FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9661

FusionGeneSummary for DDX5_SKAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: DDX5_SKAP1
Fusion gene ID: 9661
HgeneTgene
Gene symbol

DDX5

SKAP1

Gene ID

1655

8631

Gene nameDEAD-box helicase 5src kinase associated phosphoprotein 1
SynonymsG17P1|HLR1|HUMP68|p68HEL-S-81p|SCAP1|SKAP55
Cytomap

17q23.3

17q21.32

Type of geneprotein-codingprotein-coding
Descriptionprobable ATP-dependent RNA helicase DDX5ATP-dependent RNA helicase DDX5DEAD (Asp-Glu-Ala-Asp) box helicase 5DEAD (Asp-Glu-Ala-Asp) box polypeptide 5DEAD box protein 5DEAD box-5DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase, 68kD)RNA hsrc kinase-associated phosphoprotein 1SKAP-55epididymis secretory sperm binding protein Li 81ppp55src family-associated phosphoprotein 1src kinase-associated phosphoprotein of 55 kDa
Modification date2018052220180523
UniProtAcc

P17844

Q86WV1

Ensembl transtripts involved in fusion geneENST00000225792, ENST00000450599, 
ENST00000578804, ENST00000580026, 
ENST00000336915, ENST00000584924, 
Fusion gene scores* DoF score14 X 13 X 4=72822 X 8 X 9=1584
# samples 1422
** MAII scorelog2(14/728*10)=-2.37851162325373
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(22/1584*10)=-2.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DDX5 [Title/Abstract] AND SKAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneDDX5

GO:0000122

negative regulation of transcription by RNA polymerase II

15298701

HgeneDDX5

GO:0000381

regulation of alternative mRNA splicing, via spliceosome

21343338

HgeneDDX5

GO:0000956

nuclear-transcribed mRNA catabolic process

23788676

TgeneSKAP1

GO:0045944

positive regulation of transcription by RNA polymerase II

11909961


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-VQ-A8PJ-01ADDX5chr17

62496667

-SKAP1chr17

46474147

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000225792ENST00000336915DDX5chr17

62496667

-SKAP1chr17

46474147

-
In-frameENST00000225792ENST00000584924DDX5chr17

62496667

-SKAP1chr17

46474147

-
Frame-shitENST00000450599ENST00000336915DDX5chr17

62496667

-SKAP1chr17

46474147

-
In-frameENST00000450599ENST00000584924DDX5chr17

62496667

-SKAP1chr17

46474147

-
Frame-shitENST00000578804ENST00000336915DDX5chr17

62496667

-SKAP1chr17

46474147

-
In-frameENST00000578804ENST00000584924DDX5chr17

62496667

-SKAP1chr17

46474147

-
5UTR-3CDSENST00000580026ENST00000336915DDX5chr17

62496667

-SKAP1chr17

46474147

-
5UTR-3CDSENST00000580026ENST00000584924DDX5chr17

62496667

-SKAP1chr17

46474147

-

Top

FusionProtFeatures for DDX5_SKAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DDX5

P17844

SKAP1

Q86WV1

Involved in the alternative regulation of pre-mRNAsplicing; its RNA helicase activity is necessary for increasingtau exon 10 inclusion and occurs in a RBM4-dependent manner. Bindsto the tau pre-mRNA in the stem-loop region downstream of exon 10.The rate of ATP hydrolysis is highly stimulated by single-strandedRNA. Involved in transcriptional regulation; the function isindependent of the RNA helicase activity. Transcriptionalcoactivator for androgen receptor AR but probably not ESR1.Synergizes with DDX17 and SRA1 RNA to activate MYOD1transcriptional activity and involved in skeletal muscledifferentiation. Transcriptional coactivator for p53/TP53 andinvolved in p53/TP53 transcriptional response to DNA damage andp53/TP53-dependent apoptosis. Transcriptional coactivator forRUNX2 and involved in regulation of osteoblast differentiation.Acts as transcriptional repressor in a promoter-specific manner;the function probably involves association with histonedeacetylases, such as HDAC1. As component of a large PER complexis involved in the inhibition of 3' transcriptional termination ofcircadian target genes such as PER1 and NR1D1 and the control ofthe circadian rhythms. {ECO:0000269|PubMed:12527917,ECO:0000269|PubMed:15298701, ECO:0000269|PubMed:15660129,ECO:0000269|PubMed:17011493, ECO:0000269|PubMed:17960593,ECO:0000269|PubMed:18829551, ECO:0000269|PubMed:19718048,ECO:0000269|PubMed:21343338}. Positively regulates T-cell receptor signaling byenhancing the MAP kinase pathway. Required for optimal conjugationbetween T-cells and antigen-presenting cells by promoting theclustering of integrin ITGAL on the surface of T-cells. May beinvolved in high affinity immunoglobulin epsilon receptorsignaling in mast cells. {ECO:0000269|PubMed:10856234,ECO:0000269|PubMed:11909961, ECO:0000269|PubMed:12652296,ECO:0000269|PubMed:15939789, ECO:0000269|PubMed:16980616}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for DDX5_SKAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DDX5_ENST00000225792_chr17_62496667_-_SKAP1_ENST00000584924_chr17_46474147_-_825aa
MSGTSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFTQEHPDLARRTAQEVETYRRSKEITVRGHNCP
KPVLNFTEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSTLLPAIVHINHQPFLERGDGPICLVLAPTRELA
QQVQQVAAETCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIR
PDRQTLMWSATWPKEVRQLAEDFLKDTIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRK
MRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINTDYPNSSEDTIHRIGRTARSTKTGTAYTFFTPNNI
KQVSDLISVLREANQAINPKLLQLVEDRGSDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYTWDFQPQGGDIGQDSSDDNHSGT
LGLSLTSDAPFLSDTQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYTANEKSKQPKGTFLIKGYGVRMA
PHLRRDSKKESCFELTSQDRRSTEFTATSPAEARDWVDQISFLLKDLSSLTIPTEEDEEEEEKEETTDDIDGFDSPSCGSQCRPTILPGS
VGIKEPTEEKEEEDITEVLPDEEHDLEEDESGTRRKGVDTASYYQGLWDCHGDQPDELSFQRGDLIRILSKETNMTGWWVGELNSLVGIV

