FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9416

FusionGeneSummary for DCHS2_FGG

check button Fusion gene summary
Fusion gene informationFusion gene name: DCHS2_FGG
Fusion gene ID: 9416
HgeneTgene
Gene symbol

DCHS2

FGG

Gene ID

54798

2266

Gene namedachsous cadherin-related 2fibrinogen gamma chain
SynonymsCDH27|CDHJ|CDHR7|PCDH23|PCDHJ-
Cytomap

4q31.3

4q32.1

Type of geneprotein-codingprotein-coding
Descriptionprotocadherin-23cadherin Jcadherin-like 27cadherin-like protein CDHJcadherin-like protein VR8cadherin-related family member 7protein dachsous homolog 2protocadherin 23protocadherin Jprotocadherin PCDHJfibrinogen gamma chainfibrinogen, gamma polypeptidetesticular tissue protein Li 70
Modification date2018051920180519
UniProtAcc

Q6V1P9

P02679

Ensembl transtripts involved in fusion geneENST00000357232, ENST00000339452, 
ENST00000507542, ENST00000456341, 
ENST00000443500, 
ENST00000404648, 
ENST00000405164, ENST00000336098, 
ENST00000407946, 
Fusion gene scores* DoF score2 X 1 X 2=48 X 9 X 3=216
# samples 214
** MAII scorelog2(2/4*10)=2.32192809488736log2(14/216*10)=-0.625604485218502
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DCHS2 [Title/Abstract] AND FGG [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneFGG

GO:0007160

cell-matrix adhesion

10903502

TgeneFGG

GO:0031639

plasminogen activation

16846481

TgeneFGG

GO:0034116

positive regulation of heterotypic cell-cell adhesion

8100742

TgeneFGG

GO:0034622

cellular protein-containing complex assembly

8910396

TgeneFGG

GO:0042730

fibrinolysis

16846481

TgeneFGG

GO:0045907

positive regulation of vasoconstriction

15739255

TgeneFGG

GO:0045921

positive regulation of exocytosis

19193866

TgeneFGG

GO:0050714

positive regulation of protein secretion

19193866

TgeneFGG

GO:0051592

response to calcium ion

6777381

TgeneFGG

GO:0070374

positive regulation of ERK1 and ERK2 cascade

10903502|19193866

TgeneFGG

GO:0070527

platelet aggregation

6281794

TgeneFGG

GO:0072378

blood coagulation, fibrin clot formation

16846481

TgeneFGG

GO:0090277

positive regulation of peptide hormone secretion

19193866

TgeneFGG

GO:1902042

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

10903502

TgeneFGG

GO:2000352

negative regulation of endothelial cell apoptotic process

10903502


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-49-6743-01ADCHS2chr4

155410456

-FGGchr4

155533353

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000357232ENST00000404648DCHS2chr4

155410456

-FGGchr4

155533353

-
intron-3CDSENST00000357232ENST00000405164DCHS2chr4

155410456

-FGGchr4

155533353

-
intron-3CDSENST00000357232ENST00000336098DCHS2chr4

155410456

-FGGchr4

155533353

-
intron-3CDSENST00000357232ENST00000407946DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000339452ENST00000404648DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000339452ENST00000405164DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000339452ENST00000336098DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000339452ENST00000407946DCHS2chr4

155410456

-FGGchr4

155533353

-
intron-3CDSENST00000507542ENST00000404648DCHS2chr4

155410456

-FGGchr4

155533353

-
intron-3CDSENST00000507542ENST00000405164DCHS2chr4

155410456

-FGGchr4

155533353

-
intron-3CDSENST00000507542ENST00000336098DCHS2chr4

155410456

-FGGchr4

155533353

-
intron-3CDSENST00000507542ENST00000407946DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000456341ENST00000404648DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000456341ENST00000405164DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000456341ENST00000336098DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000456341ENST00000407946DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000443500ENST00000404648DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000443500ENST00000405164DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000443500ENST00000336098DCHS2chr4

155410456

-FGGchr4

155533353

-
In-frameENST00000443500ENST00000407946DCHS2chr4

155410456

-FGGchr4

155533353

-

Top

FusionProtFeatures for DCHS2_FGG


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DCHS2

Q6V1P9

FGG

P02679

Calcium-dependent cell-adhesion protein. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for DCHS2_FGG


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000404648_chr4_155533353_-_1081aa
MSPCGRKMGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGL
PAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELS
PPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWD
GGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEK
EDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVE
LKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVE
NKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKD
TVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNE
KIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDK
FEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQAGDV

>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000405164_chr4_155533353_-_1089aa
MSPCGRKMGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGL
PAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELS
PPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWD
GGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEK
EDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVE
LKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVE
NKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKD
TVQIHDITGKVKVDSPSLDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGT
TEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFS
TWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLG

>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000336098_chr4_155533353_-_1097aa
MSPCGRKMGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGL
PAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELS
PPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWD
GGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEK
EDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVE
LKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVE
NKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKD
TVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNE
KIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDK
FEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQVRPE

