAGAGGGCCTGGCCCTGGGGTGGGCTCCAGGAAAACGCTGGTTAGGCCTGGGATTGAGCTAACCTGAAACAAAGG
TAGCAGGCAGGACCTAATGACCAGAGGTTAAATCCTCATCAAGAGAGACCAGGCGGCTGGAGGACAAGCGGCTCTAACCCTGGGGGCGGC
CATGTTGTCCAGGCCCAGGCCCCTCCAGGACTGTGGCTGCCTCCCCTCCACGGCCTCCAGGGCGGCTGGCTGGAAAGCCACGCGTATGCT
GCCCTCTACAGGCTGCTCGGCCTCCCTGCAGCTCAGCGCAGCCCAGGGCTCCAAGTGAGGCCCAGAAGCCCATGGGCAGGGCTGGGGGGA
CGAAGGGGGAACCCGGAGCACCTCCACTTCTAGGGAAGATGGACAGCGTGGGGGCACACCTGGGCCTCCCGGAAGCTGTGGACGAAAGGG
AGAGCGGGTCCTCCAGGGCAAGGGGAACGGGAAATAGGTCTCCTAGGTGCCTGAAGCGCTGAGCAACCTGGGTACCCTGGTGGGGATGCA
GGGAAGGCCGGGGCAGAGAAAGTGAAGGTCGACCCAGGGCTGTAGGAAGCCATAGGAGAGTGACCACGGGATTCCCTGAGAAACAGGGCC
GGCCCCCCAACTTCAGGGACCCACCGCCCATTCCCCGAGAGCTGTCGGAACCAGATGCAACCCGGCAGCCCAGAGAACTCTCCTGGGAGG
CTGTGGGTGAGCCAGGCCAACATTGGTGTCCCTGTCCCCAGAGGGAGGAGCAGGCAGGAGAGAGAGGGGAAGGAGGTATGAATCCCAGTC
CCCAGGAACCTAGCTCTTTAAACTCTGGGGAGTCGGATTCAGGAAACACCCCCAGGAGGCCAAGCCTGAAAACAGAGGGGAGGGAGGAAG
GAAGGAGTCCCAGCAGGAGCACAGCCCTGGTTTCCTGTCACTCAGAGCTGATTCACAGGAGGAGGGGAGGTTGGGGGGCGGGAGACAAAA

>In-frame_DENND4C_ENST00000380432_chr9_19357152_+_RHOBTB2_ENST00000519685_chr8_22861938_+_7308nt
TCAGAATCAGATGTACCTCTTTTCTGCCTTCCTATGGGAGCTACTATTGAGTGCTGGGATCCTGAAACCAAATATCCACTTCCAGTTTTT
TCAACTTTTGTCTTGACAGGTTCTTCAGCCAAAAAGGTATATGGAGCTGCCATTCAGTTTTATGAACCTTACTCTCGGGAACTTCTATCA
GAGAAACAGCTTATGCACCTGGGCTTGTTGACGCCTGTGGAGAGAAAAATGGTCTCCAAATCCATCAATACAAACAAATGCATTTGTTTA
CTCTCACACTGGCCTTTTTTTGAAGCTTTTAGGAAATTTCTTATGTTTATCTACAAACTTTCTGTGTCTGGACCACATCCTCTTCCCATT
GAAAAGCACATTTCACATTTTATGCAAAACATCCCTTTTCCTTCACCACAAAGACCGAGAATCCTTGTCCAGCTGTCAGTCCATGATGCA
TTAATATTATCACAGCCAGTTTCTACACCTTTACCACTAAGTGGAGCCAACTTTAGCACCTTGCTAATGAATCTGGGTCCTGAGAATTGT
GCAACACTGCTGCTCTTTGTTTTACTTGAGAGTAAAATTCTGCTGCATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAGCTGAAGCTGTT
GTAGCTATGATCTTTCCATTTCAGTGGCAATGCCCATATATTCCCCTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTGCACCTTTACCA
TTTATAGTTGGAGTTGACTCAAGGTATTTTGATCTTCATGACCCACCACAAGATGTTGTTTGCATTGACTTGGATACGAACATGTTATAT
GTATCAGATGAAAAGAAGAACATGAACTGGAAGCAACTTCCCAAAAAGCCGTGCAAAAATCTACTTAGCACCTTAAAGAAATTGTATCCC
CAGCTGTCTTCAGTTCACCAAAAAACTCAAGAAGGCTCAGCGATTGACATGACTCCAATTGAAGCAGATTTCTCCTGGCAAAAGAAGATG
ACACAGCTTGAGATGGAAATTCAAGAGGCATTTTTGCGCTTTATGGCGTCTATTTTAAAAGGATATAGAACATATCTCAGACCAATCACA
GAGGCTCCTTCAAATAAAGCCACAGCTGCTGATTCATTGTTTGACCGACAGGGATTTTTAAAAAGTCGAGATCGTGCCTATGCAAAATTC
TATACCCTTTTATCCAAAACACAGATTTTTATTCGTTTCATTGAAGAATGCAGTTTTGTAAGTGATAAAGATACTGGATTAGCATTTTTT