>In-frame_DDX5_ENST00000450599_chr17_62496667_-_SKAP1_ENST00000584924_chr17_46474147_-_746aa
MSGTSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFTQEHPDLARRTAQEVETYRRSKEITVRGDGPI
CLVLAPTRELAQQVQQVAAETCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFE
PQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDTIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVE
TKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINTDYPNSSEDTIHRIGRTARSTKTG
TAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYTWDFQPQGGDIG
QDSSDDNHSGTLGLSLTSDAPFLSDTQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYTANEKSKQPKGT
FLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSTEFTATSPAEARDWVDQISFLLKDLSSLTIPTEEDEEEEEKEETTDDIDGFDSPSCG
SQCRPTILPGSVGIKEPTEEKEEEDITEVLPDEEHDLEEDESGTRRKGVDTASYYQGLWDCHGDQPDELSFQRGDLIRILSKETNMTGWW

>In-frame_DDX5_ENST00000578804_chr17_62496667_-_SKAP1_ENST00000584924_chr17_46474147_-_825aa
MKAGRFEADEGTSVRFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFTQEHPDLARRTAQEVETYRRSKEITVRGHNCP
KPVLNFTEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSTLLPAIVHINHQPFLERGDGPICLVLAPTRELA
QQVQQVAAETCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIR
PDRQTLMWSATWPKEVRQLAEDFLKDTIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRK
MRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINTDYPNSSEDTIHRIGRTARSTKTGTAYTFFTPNNI
KQVSDLISVLREANQAINPKLLQLVEDRGSDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYTWDFQPQGGDIGQDSSDDNHSGT
LGLSLTSDAPFLSDTQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYTANEKSKQPKGTFLIKGYGVRMA
PHLRRDSKKESCFELTSQDRRSTEFTATSPAEARDWVDQISFLLKDLSSLTIPTEEDEEEEEKEETTDDIDGFDSPSCGSQCRPTILPGS
VGIKEPTEEKEEEDITEVLPDEEHDLEEDESGTRRKGVDTASYYQGLWDCHGDQPDELSFQRGDLIRILSKETNMTGWWVGELNSLVGIV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DDX5_ENST00000225792_chr17_62496667_-_SKAP1_ENST00000584924_chr17_46474147_-_2475nt
ATGTCGGGTTATTCGAGTGACCGAGACCGCGGCCGGGACCGAGGGTTTGGTGCACCTCGATTTGGAGGAAGTAGGGCAGGGCCCTTATCT
GGAAAGAAGTTTGGAAACCCTGGGGAGAAATTAGTTAAAAAGAAGTGGAATCTTGATGAGCTGCCTAAATTTGAGAAGAATTTTTATCAA
GAGCACCCTGATTTGGCTAGGCGCACAGCACAAGAGGTGGAAACATACAGAAGAAGCAAGGAAATTACAGTTAGAGGTCACAACTGCCCG
AAGCCAGTTCTAAATTTTTATGAAGCCAATTTCCCTGCAAATGTCATGGATGTTATTGCAAGACAGAATTTCACTGAACCCACTGCTATT
CAAGCTCAGGGATGGCCAGTTGCTCTAAGTGGATTGGATATGGTTGGAGTGGCACAGACTGGATCTGGGAAAACATTGTCTTATTTGCTT
CCTGCCATTGTCCACATCAATCATCAGCCATTCCTAGAGAGAGGCGATGGGCCTATTTGTTTGGTGCTGGCACCAACTCGGGAACTGGCC
CAACAGGTGCAGCAAGTAGCTGCTGAATATTGTAGAGCATGTCGCTTGAAGTCTACTTGTATCTACGGTGGTGCTCCTAAGGGACCACAA
ATACGTGATTTGGAGAGAGGTGTGGAAATCTGTATTGCAACACCTGGAAGACTGATTGACTTTTTAGAGTGTGGAAAAACCAATCTGAGA
AGAACAACCTACCTTGTCCTTGATGAAGCAGATAGAATGCTTGATATGGGCTTTGAACCCCAAATAAGGAAGATTGTGGATCAAATAAGA
CCTGATAGGCAAACTCTAATGTGGAGTGCGACTTGGCCAAAAGAAGTAAGACAGCTTGCTGAAGATTTCCTGAAAGACTATATTCATATA
AACATTGGTGCACTTGAACTGAGTGCAAACCACAACATTCTTCAGATTGTGGATGTGTGTCATGACGTAGAAAAGGATGAAAAACTTATT
CGTCTAATGGAAGAGATCATGAGTGAGAAGGAGAATAAAACCATTGTTTTTGTGGAAACCAAAAGAAGATGTGATGAGCTTACCAGAAAA
ATGAGGAGAGATGGGTGGCCTGCCATGGGTATCCATGGTGACAAGAGTCAACAAGAGCGTGACTGGGTTCTAAATGAATTCAAACATGGA
AAAGCTCCTATTCTGATTGCTACAGATGTGGCCTCCAGAGGGCTAGATGTGGAAGATGTGAAATTTGTCATCAATTATGACTACCCTAAC
TCCTCAGAGGATTATATTCATCGAATTGGAAGAACTGCTCGCAGTACCAAAACAGGCACAGCATACACTTTCTTTACACCTAATAACATA
AAGCAAGTGAGCGACCTTATCTCTGTGCTTCGTGAAGCTAATCAAGCAATTAATCCCAAGTTGCTTCAGTTGGTCGAAGACAGAGGTTCA
GATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTCAGCGCTGTTGCAAGGGATCACAGAGACCATATTCTACGGGGCTTT
CAGCAAATCAAAGCCAGGTACTATTGGGATTTTCAGCCCCAAGGGGGAGACATTGGACAGGACAGCTCTGATGATAATCACAGCGGGACT
CTTGGCCTGTCCCTCACATCCGATGCACCCTTTTTGTCAGATTATCAGGATGAGGGAATGGAAGACATCGTAAAAGGAGCTCAAGAACTT
GATAACGTAATCAAGCAAGGATACTTGGAGAAGAAAAGCAAAGATCATAGTTTCTTTGGATCGGAGTGGCAGAAGCGATGGTGTGTTGTC
AGCAGAGGTCTCTTCTACTACTATGCTAATGAGAAGAGCAAGCAGCCCAAAGGGACCTTCCTCATTAAGGGCTACGGTGTACGGATGGCC
CCCCACCTGCGAAGAGATTCCAAGAAAGAATCCTGCTTTGAACTGACCTCCCAGGATAGGCGCAGCTATGAGTTTACAGCTACTAGTCCA
GCAGAAGCCAGAGACTGGGTGGATCAAATAAGTTTCTTGTTAAAGGATCTGAGCTCCTTAACCATTCCATATGAAGAGGATGAGGAGGAA
GAAGAAAAAGAAGAGACATATGATGATATTGATGGTTTTGACTCCCCAAGTTGTGGTTCCCAGTGCAGACCCACTATCTTGCCTGGGAGT
GTGGGGATAAAAGAGCCTACAGAGGAGAAAGAAGAAGAAGATATTTATGAAGTCTTGCCAGATGAAGAGCATGATCTAGAAGAGGATGAG
AGTGGCACTCGACGAAAAGGAGTAGACTATGCCAGTTACTACCAGGGCCTATGGGATTGCCATGGTGACCAGCCAGATGAACTGTCCTTC
CAACGGGGTGACCTCATCCGTATTCTGAGCAAGGAGTATAACATGTATGGCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTT

>In-frame_DDX5_ENST00000450599_chr17_62496667_-_SKAP1_ENST00000584924_chr17_46474147_-_2238nt
ATGTCGGGTTATTCGAGTGACCGAGACCGCGGCCGGGACCGAGGGTTTGGTGCACCTCGATTTGGAGGAAGTAGGGCAGGGCCCTTATCT
GGAAAGAAGTTTGGAAACCCTGGGGAGAAATTAGTTAAAAAGAAGTGGAATCTTGATGAGCTGCCTAAATTTGAGAAGAATTTTTATCAA
GAGCACCCTGATTTGGCTAGGCGCACAGCACAAGAGGTGGAAACATACAGAAGAAGCAAGGAAATTACAGTTAGAGGCGATGGGCCTATT
TGTTTGGTGCTGGCACCAACTCGGGAACTGGCCCAACAGGTGCAGCAAGTAGCTGCTGAATATTGTAGAGCATGTCGCTTGAAGTCTACT
TGTATCTACGGTGGTGCTCCTAAGGGACCACAAATACGTGATTTGGAGAGAGGTGTGGAAATCTGTATTGCAACACCTGGAAGACTGATT
GACTTTTTAGAGTGTGGAAAAACCAATCTGAGAAGAACAACCTACCTTGTCCTTGATGAAGCAGATAGAATGCTTGATATGGGCTTTGAA
CCCCAAATAAGGAAGATTGTGGATCAAATAAGACCTGATAGGCAAACTCTAATGTGGAGTGCGACTTGGCCAAAAGAAGTAAGACAGCTT
GCTGAAGATTTCCTGAAAGACTATATTCATATAAACATTGGTGCACTTGAACTGAGTGCAAACCACAACATTCTTCAGATTGTGGATGTG
TGTCATGACGTAGAAAAGGATGAAAAACTTATTCGTCTAATGGAAGAGATCATGAGTGAGAAGGAGAATAAAACCATTGTTTTTGTGGAA
ACCAAAAGAAGATGTGATGAGCTTACCAGAAAAATGAGGAGAGATGGGTGGCCTGCCATGGGTATCCATGGTGACAAGAGTCAACAAGAG
CGTGACTGGGTTCTAAATGAATTCAAACATGGAAAAGCTCCTATTCTGATTGCTACAGATGTGGCCTCCAGAGGGCTAGATGTGGAAGAT
GTGAAATTTGTCATCAATTATGACTACCCTAACTCCTCAGAGGATTATATTCATCGAATTGGAAGAACTGCTCGCAGTACCAAAACAGGC
ACAGCATACACTTTCTTTACACCTAATAACATAAAGCAAGTGAGCGACCTTATCTCTGTGCTTCGTGAAGCTAATCAAGCAATTAATCCC
AAGTTGCTTCAGTTGGTCGAAGACAGAGGTTCAGATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTCAGCGCTGTTGCA
AGGGATCACAGAGACCATATTCTACGGGGCTTTCAGCAAATCAAAGCCAGGTACTATTGGGATTTTCAGCCCCAAGGGGGAGACATTGGA
CAGGACAGCTCTGATGATAATCACAGCGGGACTCTTGGCCTGTCCCTCACATCCGATGCACCCTTTTTGTCAGATTATCAGGATGAGGGA
ATGGAAGACATCGTAAAAGGAGCTCAAGAACTTGATAACGTAATCAAGCAAGGATACTTGGAGAAGAAAAGCAAAGATCATAGTTTCTTT
GGATCGGAGTGGCAGAAGCGATGGTGTGTTGTCAGCAGAGGTCTCTTCTACTACTATGCTAATGAGAAGAGCAAGCAGCCCAAAGGGACC
TTCCTCATTAAGGGCTACGGTGTACGGATGGCCCCCCACCTGCGAAGAGATTCCAAGAAAGAATCCTGCTTTGAACTGACCTCCCAGGAT
AGGCGCAGCTATGAGTTTACAGCTACTAGTCCAGCAGAAGCCAGAGACTGGGTGGATCAAATAAGTTTCTTGTTAAAGGATCTGAGCTCC
TTAACCATTCCATATGAAGAGGATGAGGAGGAAGAAGAAAAAGAAGAGACATATGATGATATTGATGGTTTTGACTCCCCAAGTTGTGGT
TCCCAGTGCAGACCCACTATCTTGCCTGGGAGTGTGGGGATAAAAGAGCCTACAGAGGAGAAAGAAGAAGAAGATATTTATGAAGTCTTG
CCAGATGAAGAGCATGATCTAGAAGAGGATGAGAGTGGCACTCGACGAAAAGGAGTAGACTATGCCAGTTACTACCAGGGCCTATGGGAT
TGCCATGGTGACCAGCCAGATGAACTGTCCTTCCAACGGGGTGACCTCATCCGTATTCTGAGCAAGGAGTATAACATGTATGGCTGGTGG

