|
||||||
|
 | |
| |
| |
| |
| |
|
Fusion gene ID: 9471 |
FusionGeneSummary for DCUN1D2_CORT |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: DCUN1D2_CORT | Fusion gene ID: 9471 | Hgene | Tgene | Gene symbol | DCUN1D2 | CORT | Gene ID | 55208 | 1325 |
| Gene name | defective in cullin neddylation 1 domain containing 2 | cortistatin | |
| Synonyms | C13orf17 | CST-14|CST-17|CST-29 | |
| Cytomap | 13q34 | 1p36.22 | |
| Type of gene | protein-coding | protein-coding | |
| Description | DCN1-like protein 2DCN1, defective in cullin neddylation 1, domain containing 2DCUN1 domain-containing protein 2defective in cullin neddylation protein 1-like protein 2 | cortistatincortistatin-14cortistatin-17cortistatin-29prepro-cortistatinpreprocortistatin | |
| Modification date | 20180523 | 20180523 | |
| UniProtAcc | Q6PH85 | O00230 | |
| Ensembl transtripts involved in fusion gene | ENST00000332592, ENST00000478244, ENST00000375399, ENST00000460318, | ENST00000377049, ENST00000320498, | |
| Fusion gene scores | * DoF score | 3 X 3 X 3=27 | 2 X 1 X 2=4 |
| # samples | 3 | 2 | |
| ** MAII score | log2(3/27*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(2/4*10)=2.32192809488736 | |
| Context | PubMed: DCUN1D2 [Title/Abstract] AND CORT [Title/Abstract] AND fusion [Title/Abstract] | ||
| Functional or gene categories assigned by FusionGDB annotation | |||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | CORT | GO:0007193 | adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway | 9125122 |
| Fusion gene information from three resources (ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018)) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Data type | Source | Cancer type | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| TCGA | LD | GBM | TCGA-19-A60I-01A | DCUN1D2 | chr13 | 114128439 | - | CORT | chr1 | 10511434 | + |
| * LD: Li Ding group's fusion gene list RV: Roel Verhaak group's fusion gene list ChiTaRs fusion database |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| In-frame | ENST00000332592 | ENST00000377049 | DCUN1D2 | chr13 | 114128439 | - | CORT | chr1 | 10511434 | + |
| Frame-shift | ENST00000332592 | ENST00000320498 | DCUN1D2 | chr13 | 114128439 | - | CORT | chr1 | 10511434 | + |
| Frame-shift | ENST00000478244 | ENST00000377049 | DCUN1D2 | chr13 | 114128439 | - | CORT | chr1 | 10511434 | + |
| Frame-shift | ENST00000478244 | ENST00000320498 | DCUN1D2 | chr13 | 114128439 | - | CORT | chr1 | 10511434 | + |
| Frame-shift | ENST00000375399 | ENST00000377049 | DCUN1D2 | chr13 | 114128439 | - | CORT | chr1 | 10511434 | + |
| Frame-shift | ENST00000375399 | ENST00000320498 | DCUN1D2 | chr13 | 114128439 | - | CORT | chr1 | 10511434 | + |
| intron-3CDS | ENST00000460318 | ENST00000377049 | DCUN1D2 | chr13 | 114128439 | - | CORT | chr1 | 10511434 | + |
| intron-3CDS | ENST00000460318 | ENST00000320498 | DCUN1D2 | chr13 | 114128439 | - | CORT | chr1 | 10511434 | + |
Top |
FusionProtFeatures for DCUN1D2_CORT |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| DCUN1D2 | CORT |