GATGACTGCATAGAAAAGTTGTTTCCTGATAAAGGCACAGAGAAAACAGATAAGGTTGATTTTGATTCAGCAGAAGATACCAGATTGATA
GAACTAGATGATTCACAGAAAAGTGAGCATACTGTATTTATAATGCCGCCAGAGCCACCTCCTGATGATGGAAAGGACCTGTCACCAAAG
TACAGTTACAAATACTTTCCAAGACTGGACCTTAAGCTTTTTGACAGACCGCAGGAGTTGAAACTTTGTTTTAGTAGACACCCTACTGGG
AATAGCATTACAAAGAGTCCACCTCTCATGGCTAAGAGAACTAAACAGGAAATAAAAACAGCTCATAAATTGGCGAAGAGATGTTATACA
AATCCACCACAGTGGGCCAAGTGTCTGTTTAGTCATTGTTACAGTTTATGGTTTATTTGTCTTCCGGCCTATGTTAGAGTTTCTCATCCT
AAAGTCAGAGCACTTCAGCAGGCATATGATGTACTTATTAAGATGAGGAAAACAGATGTGGATCCCTTAGATGAGGTGTGCTATCGAGTA
GTGATGCAGCTTTGTGGACTTTGGGGTCATCCTGTTTTAGCAGTGAGAGTCTTATTTGAAATGAAAACTGCTAGGATAAAGCCTAATGCT
ATTACTTATGGTTATTATAATAAGGTAGTCTTGGAGAGCCCGTGGCCTAGCAGTACCCGCAGTGGTATTTTCTTATGGACGAAGGTACGG
AATGTGGTACGTGGCTTGGCACAGTTTAGGCAGCCGCTTAAAAAGACTGTGCAAAGGTCACAGGTCTCCTCAATATCAGGTGGTCAGTCT
GACCAAGGATACGGGTCTAAGGATGAACTTATAAAGGATGATGCAGAAATTCATGTGCCTGAAGAACAGGCAGCAAGAGAATTGATAACT
AAAACAAAAATGCAAACAGAAGAGGTGTGTGATGCCTCTGCTATTGTGGCAAAACATTCACAACCTAGTCCAGAGCCTCACAGTCCTACT
GAACCTCCTGCATGGGGCAGCAGTATTGTGAAAGTTCCGTCTGGTATATTTGATGTCAACAGCAGGAAAAGTAGCACTGGTAGTATATCA
AATGTGCTGTTTTCTACTCAAGATCCAGTTGAAGATGCAGTCTTTGGCGAAGCTACTAATCTCAAGAAGAATGGTGATAGAGGAGAAAAA
AGACAAAAGCATTTTCCTGAGAGGAGTTGTAGTTTTAGTTCTGAAAGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGTTTGGATTCGAAT
TCAAGTGAAATGGCTATCATGATGGGAGCAGATGCCAAGATTCTCACAGCAGCATTGACATGTCCTAAGACTTCTCTACTTCATATTGCA
AGAACCCATAGCTTTGAGAATGTTAGCTGTCACCTACCTGATAGTAGGACTTGTATGTCTGAAAGCACTTGGAATCCTGAGCACAGATCA
TCTCCGGTGCCAGAGATGCTTGAGGAAAGCCAAGAACTCCTTGAGCCTGTGGTTGATGACGTACCTAAAACTACTGCAACAGTAGATACA
TATGAGAGTCTACTAAGTGATAGTAACAGTAATCAGTCCAGAGACTTGAAAACAGTATCCAAAGATCTGAGGAATAAGAGAAGTAGTTTA
TATGGTATTGCTAAGGTGGTTCAGAGGGAAGATGTTGAAACTGGACTAGATCCTTTGTCTCTTTTAGCCACTGAATGTACAGGAGGAAAA
ACTCCTGATTCTGAAGATAAGTTGTTTTCTCCAGTTATTGCACGTAATCTGGCTGATGAAATAGAAAGCTATATGAACCTAAAAAGTCCC
CTAGGTAGTAAATCTTCTAGTATGGAATTACACAGAGAGGAAAACAGAGAGTCTGGCATGACTACTGCATTTATTCATGCTCTAGAGAGG
AGATCAAGCCTACCTTTAGATCATGGTTCACCAGCACAGGAAAATCCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCCAGGTCTAAAACT
TTTACTGGGCGTTTCAAGCAGCAAACCCCCTCTCGAACTCATAAAGAACGTTCAACTTCTTTGTCAGCACTGGTGCGTTCTTCGCCACAT
GGCTCGTTGGGTTCTGTAGTAAATTCTTTGTCAGGGCTAAAGCTGGATAATATACTCTCAGGGCCCAAGATAGATGTCCTGAAATCTGGT
ATGAAACAAGCAGCGACAGTAGCCAGTAAGATGTGGGTAGCTGTTGCGTCTGCCTACAGCTACTCAGATGATGAGGAAGAAACTAATAGA