>In-frame_DDX5_ENST00000578804_chr17_62496667_-_SKAP1_ENST00000584924_chr17_46474147_-_2475nt
ATGAAAGCGGGACGCTTCGAGGCAGACGAAGGAACATCTGTTAGGTTTGGTGCACCTCGATTTGGAGGAAGTAGGGCAGGGCCCTTATCT
GGAAAGAAGTTTGGAAACCCTGGGGAGAAATTAGTTAAAAAGAAGTGGAATCTTGATGAGCTGCCTAAATTTGAGAAGAATTTTTATCAA
GAGCACCCTGATTTGGCTAGGCGCACAGCACAAGAGGTGGAAACATACAGAAGAAGCAAGGAAATTACAGTTAGAGGTCACAACTGCCCG
AAGCCAGTTCTAAATTTTTATGAAGCCAATTTCCCTGCAAATGTCATGGATGTTATTGCAAGACAGAATTTCACTGAACCCACTGCTATT
CAAGCTCAGGGATGGCCAGTTGCTCTAAGTGGATTGGATATGGTTGGAGTGGCACAGACTGGATCTGGGAAAACATTGTCTTATTTGCTT
CCTGCCATTGTCCACATCAATCATCAGCCATTCCTAGAGAGAGGCGATGGGCCTATTTGTTTGGTGCTGGCACCAACTCGGGAACTGGCC
CAACAGGTGCAGCAAGTAGCTGCTGAATATTGTAGAGCATGTCGCTTGAAGTCTACTTGTATCTACGGTGGTGCTCCTAAGGGACCACAA
ATACGTGATTTGGAGAGAGGTGTGGAAATCTGTATTGCAACACCTGGAAGACTGATTGACTTTTTAGAGTGTGGAAAAACCAATCTGAGA
AGAACAACCTACCTTGTCCTTGATGAAGCAGATAGAATGCTTGATATGGGCTTTGAACCCCAAATAAGGAAGATTGTGGATCAAATAAGA
CCTGATAGGCAAACTCTAATGTGGAGTGCGACTTGGCCAAAAGAAGTAAGACAGCTTGCTGAAGATTTCCTGAAAGACTATATTCATATA
AACATTGGTGCACTTGAACTGAGTGCAAACCACAACATTCTTCAGATTGTGGATGTGTGTCATGACGTAGAAAAGGATGAAAAACTTATT
CGTCTAATGGAAGAGATCATGAGTGAGAAGGAGAATAAAACCATTGTTTTTGTGGAAACCAAAAGAAGATGTGATGAGCTTACCAGAAAA
ATGAGGAGAGATGGGTGGCCTGCCATGGGTATCCATGGTGACAAGAGTCAACAAGAGCGTGACTGGGTTCTAAATGAATTCAAACATGGA
AAAGCTCCTATTCTGATTGCTACAGATGTGGCCTCCAGAGGGCTAGATGTGGAAGATGTGAAATTTGTCATCAATTATGACTACCCTAAC
TCCTCAGAGGATTATATTCATCGAATTGGAAGAACTGCTCGCAGTACCAAAACAGGCACAGCATACACTTTCTTTACACCTAATAACATA
AAGCAAGTGAGCGACCTTATCTCTGTGCTTCGTGAAGCTAATCAAGCAATTAATCCCAAGTTGCTTCAGTTGGTCGAAGACAGAGGTTCA
GATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTCAGCGCTGTTGCAAGGGATCACAGAGACCATATTCTACGGGGCTTT
CAGCAAATCAAAGCCAGGTACTATTGGGATTTTCAGCCCCAAGGGGGAGACATTGGACAGGACAGCTCTGATGATAATCACAGCGGGACT
CTTGGCCTGTCCCTCACATCCGATGCACCCTTTTTGTCAGATTATCAGGATGAGGGAATGGAAGACATCGTAAAAGGAGCTCAAGAACTT
GATAACGTAATCAAGCAAGGATACTTGGAGAAGAAAAGCAAAGATCATAGTTTCTTTGGATCGGAGTGGCAGAAGCGATGGTGTGTTGTC
AGCAGAGGTCTCTTCTACTACTATGCTAATGAGAAGAGCAAGCAGCCCAAAGGGACCTTCCTCATTAAGGGCTACGGTGTACGGATGGCC
CCCCACCTGCGAAGAGATTCCAAGAAAGAATCCTGCTTTGAACTGACCTCCCAGGATAGGCGCAGCTATGAGTTTACAGCTACTAGTCCA
GCAGAAGCCAGAGACTGGGTGGATCAAATAAGTTTCTTGTTAAAGGATCTGAGCTCCTTAACCATTCCATATGAAGAGGATGAGGAGGAA
GAAGAAAAAGAAGAGACATATGATGATATTGATGGTTTTGACTCCCCAAGTTGTGGTTCCCAGTGCAGACCCACTATCTTGCCTGGGAGT
GTGGGGATAAAAGAGCCTACAGAGGAGAAAGAAGAAGAAGATATTTATGAAGTCTTGCCAGATGAAGAGCATGATCTAGAAGAGGATGAG
AGTGGCACTCGACGAAAAGGAGTAGACTATGCCAGTTACTACCAGGGCCTATGGGATTGCCATGGTGACCAGCCAGATGAACTGTCCTTC
CAACGGGGTGACCTCATCCGTATTCTGAGCAAGGAGTATAACATGTATGGCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_DDX5_ENST00000225792_chr17_62496667_-_SKAP1_ENST00000584924_chr17_46474147_-_3175nt
AGAAGAAGGTGAGGTCAAGAGAGTGCAGAATGAGGCATTCCAATGGTGGGTGGGCCCTGACCTGAGAGAGTGGCGCGGGGAGGGGTGAAA
GCGCGGCGATCCTGGAACGCCAGCGGGCGTTGCGGCCTATGCGCGAGGGGCGGGGCGATTAGGTCATAGAGCGGCTCCCAGCGTTCCCTG
CGGCGTAGGAGGCGGTCCAGACTATAAAAGCGGCTGCCGGAAAGCGGCCGGCACCTCATTCATTTCTACCGGTCTCTAGTAGTGCAGCTT