| Potently stimulates the neddylation of cullin componentsof SCF-type E3 ubiquitin ligase complexes from the NEDD8-conjugating E2 enzyme UBC12. Neddylation of cullins play anessential role in the regulation of SCF-type complexes activity.{ECO:0000269|PubMed:23201271}. | Binds to all human somatostatin receptor (SSTR)subtypes. It also inhibits cAMP production induced by forskolinthrough SSTRs. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at . * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | DCUN1D2 | chr13:114128439 | chr1:10511434 | ENST00000375399 | - | 4 | 5 | 8_45 | 173 | 187 | Domain | Note=UBA-like |
| Hgene | DCUN1D2 | chr13:114128439 | chr1:10511434 | ENST00000478244 | - | 4 | 7 | 8_45 | 173 | 260 | Domain | Note=UBA-like |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | >DCUN1D2 | chr13:114128439 | chr1:10511434 | ENST00000332592 | - | 2 | 5 | 60_248 | 40 | 127 | Domain | DCUN1 |
| Hgene | >DCUN1D2 | chr13:114128439 | chr1:10511434 | ENST00000332592 | - | 2 | 5 | 8_45 | 40 | 127 | Domain | Note=UBA-like |
| Hgene | >DCUN1D2 | chr13:114128439 | chr1:10511434 | ENST00000375399 | - | 4 | 5 | 60_248 | 173 | 187 | Domain | DCUN1 |
| Hgene | >DCUN1D2 | chr13:114128439 | chr1:10511434 | ENST00000478244 | - | 4 | 7 | 60_248 | 173 | 260 | Domain | DCUN1 |
Top |
FusionGeneSequence for DCUN1D2_CORT |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. (nt: nucleotides, aa: amino acids) |
| * Fusion amino acid sequences. |
| >In-frame_DCUN1D2_ENST00000332592_chr13_114128439_-_CORT_ENST00000377049_chr1_10511434_+_113aa MEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLAYAGSGRNKEKQPPDFPRLVVXVDLPGQCRAPHRRGSPGGGQAAGRRTPP |
| * Fusion transcript sequences (only coding sequence (CDS) region). |
| >In-frame_DCUN1D2_ENST00000332592_chr13_114128439_-_CORT_ENST00000377049_chr1_10511434_+_340nt ATGGAGAAGCTAAAGGCTCTTCTGCCAAGACTGGAGCAGGAGCTGAAGGACACAGCCAAGTTTAAAGATTTTTATCAGTTTACCTTCACC TTCGCTAAGAACCCAGGGCAGAAAGGTTTAGCATATGCAGGAAGCGGCAGGAATAAGGAAAAGCAGCCTCCTGACTTTCCTCGCTTGGTG GTTTGAGTGGACCTCCCAGGCCAGTGCCGGGCCCCTCATAGGAGAGGAAGCCCGGGAGGTGGCCAGGCGGCAGGAAGGCGCACCCCCCCA |
| * Fusion transcript sequences (Full-length transcript). |
| >In-frame_DCUN1D2_ENST00000332592_chr13_114128439_-_CORT_ENST00000377049_chr1_10511434_+_682nt AGAAGCGGGCGGCGCGGGGGAGATGGTGTGACAGCATGGAGAAGCTAAAGGCTCTTCTGCCAAGACTGGAGCAGGAGCTGAAGGACACAG CCAAGTTTAAAGATTTTTATCAGTTTACCTTCACCTTCGCTAAGAACCCAGGGCAGAAAGGTTTAGCATATGCAGGAAGCGGCAGGAATA AGGAAAAGCAGCCTCCTGACTTTCCTCGCTTGGTGGTTTGAGTGGACCTCCCAGGCCAGTGCCGGGCCCCTCATAGGAGAGGAAGCCCGG GAGGTGGCCAGGCGGCAGGAAGGCGCACCCCCCCAGCAATCTGCGCGCCGGGACAGAATGCCCTGCAGGAACTTCTTCTGGAAGACCTTC TCCTCCTGCAAATAAAACCTCACCCATGAATGCTCACGCAAGTGTAATGACAGACCTGAATAAAATGTATTAAGCAGCAGTGATCTTTCC TCTCCTCCTTCCCAAGTCATTTGAAAAGTGTTTGTTATTTAAATTCCAATAATGCCCAATACTGACGTGTCTTGAGTAATTTGGAACCCA AAGTGAAGATCTTTGATAAAGATTTTTTTGTGGTTCGACTGGACTGTGCTGAGTGCGGGCACTGGGCTTTTCTTCTGATGTTCATTATGG |
Top |
FusionGenePPI for DCUN1D2_CORT |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in . |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| DCUN1D2 | DCUN1D1, APP, CUL1, CUL2, CUL3, CUL4A, CUL4B, CUL5, UBE2F, UBE2M, MAP3K1, CAND1, RBX1, RNF7, TCEB2 | CORT | SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, AP1S2, MB |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
RelatedDrugs for DCUN1D2_CORT |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.0 2018-04-02) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for DCUN1D2_CORT |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|