GACTACAGCTTCCCAGCTGGCCTAGAAGACCATATTTTGGGGGAGAATATATCGCCTAACACAAGTATCTCAGGGTTGGTCCCCAGTGAA
CTTACCCAGAGCAACACAAGTCTTGGCAGTAGCAGCAGTAGTGGAGATGTAGGAAAACTGCATTATCCAACAGGTGAAGTTCCATTTCCA
AGAGGCATGAAAGGGCAAGACTTTGAAAAATCAGATCATGGTTCTTCTCAAAATACCAGCATGTCTAGCATCTATCAGAATTGTGCAATG
GAGGTTTTGATGTCCAGTTGTTCACAGTGTAGAGCTTGTGGAGCTTTAGTTTATGATGAAGAAATTATGGCTGGATGGACAGCAGATGAC
TCAAATTTGAATACAGCTTGTCCATTCTGTAAAAGCAACTTCTTGCCTCTTCTCAATATAGAATTCAAAGATTTGAGAGGTTCTGCAAGC
TTTTTCCTGAAACCAAGTACCTCTGGTGACAGTTTACAAAGTGGAAGCATTCCATTGGCAAATGAATCCTTGGAGCACAAACCTGTATCC
AGTTTAGCAGAACCTGACTTGATCAACTTTATGGACTTCCCAAAACATAACCAGATCATAACTGAAGAAACAGGCTCTGCAGTTGAACCA
AGGTCCCGTTTAATGGATTCTGACATGGATTATGAAAGGCCAAACGTAGAGACCATCAAGTGCGTTGTGGTGGGGGACAACGCCGTGGGT
AAGACCAGGCTCATCTGTGCCCGCGCTTGCAATGCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTGCCCACAGTATGGGCCATC
GACCAATATCGTGTGTGCCAGGAGGTGCTGGAACGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCTGGGACACCTTT
GGAGACCACCACAAAGACCGTCGCTTTGCTTATGGGAGATCTGATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCAATTCCCTCCAC
CATGTCAAGACCATGTGGTACCCAGAAATCAAGCACTTCTGCCCCCGAGCACCTGTCATCTTGGTGGGCTGCCAGTTGGACCTGCGCTAC
GCTGACCTGGAGGCTGTCAACAGGGCTAGGCGACCCTTGGCTAGGCCCATCAAACCTAATGAAATCCTGCCCCCAGAGAAGGGTCGGGAG
GTGGCCAAGGAGCTGGGCATCCCCTACTATGAGACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTTGACAACGCCATCCGAGCT
GCACTCATCTCCCGCCGCCACCTGCAGTTCTGGAAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCTTCCTACCCCCC
AAGCCACCGCCCCCGATCATCGTGGTGCCCGACCCTCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACCCGCTCTGCGCG
GACGTCATCCTGGTGCTGCAGGAGCGGGTGCGCATCTTTGCCCACAAGATCTACCTCTCCACCTCTTCCTCCAAGTTCTATGACCTGTTC
CTCATGGACCTGAGTGAGGGGGAGCTGGGGGGCCCCTCGGAGCCAGGGGGCACCCACCCAGAGGACCACCAGGGCCACTCTGATCAACAC
CACCACCATCACCACCACCACCATGGGCGAGACTTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGCGTGGATGAGGCTGGGGGC
TCCGGTCCTGCTGGCCTCCGTGCTTCCACCAGCGACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGGGGTCGTGTGCTG
TCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAGGAAGAGATGGCAGAAGATCCTCTCACCTACAAATCCCGGCTGATGGTGGTGGTGAAG
ATGGACAGTTCCATCCAGCCGGGGCCCTTCCGGGCTGTCCTCAAGTACCTGTACACGGGGGAGCTAGATGAGAACGAGCGTGACCTCATG
CACATTGCCCACATTGCTGAGCTGCTCGAGGTCTTTGATCTGCGCATGATGGTGGCCAACATTCTCAACAATGAGGCCTTCATGAACCAG
GAGATCACCAAGGCCTTCCACGTCCGCCGGACCAACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCAGATGTGACCTTCATCCTG
GATGATGGCACCATCAGCGCCCACAAGCCCCTGTTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCATTTGTGGAGAGC
TCCACCCGGGAGGTGGTGTTTCCCTACACAAGCAAGAGCTGCATGCGGGCCGTGCTGGAATACCTCTACACCGGCATGTTCACCTCCAGC
CCCGACCTGGATGACATGAAGCTCATCATTCTAGCCAACCGCCTCTGCCTGCCACACCTGGTTGCCCTCACAGAGCAGTACACAGTGACC
GGGCTGATGGAAGCGACCCAGATGATGGTGGACATCGATGGGGACGTCCTTGTGTTCCTGGAACTGGCTCAGTTCCACTGTGCGTACCAG
CTGGCCGACTGGTGTCTCCACCACATCTGCACCAACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATGAAGGCCATGTCCCCAGAA
AACCAGGAGTATTTCGAGAAGCATCGGTGGCCACCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGGAAGGAGCGTGAG
AAGGAGGACTACCTCCACCTCAAGCGGCAGCCCAAACGGCGTTGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCCTCGGCAGCCTCC
TCCTCATCCCCATCTTCCTCCTCGGCTGTGGTCTGAGATGCTGCCACCCTCTTCTGACCCTGCTGCTGTTGTCCCCATCCGCCTTCACCC
CTCTGCTCTTCCGCATCACCCCATCCACCTTACAGGGACCAGGGGGCCCACGTAACCAGGACCCAGAGGGTGGAGCTCTTCTTACCAGCC
ACCGTGGCTCAGCCAGAGAGGAGCTGAGCCCTGTGGAGCAGAACGGGAACCACCTGCAGAGGTCCCCAGACCCAAAGCAGGACGGGAGAC
AACTGCTTGGAGGAGCGAAGAGCCCTGGCATTTTATCTCTGGGTTTGAGAGCCCTAGAGTCAAAGGGAAAGCCTCCCAGCCTCCAGGGCT
TCTCTGTGTGTCTTGGTTGCTGCTCTGGCCAGGGAGGCAGCCCCACTCCCAGCAAGCAGAAGTGATCCTCGAGGGTCCTGCCCCTGTTGG
CCATATCTTTCCACCGACGGACTTGAGTGTTGCATTTGTTTTGTGGGCATTTCCACACGAAGCCTACTCACACCCTCACTGGAGAAGTCA
GGGTAGAAATTGAGCCTTCAGAGCCCAACTCAAGGCTTCTACATCCTGGGGTGCAGCTGCAAAAGGCCAGACGTGGAAAGGCCTGTATCC
TGCCAGTGTCCCTCCGTCCCAGGGGGCTGTGCTAGCACAGACCTGAGAATGGGGACACAGGTCATTCAGAGCTCCAGGCCTGGAAGCAGT
GCCTCTTGGTGCAACAAGAAACTTCTCCCTCACCCCCTCCTTTACCCTCAGATTTGGAGATGGTAACCAAAGGAAGCAGCTGGGACAGGT
GGAGAAGGAAGTAGGAATGAGTGCACGGCGACCCCGTGCTCCTCAGGGCCCTCCCCTGCCTCTGGGTGGCACTGCTTTTTATAGGGTGGG
GCAAAATTAGCAAAAAACAAAAACCAATGACAACCAAACTGAAACCGAAACGAAAAATCAACAAACACTCTGTCCTCTATCCCTCCAAAG

>In-frame_DENND4C_ENST00000380432_chr9_19357152_+_RHOBTB2_ENST00000522948_chr8_22861938_+_9059nt
TCAGAATCAGATGTACCTCTTTTCTGCCTTCCTATGGGAGCTACTATTGAGTGCTGGGATCCTGAAACCAAATATCCACTTCCAGTTTTT
TCAACTTTTGTCTTGACAGGTTCTTCAGCCAAAAAGGTATATGGAGCTGCCATTCAGTTTTATGAACCTTACTCTCGGGAACTTCTATCA
GAGAAACAGCTTATGCACCTGGGCTTGTTGACGCCTGTGGAGAGAAAAATGGTCTCCAAATCCATCAATACAAACAAATGCATTTGTTTA
CTCTCACACTGGCCTTTTTTTGAAGCTTTTAGGAAATTTCTTATGTTTATCTACAAACTTTCTGTGTCTGGACCACATCCTCTTCCCATT
GAAAAGCACATTTCACATTTTATGCAAAACATCCCTTTTCCTTCACCACAAAGACCGAGAATCCTTGTCCAGCTGTCAGTCCATGATGCA
TTAATATTATCACAGCCAGTTTCTACACCTTTACCACTAAGTGGAGCCAACTTTAGCACCTTGCTAATGAATCTGGGTCCTGAGAATTGT
GCAACACTGCTGCTCTTTGTTTTACTTGAGAGTAAAATTCTGCTGCATTCTCTTAGGCCAGCTGTCTTGACTGGGGTAGCTGAAGCTGTT