CGGCTGGTGTCATCGGTGTCCTTCCTCCGCTGCCGCCCCCGCAAGGCTTCGCCGTCATCGAGGCCATTTCCAGCGACTTGTCGCACGCTT
TTCTATATACTTCGTTCCCCGCCAACCGCAACCATTGACGCCATGTCGGGTTATTCGAGTGACCGAGACCGCGGCCGGGACCGAGGGTTT
GGTGCACCTCGATTTGGAGGAAGTAGGGCAGGGCCCTTATCTGGAAAGAAGTTTGGAAACCCTGGGGAGAAATTAGTTAAAAAGAAGTGG
AATCTTGATGAGCTGCCTAAATTTGAGAAGAATTTTTATCAAGAGCACCCTGATTTGGCTAGGCGCACAGCACAAGAGGTGGAAACATAC
AGAAGAAGCAAGGAAATTACAGTTAGAGGTCACAACTGCCCGAAGCCAGTTCTAAATTTTTATGAAGCCAATTTCCCTGCAAATGTCATG
GATGTTATTGCAAGACAGAATTTCACTGAACCCACTGCTATTCAAGCTCAGGGATGGCCAGTTGCTCTAAGTGGATTGGATATGGTTGGA
GTGGCACAGACTGGATCTGGGAAAACATTGTCTTATTTGCTTCCTGCCATTGTCCACATCAATCATCAGCCATTCCTAGAGAGAGGCGAT
GGGCCTATTTGTTTGGTGCTGGCACCAACTCGGGAACTGGCCCAACAGGTGCAGCAAGTAGCTGCTGAATATTGTAGAGCATGTCGCTTG
AAGTCTACTTGTATCTACGGTGGTGCTCCTAAGGGACCACAAATACGTGATTTGGAGAGAGGTGTGGAAATCTGTATTGCAACACCTGGA
AGACTGATTGACTTTTTAGAGTGTGGAAAAACCAATCTGAGAAGAACAACCTACCTTGTCCTTGATGAAGCAGATAGAATGCTTGATATG
GGCTTTGAACCCCAAATAAGGAAGATTGTGGATCAAATAAGACCTGATAGGCAAACTCTAATGTGGAGTGCGACTTGGCCAAAAGAAGTA
AGACAGCTTGCTGAAGATTTCCTGAAAGACTATATTCATATAAACATTGGTGCACTTGAACTGAGTGCAAACCACAACATTCTTCAGATT
GTGGATGTGTGTCATGACGTAGAAAAGGATGAAAAACTTATTCGTCTAATGGAAGAGATCATGAGTGAGAAGGAGAATAAAACCATTGTT
TTTGTGGAAACCAAAAGAAGATGTGATGAGCTTACCAGAAAAATGAGGAGAGATGGGTGGCCTGCCATGGGTATCCATGGTGACAAGAGT
CAACAAGAGCGTGACTGGGTTCTAAATGAATTCAAACATGGAAAAGCTCCTATTCTGATTGCTACAGATGTGGCCTCCAGAGGGCTAGAT
GTGGAAGATGTGAAATTTGTCATCAATTATGACTACCCTAACTCCTCAGAGGATTATATTCATCGAATTGGAAGAACTGCTCGCAGTACC
AAAACAGGCACAGCATACACTTTCTTTACACCTAATAACATAAAGCAAGTGAGCGACCTTATCTCTGTGCTTCGTGAAGCTAATCAAGCA
ATTAATCCCAAGTTGCTTCAGTTGGTCGAAGACAGAGGTTCAGATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTCAGC
GCTGTTGCAAGGGATCACAGAGACCATATTCTACGGGGCTTTCAGCAAATCAAAGCCAGGTACTATTGGGATTTTCAGCCCCAAGGGGGA
GACATTGGACAGGACAGCTCTGATGATAATCACAGCGGGACTCTTGGCCTGTCCCTCACATCCGATGCACCCTTTTTGTCAGATTATCAG
GATGAGGGAATGGAAGACATCGTAAAAGGAGCTCAAGAACTTGATAACGTAATCAAGCAAGGATACTTGGAGAAGAAAAGCAAAGATCAT
AGTTTCTTTGGATCGGAGTGGCAGAAGCGATGGTGTGTTGTCAGCAGAGGTCTCTTCTACTACTATGCTAATGAGAAGAGCAAGCAGCCC
AAAGGGACCTTCCTCATTAAGGGCTACGGTGTACGGATGGCCCCCCACCTGCGAAGAGATTCCAAGAAAGAATCCTGCTTTGAACTGACC
TCCCAGGATAGGCGCAGCTATGAGTTTACAGCTACTAGTCCAGCAGAAGCCAGAGACTGGGTGGATCAAATAAGTTTCTTGTTAAAGGAT
CTGAGCTCCTTAACCATTCCATATGAAGAGGATGAGGAGGAAGAAGAAAAAGAAGAGACATATGATGATATTGATGGTTTTGACTCCCCA
AGTTGTGGTTCCCAGTGCAGACCCACTATCTTGCCTGGGAGTGTGGGGATAAAAGAGCCTACAGAGGAGAAAGAAGAAGAAGATATTTAT
GAAGTCTTGCCAGATGAAGAGCATGATCTAGAAGAGGATGAGAGTGGCACTCGACGAAAAGGAGTAGACTATGCCAGTTACTACCAGGGC
CTATGGGATTGCCATGGTGACCAGCCAGATGAACTGTCCTTCCAACGGGGTGACCTCATCCGTATTCTGAGCAAGGAGTATAACATGTAT
GGCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTTCCAAAGGAGTATCTCACCACTGCCTTTGAAGTGGAAGAAAGATGAAAC
CCAGGTATCAGAACCATGGCCAATGAACTGCCTAATAGTTGAGTGGAACTTGTGGGCCACTACTTTGTTTCTCTGAAAGATGAGAGTTGC
CAGTGAAGTAGCTTTTCTTCATTTCTCATACTAATGCTAGTGATTCACCACTGATGGAAAGAAAATGCCTCTGGAATTGTTTTTTTCTTA
AATTTGGGGACAGTGTCACTTAGGATAAGGTTCAACTAATAGCAACATAAAATCTAAACTAAAAATGACTTAATTAACACAGAAAGCCAG