GTAGCTATGATCTTTCCATTTCAGTGGCAATGCCCATATATTCCCCTTTGTCCTCTTTCACTGGCTGCAGTGCTTAGTGCACCTTTACCA
TTTATAGTTGGAGTTGACTCAAGGTATTTTGATCTTCATGACCCACCACAAGATGTTGTTTGCATTGACTTGGATACGAACATGTTATAT
GTATCAGATGAAAAGAAGAACATGAACTGGAAGCAACTTCCCAAAAAGCCGTGCAAAAATCTACTTAGCACCTTAAAGAAATTGTATCCC
CAGCTGTCTTCAGTTCACCAAAAAACTCAAGAAGGCTCAGCGATTGACATGACTCCAATTGAAGCAGATTTCTCCTGGCAAAAGAAGATG
ACACAGCTTGAGATGGAAATTCAAGAGGCATTTTTGCGCTTTATGGCGTCTATTTTAAAAGGATATAGAACATATCTCAGACCAATCACA
GAGGCTCCTTCAAATAAAGCCACAGCTGCTGATTCATTGTTTGACCGACAGGGATTTTTAAAAAGTCGAGATCGTGCCTATGCAAAATTC
TATACCCTTTTATCCAAAACACAGATTTTTATTCGTTTCATTGAAGAATGCAGTTTTGTAAGTGATAAAGATACTGGATTAGCATTTTTT
GATGACTGCATAGAAAAGTTGTTTCCTGATAAAGGCACAGAGAAAACAGATAAGGTTGATTTTGATTCAGCAGAAGATACCAGATTGATA
GAACTAGATGATTCACAGAAAAGTGAGCATACTGTATTTATAATGCCGCCAGAGCCACCTCCTGATGATGGAAAGGACCTGTCACCAAAG
TACAGTTACAAATACTTTCCAAGACTGGACCTTAAGCTTTTTGACAGACCGCAGGAGTTGAAACTTTGTTTTAGTAGACACCCTACTGGG
AATAGCATTACAAAGAGTCCACCTCTCATGGCTAAGAGAACTAAACAGGAAATAAAAACAGCTCATAAATTGGCGAAGAGATGTTATACA
AATCCACCACAGTGGGCCAAGTGTCTGTTTAGTCATTGTTACAGTTTATGGTTTATTTGTCTTCCGGCCTATGTTAGAGTTTCTCATCCT
AAAGTCAGAGCACTTCAGCAGGCATATGATGTACTTATTAAGATGAGGAAAACAGATGTGGATCCCTTAGATGAGGTGTGCTATCGAGTA
GTGATGCAGCTTTGTGGACTTTGGGGTCATCCTGTTTTAGCAGTGAGAGTCTTATTTGAAATGAAAACTGCTAGGATAAAGCCTAATGCT
ATTACTTATGGTTATTATAATAAGGTAGTCTTGGAGAGCCCGTGGCCTAGCAGTACCCGCAGTGGTATTTTCTTATGGACGAAGGTACGG
AATGTGGTACGTGGCTTGGCACAGTTTAGGCAGCCGCTTAAAAAGACTGTGCAAAGGTCACAGGTCTCCTCAATATCAGGTGGTCAGTCT
GACCAAGGATACGGGTCTAAGGATGAACTTATAAAGGATGATGCAGAAATTCATGTGCCTGAAGAACAGGCAGCAAGAGAATTGATAACT
AAAACAAAAATGCAAACAGAAGAGGTGTGTGATGCCTCTGCTATTGTGGCAAAACATTCACAACCTAGTCCAGAGCCTCACAGTCCTACT
GAACCTCCTGCATGGGGCAGCAGTATTGTGAAAGTTCCGTCTGGTATATTTGATGTCAACAGCAGGAAAAGTAGCACTGGTAGTATATCA
AATGTGCTGTTTTCTACTCAAGATCCAGTTGAAGATGCAGTCTTTGGCGAAGCTACTAATCTCAAGAAGAATGGTGATAGAGGAGAAAAA
AGACAAAAGCATTTTCCTGAGAGGAGTTGTAGTTTTAGTTCTGAAAGTCGAGCAGGAATGTTGCTTAAGAAGAGTAGTTTGGATTCGAAT
TCAAGTGAAATGGCTATCATGATGGGAGCAGATGCCAAGATTCTCACAGCAGCATTGACATGTCCTAAGACTTCTCTACTTCATATTGCA
AGAACCCATAGCTTTGAGAATGTTAGCTGTCACCTACCTGATAGTAGGACTTGTATGTCTGAAAGCACTTGGAATCCTGAGCACAGATCA
TCTCCGGTGCCAGAGATGCTTGAGGAAAGCCAAGAACTCCTTGAGCCTGTGGTTGATGACGTACCTAAAACTACTGCAACAGTAGATACA
TATGAGAGTCTACTAAGTGATAGTAACAGTAATCAGTCCAGAGACTTGAAAACAGTATCCAAAGATCTGAGGAATAAGAGAAGTAGTTTA
TATGGTATTGCTAAGGTGGTTCAGAGGGAAGATGTTGAAACTGGACTAGATCCTTTGTCTCTTTTAGCCACTGAATGTACAGGAGGAAAA
ACTCCTGATTCTGAAGATAAGTTGTTTTCTCCAGTTATTGCACGTAATCTGGCTGATGAAATAGAAAGCTATATGAACCTAAAAAGTCCC
CTAGGTAGTAAATCTTCTAGTATGGAATTACACAGAGAGGAAAACAGAGAGTCTGGCATGACTACTGCATTTATTCATGCTCTAGAGAGG
AGATCAAGCCTACCTTTAGATCATGGTTCACCAGCACAGGAAAATCCTGAAAGTGAAAAGAGCTCACCTGCAGTGTCCAGGTCTAAAACT
TTTACTGGGCGTTTCAAGCAGCAAACCCCCTCTCGAACTCATAAAGAACGTTCAACTTCTTTGTCAGCACTGGTGCGTTCTTCGCCACAT
GGCTCGTTGGGTTCTGTAGTAAATTCTTTGTCAGGGCTAAAGCTGGATAATATACTCTCAGGGCCCAAGATAGATGTCCTGAAATCTGGT
ATGAAACAAGCAGCGACAGTAGCCAGTAAGATGTGGGTAGCTGTTGCGTCTGCCTACAGCTACTCAGATGATGAGGAAGAAACTAATAGA
GACTACAGCTTCCCAGCTGGCCTAGAAGACCATATTTTGGGGGAGAATATATCGCCTAACACAAGTATCTCAGGGTTGGTCCCCAGTGAA
CTTACCCAGAGCAACACAAGTCTTGGCAGTAGCAGCAGTAGTGGAGATGTAGGAAAACTGCATTATCCAACAGGTGAAGTTCCATTTCCA
AGAGGCATGAAAGGGCAAGACTTTGAAAAATCAGATCATGGTTCTTCTCAAAATACCAGCATGTCTAGCATCTATCAGAATTGTGCAATG
GAGGTTTTGATGTCCAGTTGTTCACAGTGTAGAGCTTGTGGAGCTTTAGTTTATGATGAAGAAATTATGGCTGGATGGACAGCAGATGAC
TCAAATTTGAATACAGCTTGTCCATTCTGTAAAAGCAACTTCTTGCCTCTTCTCAATATAGAATTCAAAGATTTGAGAGGTTCTGCAAGC
TTTTTCCTGAAACCAAGTACCTCTGGTGACAGTTTACAAAGTGGAAGCATTCCATTGGCAAATGAATCCTTGGAGCACAAACCTGTATCC
AGTTTAGCAGAACCTGACTTGATCAACTTTATGGACTTCCCAAAACATAACCAGATCATAACTGAAGAAACAGGCTCTGCAGTTGAACCA
AGGTCCCGTTTAATGGATTCTGACATGGATTATGAAAGGCCAAACGTAGAGACCATCAAGTGCGTTGTGGTGGGGGACAACGCCGTGGGT
AAGACCAGGCTCATCTGTGCCCGCGCTTGCAATGCCACCCTCACCCAGTACCAGCTGCTGGCCACGCATGTGCCCACAGTATGGGCCATC
GACCAATATCGTGTGTGCCAGGAGGTGCTGGAACGCTCCCGAGACGTGGTAGATGATGTCAGCGTCTCTCTGCGCCTCTGGGACACCTTT
GGAGACCACCACAAAGACCGTCGCTTTGCTTATGGGAGATCTGATGTGGTGGTTCTGTGCTTCTCCATTGCCAACCCCAATTCCCTCCAC
CATGTCAAGACCATGTGGTACCCAGAAATCAAGCACTTCTGCCCCCGAGCACCTGTCATCTTGGTGGGCTGCCAGTTGGACCTGCGCTAC
GCTGACCTGGAGGCTGTCAACAGGGCTAGGCGACCCTTGGCTAGGCCCATCAAACCTAATGAAATCCTGCCCCCAGAGAAGGGTCGGGAG
GTGGCCAAGGAGCTGGGCATCCCCTACTATGAGACCAGCGTGGTGGCCCAGTTCGGCATCAAGGACGTCTTTGACAACGCCATCCGAGCT
GCACTCATCTCCCGCCGCCACCTGCAGTTCTGGAAGTCCCACCTCCGCAATGTGCAGCGGCCTCTGCTGCAGGCACCCTTCCTACCCCCC
AAGCCACCGCCCCCGATCATCGTGGTGCCCGACCCTCCCTCCAGCAGCGAGGAGTGCCCCGCCCACCTCCTGGAGGACCCGCTCTGCGCG
GACGTCATCCTGGTGCTGCAGGAGCGGGTGCGCATCTTTGCCCACAAGATCTACCTCTCCACCTCTTCCTCCAAGTTCTATGACCTGTTC
CTCATGGACCTGAGTGAGGGGGAGCTGGGGGGCCCCTCGGAGCCAGGGGGCACCCACCCAGAGGACCACCAGGGCCACTCTGATCAACAC
CACCACCATCACCACCACCACCATGGGCGAGACTTCCTGCTCCGAGCAGCCAGCTTTGACGTGTGCGAGAGCGTGGATGAGGCTGGGGGC
TCCGGTCCTGCTGGCCTCCGTGCTTCCACCAGCGACGGGATCTTACGGGGCAACGGAACAGGGTACCTACCGGGCAGGGGTCGTGTGCTG