>In-frame_DDX5_ENST00000450599_chr17_62496667_-_SKAP1_ENST00000584924_chr17_46474147_-_2704nt
CTCATTCATTTCTACCGGTCTCTAGTAGTGCAGCTTCGGCTGGTGTCATCGGTGTCCTTCCTCCGCTGCCGCCCCCGCAAGGCTTCGCCG
TCATCGAGGCCATTTCCAGCGACTTGTCGCACGCTTTTCTATATACTTCGTTCCCCGCCAACCGCAACCATTGACGCCATGTCGGGTTAT
TCGAGTGACCGAGACCGCGGCCGGGACCGAGGGTTTGGTGCACCTCGATTTGGAGGAAGTAGGGCAGGGCCCTTATCTGGAAAGAAGTTT
GGAAACCCTGGGGAGAAATTAGTTAAAAAGAAGTGGAATCTTGATGAGCTGCCTAAATTTGAGAAGAATTTTTATCAAGAGCACCCTGAT
TTGGCTAGGCGCACAGCACAAGAGGTGGAAACATACAGAAGAAGCAAGGAAATTACAGTTAGAGGCGATGGGCCTATTTGTTTGGTGCTG
GCACCAACTCGGGAACTGGCCCAACAGGTGCAGCAAGTAGCTGCTGAATATTGTAGAGCATGTCGCTTGAAGTCTACTTGTATCTACGGT
GGTGCTCCTAAGGGACCACAAATACGTGATTTGGAGAGAGGTGTGGAAATCTGTATTGCAACACCTGGAAGACTGATTGACTTTTTAGAG
TGTGGAAAAACCAATCTGAGAAGAACAACCTACCTTGTCCTTGATGAAGCAGATAGAATGCTTGATATGGGCTTTGAACCCCAAATAAGG
AAGATTGTGGATCAAATAAGACCTGATAGGCAAACTCTAATGTGGAGTGCGACTTGGCCAAAAGAAGTAAGACAGCTTGCTGAAGATTTC
CTGAAAGACTATATTCATATAAACATTGGTGCACTTGAACTGAGTGCAAACCACAACATTCTTCAGATTGTGGATGTGTGTCATGACGTA
GAAAAGGATGAAAAACTTATTCGTCTAATGGAAGAGATCATGAGTGAGAAGGAGAATAAAACCATTGTTTTTGTGGAAACCAAAAGAAGA
TGTGATGAGCTTACCAGAAAAATGAGGAGAGATGGGTGGCCTGCCATGGGTATCCATGGTGACAAGAGTCAACAAGAGCGTGACTGGGTT
CTAAATGAATTCAAACATGGAAAAGCTCCTATTCTGATTGCTACAGATGTGGCCTCCAGAGGGCTAGATGTGGAAGATGTGAAATTTGTC
ATCAATTATGACTACCCTAACTCCTCAGAGGATTATATTCATCGAATTGGAAGAACTGCTCGCAGTACCAAAACAGGCACAGCATACACT
TTCTTTACACCTAATAACATAAAGCAAGTGAGCGACCTTATCTCTGTGCTTCGTGAAGCTAATCAAGCAATTAATCCCAAGTTGCTTCAG
TTGGTCGAAGACAGAGGTTCAGATGCTGAAGAGTTTCTGGCAGAAGGTTTGCGGAATGAGAACCTCAGCGCTGTTGCAAGGGATCACAGA
GACCATATTCTACGGGGCTTTCAGCAAATCAAAGCCAGGTACTATTGGGATTTTCAGCCCCAAGGGGGAGACATTGGACAGGACAGCTCT
GATGATAATCACAGCGGGACTCTTGGCCTGTCCCTCACATCCGATGCACCCTTTTTGTCAGATTATCAGGATGAGGGAATGGAAGACATC
GTAAAAGGAGCTCAAGAACTTGATAACGTAATCAAGCAAGGATACTTGGAGAAGAAAAGCAAAGATCATAGTTTCTTTGGATCGGAGTGG
CAGAAGCGATGGTGTGTTGTCAGCAGAGGTCTCTTCTACTACTATGCTAATGAGAAGAGCAAGCAGCCCAAAGGGACCTTCCTCATTAAG
GGCTACGGTGTACGGATGGCCCCCCACCTGCGAAGAGATTCCAAGAAAGAATCCTGCTTTGAACTGACCTCCCAGGATAGGCGCAGCTAT
GAGTTTACAGCTACTAGTCCAGCAGAAGCCAGAGACTGGGTGGATCAAATAAGTTTCTTGTTAAAGGATCTGAGCTCCTTAACCATTCCA
TATGAAGAGGATGAGGAGGAAGAAGAAAAAGAAGAGACATATGATGATATTGATGGTTTTGACTCCCCAAGTTGTGGTTCCCAGTGCAGA
CCCACTATCTTGCCTGGGAGTGTGGGGATAAAAGAGCCTACAGAGGAGAAAGAAGAAGAAGATATTTATGAAGTCTTGCCAGATGAAGAG
CATGATCTAGAAGAGGATGAGAGTGGCACTCGACGAAAAGGAGTAGACTATGCCAGTTACTACCAGGGCCTATGGGATTGCCATGGTGAC
CAGCCAGATGAACTGTCCTTCCAACGGGGTGACCTCATCCGTATTCTGAGCAAGGAGTATAACATGTATGGCTGGTGGGTGGGAGAACTG
AACAGCCTCGTTGGGATTGTTCCAAAGGAGTATCTCACCACTGCCTTTGAAGTGGAAGAAAGATGAAACCCAGGTATCAGAACCATGGCC
AATGAACTGCCTAATAGTTGAGTGGAACTTGTGGGCCACTACTTTGTTTCTCTGAAAGATGAGAGTTGCCAGTGAAGTAGCTTTTCTTCA
TTTCTCATACTAATGCTAGTGATTCACCACTGATGGAAAGAAAATGCCTCTGGAATTGTTTTTTTCTTAAATTTGGGGACAGTGTCACTT
AGGATAAGGTTCAACTAATAGCAACATAAAATCTAAACTAAAAATGACTTAATTAACACAGAAAGCCAGGCACAGTGGCTCACACCTGTA