TCTTCCTGGAGCCGAGCTTTTGTGAGCATCCAGGAAGAGATGGCAGAAGATCCTCTCACCTACAAATCCCGGCTGATGGTGGTGGTGAAG
ATGGACAGTTCCATCCAGCCGGGGCCCTTCCGGGCTGTCCTCAAGTACCTGTACACGGGGGAGCTAGATGAGAACGAGCGTGACCTCATG
CACATTGCCCACATTGCTGAGCTGCTCGAGGTCTTTGATCTGCGCATGATGGTGGCCAACATTCTCAACAATGAGGCCTTCATGAACCAG
GAGATCACCAAGGCCTTCCACGTCCGCCGGACCAACCGGGTTAAGGAGTGCTTGGCAAAAGGCACCTTCTCAGATGTGACCTTCATCCTG
GATGATGGCACCATCAGCGCCCACAAGCCCCTGTTGATTTCCAGCTGTGACTGGATGGCTGCCATGTTTGGGGGGCCATTTGTGGAGAGC
TCCACCCGGGAGGTGGTGTTTCCCTACACAAGCAAGAGCTGCATGCGGGCCGTGCTGGAATACCTCTACACCGGCATGTTCACCTCCAGC
CCCGACCTGGATGACATGAAGCTCATCATTCTAGCCAACCGCCTCTGCCTGCCACACCTGGTTGCCCTCACAGAGCAGTACACAGTGACC
GGGCTGATGGAAGCGACCCAGATGATGGTGGACATCGATGGGGACGTCCTTGTGTTCCTGGAACTGGCTCAGTTCCACTGTGCGTACCAG
CTGGCCGACTGGTGTCTCCACCACATCTGCACCAACTACAACAACGTGTGCCGCAAGTTCCCCCGAGACATGAAGGCCATGTCCCCAGAA
AACCAGGAGTATTTCGAGAAGCATCGGTGGCCACCTGTGTGGTACCTGAAGGAGGAAGATCATTACCAGCGGGCACGGAAGGAGCGTGAG
AAGGAGGACTACCTCCACCTCAAGCGGCAGCCCAAACGGCGTTGGCTCTTCTGGAACAGTCCATCCTCCCCGTCTTCCTCGGCAGCCTCC
TCCTCATCCCCATCTTCCTCCTCGGCTGTGGTCTGAGATGCTGCCACCCTCTTCTGACCCTGCTGCTGTTGTCCCCATCCGCCTTCACCC
CTCTGCTCTTCCGCATCACCCCATCCACCTTACAGGGACCAGGGGGCCCACGTAACCAGGACCCAGAGGGTGGAGCTCTTCTTACCAGCC
ACCGTGGCTCAGCCAGAGAGGAGCTGAGCCCTGTGGAGCAGAACGGGAACCACCTGCAGAGGTCCCCAGACCCAAAGCAGGACGGGAGAC
AACTGCTTGGAGGAGCGAAGAGCCCTGGCATTTTATCTCTGGGTTTGAGAGCCCTAGAGTCAAAGGGAAAGCCTCCCAGCCTCCAGGGCT
TCTCTGTGTGTCTTGGTTGCTGCTCTGGCCAGGGAGGCAGCCCCACTCCCAGCAAGCAGAAGTGATCCTCGAGGGTCCTGCCCCTGTTGG
CCATATCTTTCCACCGACGGACTTGAGTGTTGCATTTGTTTTGTGGGCATTTCCACACGAAGCCTACTCACACCCTCACTGGAGAAGTCA
GGGTAGAAATTGAGCCTTCAGAGCCCAACTCAAGGCTTCTACATCCTGGGGTGCAGCTGCAAAAGGCCAGACGTGGAAAGGCCTGTATCC
TGCCAGTGTCCCTCCGTCCCAGGGGGCTGTGCTAGCACAGACCTGAGAATGGGGACACAGGTCATTCAGAGCTCCAGGCCTGGAAGCAGT
GCCTCTTGGTGCAACAAGAAACTTCTCCCTCACCCCCTCCTTTACCCTCAGATTTGGAGATGGTAACCAAAGGAAGCAGCTGGGACAGGT
GGAGAAGGAAGTAGGAATGAGTGCACGGCGACCCCGTGCTCCTCAGGGCCCTCCCCTGCCTCTGGGTGGCACTGCTTTTTATAGGGTGGG
GCAAAATTAGCAAAAAACAAAAACCAATGACAACCAAACTGAAACCGAAACGAAAAATCAACAAACACTCTGTCCTCTATCCCTCCAAAG
AATGAAAATCAGAAAAAGCCCCTGCCTAGCTCACATTTCTATAAACAGAGGCCCCCATGATGAGGAGGTGAAGATTTAGGTTGCAGAATC
GACTCCAATGCCTTTCAGGAAAGGACTCGGCACTTCTCTGACTGCGGAGGCCCTGACCCTGCCAGCTGGCTCCGAGGGCAACACAGGGGC
CTGGCCTCTAGAGGGCTGGTGATTGAGGGGCCCGGGCTGGCGGCAAAGAGGGGTTTGGTCTCGGGGCTTAAATGGCACCAGACTCTTGCT
TTTGCCCATCTGGAGACTGCAGGCTCCCTTCCTTACCCTCAGAGAGTGCTTATGGTGGGTGTTTTTGCGGGGCTGCAATAGGGGCCAAAA
GTCAGGGAAAGGGGCACTGACCTGTAGTGAAAGGCCACAGGACACAGCCTTATTACTGCTGGGGTGGGATAAGGGGAAGGAGAAGAGGGA
GAATGGAGCAGGAGGAAAAGCAGAGTTGGTCTAGAGAGGAGGAGGGCGGGGCTGGAGGAATGTGGGGGATTGAAACTAGCTCCCAGCCCC
CATGGGGCAGCAGCTGGGCCACAATTGCCCCTTTCCGTTTTCTAACCCCGACTCAGATTTCACCACCCACACTCTTTTTAGGTGTAAAAG
ATGGAGTCCCACGGAGGAGGGGCAGAGCCAGGAGGCAGTGGGGCTGTGGGCTCAGAGCTCAGGAGTCGCCTTACCTGAGAGAGATGTTCT
AGCTGAGAGGGCCTGGCCCTGGGGTGGGCTCCAGGAAAACGCTGGTTAGGCCTGGGATTGAGCTAACCTGAAACAAAGGTAGCAGGCAGG
ACCTAATGACCAGAGGTTAAATCCTCATCAAGAGAGACCAGGCGGCTGGAGGACAAGCGGCTCTAACCCTGGGGGCGGCCATGTTGTCCA
GGCCCAGGCCCCTCCAGGACTGTGGCTGCCTCCCCTCCACGGCCTCCAGGGCGGCTGGCTGGAAAGCCACGCGTATGCTGCCCTCTACAG
GCTGCTCGGCCTCCCTGCAGCTCAGCGCAGCCCAGGGCTCCAAGTGAGGCCCAGAAGCCCATGGGCAGGGCTGGGGGGACGAAGGGGGAA
CCCGGAGCACCTCCACTTCTAGGGAAGATGGACAGCGTGGGGGCACACCTGGGCCTCCCGGAAGCTGTGGACGAAAGGGAGAGCGGGTCC
TCCAGGGCAAGGGGAACGGGAAATAGGTCTCCTAGGTGCCTGAAGCGCTGAGCAACCTGGGTACCCTGGTGGGGATGCAGGGAAGGCCGG
GGCAGAGAAAGTGAAGGTCGACCCAGGGCTGTAGGAAGCCATAGGAGAGTGACCACGGGATTCCCTGAGAAACAGGGCCGGCCCCCCAAC
TTCAGGGACCCACCGCCCATTCCCCGAGAGCTGTCGGAACCAGATGCAACCCGGCAGCCCAGAGAACTCTCCTGGGAGGCTGTGGGTGAG
CCAGGCCAACATTGGTGTCCCTGTCCCCAGAGGGAGGAGCAGGCAGGAGAGAGAGGGGAAGGAGGTATGAATCCCAGTCCCCAGGAACCT
AGCTCTTTAAACTCTGGGGAGTCGGATTCAGGAAACACCCCCAGGAGGCCAAGCCTGAAAACAGAGGGGAGGGAGGAAGGAAGGAGTCCC
AGCAGGAGCACAGCCCTGGTTTCCTGTCACTCAGAGCTGATTCACAGGAGGAGGGGAGGTTGGGGGGCGGGAGACAAAAACCACACCTCT


Top

FusionGenePPI for DENND4C_RHOBTB2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DENND4CYWHAB, FBXW11, MED4, OFD1, XPO1, CDK8, C1orf112, CDH1, KCTD3, KIF13B, ZBTB21, KSR1, GIGYF1, CGN, LRFN1, DENND1A, RTKN, SH3PXD2A, MAST3, SRGAP2, EIF4E2, SIPA1L1, PPM1H, LPIN3, LIMA1, MAGI1, TESK2, DCLK1, ZNF638, MAPKAP1, NF1, HDAC4, CBY1, SH3RF3, SRSF12, CDC25C, SYDE1, AGAP1, NADK, GIGYF2, CDC25B, CDK16, TANC2, PTPN13, CAMSAP2, RALGPS2, FAM110B, USP21, KIAA1804, RASAL2, TIAM1, FAM53C, ANKRD34A, OSBPL6, PHLDB2, RPTOR, PLEKHA7, KIF1C, CSNK1A1, MELK, NAV1, DENND4A, FAM110A, GAB2, STARD13, PTPN14, WEE1, INPP5ERHOBTB2KDM5B, CUL3, CUL5, RHOBTB2, RHOBTB3, CDC37, HSP90AA1, BAG4, CHEK2, ERBB2, FGFR2, PALB2, PPM1D, PTPN1, STK11, HSP90AB1, MSI2, APBB3, ARIH1, PKP3, TPM2, DUSP14, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DENND4C_RHOBTB2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DENND4C_RHOBTB2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneRHOBTB2C0031117Peripheral Neuropathy1CTD_human