>In-frame_DDX5_ENST00000578804_chr17_62496667_-_SKAP1_ENST00000584924_chr17_46474147_-_2940nt
TCCTTTCCCGAAGGCTTGCGCCATTTTGATATTCACGTCACAGTGATTGGAAGAGATTTGACGGTGTAGTGTCTTCAAGCTTGCTTTTTG
TGTGGGGATTGGGGAGCTGTCGGGGCGGCTGCCATTTGGTAGCTGTTGAGGGAGTTGAGAGGGAGCGTATTGTGCGGATGAAAGCGGGAC
GCTTCGAGGCAGACGAAGGAACATCTGTTAGGTTTGGTGCACCTCGATTTGGAGGAAGTAGGGCAGGGCCCTTATCTGGAAAGAAGTTTG
GAAACCCTGGGGAGAAATTAGTTAAAAAGAAGTGGAATCTTGATGAGCTGCCTAAATTTGAGAAGAATTTTTATCAAGAGCACCCTGATT
TGGCTAGGCGCACAGCACAAGAGGTGGAAACATACAGAAGAAGCAAGGAAATTACAGTTAGAGGTCACAACTGCCCGAAGCCAGTTCTAA
ATTTTTATGAAGCCAATTTCCCTGCAAATGTCATGGATGTTATTGCAAGACAGAATTTCACTGAACCCACTGCTATTCAAGCTCAGGGAT
GGCCAGTTGCTCTAAGTGGATTGGATATGGTTGGAGTGGCACAGACTGGATCTGGGAAAACATTGTCTTATTTGCTTCCTGCCATTGTCC
ACATCAATCATCAGCCATTCCTAGAGAGAGGCGATGGGCCTATTTGTTTGGTGCTGGCACCAACTCGGGAACTGGCCCAACAGGTGCAGC
AAGTAGCTGCTGAATATTGTAGAGCATGTCGCTTGAAGTCTACTTGTATCTACGGTGGTGCTCCTAAGGGACCACAAATACGTGATTTGG
AGAGAGGTGTGGAAATCTGTATTGCAACACCTGGAAGACTGATTGACTTTTTAGAGTGTGGAAAAACCAATCTGAGAAGAACAACCTACC
TTGTCCTTGATGAAGCAGATAGAATGCTTGATATGGGCTTTGAACCCCAAATAAGGAAGATTGTGGATCAAATAAGACCTGATAGGCAAA
CTCTAATGTGGAGTGCGACTTGGCCAAAAGAAGTAAGACAGCTTGCTGAAGATTTCCTGAAAGACTATATTCATATAAACATTGGTGCAC
TTGAACTGAGTGCAAACCACAACATTCTTCAGATTGTGGATGTGTGTCATGACGTAGAAAAGGATGAAAAACTTATTCGTCTAATGGAAG
AGATCATGAGTGAGAAGGAGAATAAAACCATTGTTTTTGTGGAAACCAAAAGAAGATGTGATGAGCTTACCAGAAAAATGAGGAGAGATG
GGTGGCCTGCCATGGGTATCCATGGTGACAAGAGTCAACAAGAGCGTGACTGGGTTCTAAATGAATTCAAACATGGAAAAGCTCCTATTC
TGATTGCTACAGATGTGGCCTCCAGAGGGCTAGATGTGGAAGATGTGAAATTTGTCATCAATTATGACTACCCTAACTCCTCAGAGGATT
ATATTCATCGAATTGGAAGAACTGCTCGCAGTACCAAAACAGGCACAGCATACACTTTCTTTACACCTAATAACATAAAGCAAGTGAGCG
ACCTTATCTCTGTGCTTCGTGAAGCTAATCAAGCAATTAATCCCAAGTTGCTTCAGTTGGTCGAAGACAGAGGTTCAGATGCTGAAGAGT
TTCTGGCAGAAGGTTTGCGGAATGAGAACCTCAGCGCTGTTGCAAGGGATCACAGAGACCATATTCTACGGGGCTTTCAGCAAATCAAAG
CCAGGTACTATTGGGATTTTCAGCCCCAAGGGGGAGACATTGGACAGGACAGCTCTGATGATAATCACAGCGGGACTCTTGGCCTGTCCC
TCACATCCGATGCACCCTTTTTGTCAGATTATCAGGATGAGGGAATGGAAGACATCGTAAAAGGAGCTCAAGAACTTGATAACGTAATCA
AGCAAGGATACTTGGAGAAGAAAAGCAAAGATCATAGTTTCTTTGGATCGGAGTGGCAGAAGCGATGGTGTGTTGTCAGCAGAGGTCTCT
TCTACTACTATGCTAATGAGAAGAGCAAGCAGCCCAAAGGGACCTTCCTCATTAAGGGCTACGGTGTACGGATGGCCCCCCACCTGCGAA
GAGATTCCAAGAAAGAATCCTGCTTTGAACTGACCTCCCAGGATAGGCGCAGCTATGAGTTTACAGCTACTAGTCCAGCAGAAGCCAGAG
ACTGGGTGGATCAAATAAGTTTCTTGTTAAAGGATCTGAGCTCCTTAACCATTCCATATGAAGAGGATGAGGAGGAAGAAGAAAAAGAAG
AGACATATGATGATATTGATGGTTTTGACTCCCCAAGTTGTGGTTCCCAGTGCAGACCCACTATCTTGCCTGGGAGTGTGGGGATAAAAG
AGCCTACAGAGGAGAAAGAAGAAGAAGATATTTATGAAGTCTTGCCAGATGAAGAGCATGATCTAGAAGAGGATGAGAGTGGCACTCGAC
GAAAAGGAGTAGACTATGCCAGTTACTACCAGGGCCTATGGGATTGCCATGGTGACCAGCCAGATGAACTGTCCTTCCAACGGGGTGACC
TCATCCGTATTCTGAGCAAGGAGTATAACATGTATGGCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTTCCAAAGGAGTATC
TCACCACTGCCTTTGAAGTGGAAGAAAGATGAAACCCAGGTATCAGAACCATGGCCAATGAACTGCCTAATAGTTGAGTGGAACTTGTGG
GCCACTACTTTGTTTCTCTGAAAGATGAGAGTTGCCAGTGAAGTAGCTTTTCTTCATTTCTCATACTAATGCTAGTGATTCACCACTGAT
GGAAAGAAAATGCCTCTGGAATTGTTTTTTTCTTAAATTTGGGGACAGTGTCACTTAGGATAAGGTTCAACTAATAGCAACATAAAATCT


Top

FusionGenePPI for DDX5_SKAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DDX5STK24, HDAC1, CREBBP, EP300, AKAP8, FBL, OTUB1, MEPCE, CDK9, HNRNPA1, HNRNPH1, KHDRBS2, IPO11, TCEA1, AIRE, MYOD1, SMARCA4, TBP, POLR2A, MGMT, SRRM1, SRRM2, PIAS1, MBD3, CHD3, ESR1, TADA2A, SMN1, CD4, DGCR8, ZWINT, CALM1, PIK3CA, PSMA3, TNNT1, VHL, SMARCAD1, YY1, NDRG1, HDGF, CENPA, MBNL1, SF3A2, ARRB2, ERG, NFX1, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, DDX5, DDX17, HDAC2, HDAC3, INPPL1, SHC1, CRK, AKT1, DHX15, SRSF1, SF3B3, U2AF2, DHX38, SNRPA1, EIF4A3, PRKDC, SF3A1, HNRNPM, HNRNPF, SNRPD1, RBMX, SYNCRIP, U2AF1, SART1, PRPF40A, IGF2BP3, SNW1, PRPF19, SNRPD2, VTN, MCM7, SYN1, RPS20, XRCC4, RPS16, HNRNPA0, EEF2, PRSS1, THRAP3, GOLIM4, EPRS, RPL19, SRP14, SMURF1, FN1, VCAM1, RBM10, WBP11, HNRNPK, DHX9, RBM4, HNRNPH2, HNRNPH3, KHDRBS1, RBFOX2, IL7R, MAP1LC3A, ITGA4, CTNNB1, CD81, IGSF8, FBXW4, FBXO46, SP1, MAPK10, FBXO6, TARDBP, PARK2, PIN1, DBNL, ERO1L, FKBP10, LRSAM1, PABPC4, PRPSAP1, WDR4, RPA1, RPA2, RPA3, STAU1, MDM2, SPRTN, AURKA, AURKB, CEP250, TP53, TUBGCP3, FUS, MAPKAPK2, DROSHA, NXF1, CUL7, OBSL1, CCDC8, UBE2I, EZH2, SUZ12, EED, RNF2, SMAD3, ABL1, ARAF, CDK2, DAPK1, ILK, MAST3, SGK2, SRPK1, TNK1, TYK2, LUZP4, RPS6KB2, UNK, NTRK1, ATXN2, ATXN2L, C14orf166, CPSF6, DDX18, DNAJC2, ELAC2, GTPBP4, HNRNPR, IMPDH1, SBDS, SKIV2L2, TRMT6, DHX36, EDC4, EIF2A, GMPS, LUC7L2, NACA, UPF1, SFN, SCARNA22, FRS3, XPO1, HNRNPU, RPL10, MATR3, SKI, MCM2, MCM5, CDC5L, CDC37, CRBN, CBX7, RYBP, WWP2, DERL1, EGFR, YPEL5, RMND5A, MAEA, RANBP9, ARMC8, NR2E1, CYLD, CD2BP2, INO80B, TRIM25, HOTAIR, HEY1, BRCA1, LMNA, MTF1SKAP1PTPRC, FYB, SRC, LYN, FYN, LCK, SKAP1, GRB2, APP, BLCAP, SH2D4A, PRAM1, FAM102A, AP3M1, MYO9B, MYO9A, POLR1B, LOC81691, EML3, WRN, ASPM, JPH1, POLR1A, POLR3A, RECQL4, HPS3, ZNF324, FAM208A, UXT, NCAPD3, MYCBP2, CUL2, PIP5K1A, NEK1, PLEKHH3, PHLDB3, PIK3C3, SEC63, SKAP2, GTF3C1, URI1, PIK3R2, PIK3R3, POLRMT, PLD2, UCKL1, PRR14L, KSR1, ZNHIT6, PDRG1, SETX, NEFL, ALMS1, APPBP2, DDX11L8, UTP15, SENP5, NCAPH2, PAX3, TBL2, ZNHIT2, ZNF644, SUGCT, PKN3, TTF2, PPHLN1, NPHP4, MTMR1, PKN2, C21orf2, POLA1, POLR3B, POLR2L, CCP110, SETD5, ELP3, DOCK7, USP54, POLR1E, TRMT44, POLR1D, EXPH5, NEK4, ATXN2, SBF1, GTPBP6, TRMT1, CD3EAP, PER1, SUPT6H, MCM8, RTEL1, TIGD5, PUSL1, KLHDC3, DYNLL2, MAP7D1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DDX5_SKAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneDDX5P17844DB11638ArtenimolProbable ATP-dependent RNA helicase DDX5small moleculeapproved|investigational

Top

RelatedDiseases for DDX5_SKAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneDDX5C0014175Endometriosis1CTD_human
TgeneSKAP1C0919267ovarian neoplasm1CTD_human