>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000407946_chr4_155533353_-_1105aa
MSPCGRKMGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGL
PAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELS
PPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWD
GGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEK
EDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVE
LKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVE
NKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKD
TVQIHDITGKVKVDSPSLDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGT
TEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFS
TWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLG

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000404648_chr4_155533353_-_1074aa
MGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQE
GSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPPGTAFR
LPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRT
GLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEELSGVVRV
WRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGE
LGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKAS
VSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQD
LGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVK
QLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDI
TGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLIST
QSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAE

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000405164_chr4_155533353_-_1082aa
MGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQE
GSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPPGTAFR
LPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRT
GLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEELSGVVRV
WRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGE
LGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKAS
VSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQD
LGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVK
QLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDI
TGKVKVDSPSLDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGN
EKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDND
KFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQAGD

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000336098_chr4_155533353_-_1090aa
MGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQE
GSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPPGTAFR
LPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRT
GLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEELSGVVRV
WRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGE
LGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKAS
VSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQD
LGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVK
QLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDI
TGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLIST
QSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAE
QDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQVRPEHPAETEY

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000407946_chr4_155533353_-_1098aa
MGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGLPAAQQQE
GSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELSPPGTAFR
LPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWDGGRPRRT
GLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEELSGVVRV
WRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEKEDEATGE
LGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFSQQHYKAS
VSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVELKVVAQD
LGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVK
QLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDI
TGKVKVDSPSLDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGN
EKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDND
KFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQVRP

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000404648_chr4_155533353_-_1081aa
MSPCGRKMGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGL
PAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELS
PPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWD
GGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEK
EDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVE
LKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVE
NKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKD
TVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNE
KIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDK
FEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQAGDV

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000405164_chr4_155533353_-_1089aa
MSPCGRKMGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGL
PAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELS
PPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWD
GGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEK
EDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVE
LKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVE
NKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKD
TVQIHDITGKVKVDSPSLDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGT
TEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFS
TWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLG

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000336098_chr4_155533353_-_1097aa
MSPCGRKMGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGL
PAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELS
PPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWD
GGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEK
EDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVE
LKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVE
NKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKD
TVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNE
KIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDK
FEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLGGAKQVRPE

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000407946_chr4_155533353_-_1105aa
MSPCGRKMGEGRQQRRAPVGKLLLLPGRRDTPHGRSGSSGARTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTLVGDIRAGL
PAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHSPRFPLDSLQLDVSELS
PPGTAFRLPVAHDPDAGLFSTQGYTLVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPLDLVLLRRLDREEAAAHRLQIEAWD
GGRPRRTGLLSVELRVLDENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPNGFVRYSVRARQVPGAGSGGGALGDAAYFAVEE
LSGVVRVWRPLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNRPAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADGDWEK
EDEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLCVEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLNDQPPLFS
QQHYKASVSEAAAPGTVVMWVSASDADEAGSDHAWLRYTVVQLSAPCNLGSLQSKMVHTAECGPSFAIDSESGAISTIRTLDREVQEAVE
LKVVAQDLGEPPLSATCLVSITVDDVNDNEPIFWRQVYNATIAEHAPVGHCFLQGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVE
NKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKD
TVQIHDITGKVKVDSPSLDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGT
TEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFS
TWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000404648_chr4_155533353_-_3243nt
ATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGAT
ACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCG
GGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTG
CCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCG
GACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTG
GTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGC
CCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCC
GACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCG
TCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGAC
GGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAG
TACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTC
GTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAG
CTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCC
GAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAG
GGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAG
GAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTG
CTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTG
GCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGC
CAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGC
AGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCA
GAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAG
CTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAG
CCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACT
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAA
AACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCT
GCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAG
GAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGAC
ACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCT
CTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGT
GTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAG
AAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGAC
TATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGAT
GGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAG
TTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGT
GGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAA
ACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGCTGGAGACGTT

>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000405164_chr4_155533353_-_3267nt
ATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGAT
ACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCG
GGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTG
CCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCG
GACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTG
GTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGC
CCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCC
GACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCG
TCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGAC
GGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAG
TACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTC
GTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAG
CTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCC
GAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAG
GGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAG
GAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTG
CTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTG
GCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGC
CAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGC
AGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCA
GAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAG
CTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAG
CCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACT
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAA
AACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCT
GCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAG
GAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGAC
ACGGTGCAAATCCATGATATCACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAG
AGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTG
TTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACA
ACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGG
AATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGT
GGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGT
ACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCAT
CTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAA
ACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGG

>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000336098_chr4_155533353_-_3291nt
ATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGAT
ACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCG
GGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTG
CCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCG
GACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTG
GTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGC
CCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCC
GACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCG
TCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGAC
GGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAG
TACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTC
GTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAG
CTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCC
GAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAG
GGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAG
GAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTG
CTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTG
GCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGC
CAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGC
AGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCA
GAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAG
CTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAG
CCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACT
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAA
AACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCT
GCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAG
GAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGAC
ACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCT
CTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGT
GTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAG
AAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGAC
TATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGAT
GGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAG
TTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGT
GGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAA
ACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGTCAGACCAGAG

>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000407946_chr4_155533353_-_3315nt
ATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGAT
ACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCG
GGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTG
CCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCG
GACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTG
GTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGC
CCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCC
GACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCG
TCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGAC
GGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAG
TACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTC
GTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAG
CTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCC
GAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAG
GGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAG
GAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTG
CTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTG
GCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGC
CAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGC
AGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCA
GAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAG
CTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAG
CCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACT
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAA
AACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCT
GCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAG
GAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGAC
ACGGTGCAAATCCATGATATCACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAG
AGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTG
TTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACA
ACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGG
AATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGT
GGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGT
ACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCAT
CTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAA
ACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGG

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000404648_chr4_155533353_-_3222nt
ATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGC
AGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTC
AACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAG
GGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACT
GCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTC
AACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGC
CTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCA
GGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGAT
CTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACC
GGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAG
GACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCC
CGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTG
TGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTG
CGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCT
GAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAG
CTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGG
GTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCG
CCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCA
GTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGC
TACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCC
ATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGAC
CTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTG
TACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTC
CTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAA
CAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAA
ATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAAT
CAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATC
ACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTC
TTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGG
ATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACA
CAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGA
CCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGAT
CCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAA
CAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCT
ACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCA

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000405164_chr4_155533353_-_3246nt
ATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGC
AGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTC
AACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAG
GGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACT
GCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTC
AACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGC
CTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCA
GGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGAT
CTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACC
GGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAG
GACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCC
CGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTG
TGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTG
CGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCT
GAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAG
CTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGG
GTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCG
CCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCA
GTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGC
TACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCC
ATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGAC
CTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTG
TACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTC
CTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAA
CAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAA
ATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAAT
CAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATC
ACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAA
CCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGC
AGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAAT
GAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCA
GACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTT
GATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGAT
AAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAA
GGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAG
AAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGCTGGAGAC

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000336098_chr4_155533353_-_3270nt
ATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGC
AGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTC
AACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAG
GGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACT
GCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTC
AACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGC
CTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCA
GGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGAT
CTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACC
GGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAG
GACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCC
CGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTG
TGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTG
CGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCT
GAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAG
CTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGG
GTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCG
CCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCA
GTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGC
TACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCC
ATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGAC
CTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTG
TACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTC
CTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAA
CAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAA
ATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAAT
CAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATC
ACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTC
TTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGG
ATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACA
CAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGA
CCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGAT
CCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAA
CAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCT
ACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCA
TTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGTCAGACCAGAGCACCCTGCGGAAACAGAATAT

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000407946_chr4_155533353_-_3294nt
ATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGC
AGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTC
AACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAG
GGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACT
GCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTC
AACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGC
CTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCA
GGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGAT
CTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACC
GGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAG
GACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCC
CGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTG
TGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTG
CGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCT
GAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAG
CTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGG
GTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCG
CCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCA
GTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGC
TACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCC
ATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGAC
CTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTG
TACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTC
CTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAA
CAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAA
ATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAAT
CAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATC
ACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAA
CCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGC
AGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAAT
GAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCA
GACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTT
GATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGAT
AAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAA
GGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAG
AAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGTCAGACCA

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000404648_chr4_155533353_-_3243nt
ATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGAT
ACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCG
GGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTG
CCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCG
GACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTG
GTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGC
CCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCC
GACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCG
TCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGAC
GGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAG
TACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTC
GTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAG
CTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCC
GAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAG
GGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAG
GAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTG
CTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTG
GCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGC
CAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGC
AGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCA
GAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAG
CTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAG
CCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACT
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAA
AACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCT
GCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAG
GAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGAC
ACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCT
CTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGT
GTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAG
AAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGAC
TATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGAT
GGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAG
TTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGT
GGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAA
ACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGCTGGAGACGTT

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000405164_chr4_155533353_-_3267nt
ATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGAT
ACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCG
GGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTG
CCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCG
GACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTG
GTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGC
CCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCC
GACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCG
TCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGAC
GGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAG
TACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTC
GTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAG
CTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCC
GAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAG
GGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAG
GAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTG
CTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTG
GCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGC
CAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGC
AGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCA
GAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAG
CTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAG
CCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACT
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAA
AACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCT
GCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAG
GAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGAC
ACGGTGCAAATCCATGATATCACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAG
AGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTG
TTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACA
ACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGG
AATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGT
GGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGT
ACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCAT
CTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAA
ACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGG

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000336098_chr4_155533353_-_3291nt
ATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGAT
ACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCG
GGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTG
CCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCG
GACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTG
GTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGC
CCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCC
GACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCG
TCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGAC
GGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAG
TACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTC
GTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAG
CTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCC
GAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAG
GGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAG
GAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTG
CTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTG
GCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGC
CAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGC
AGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCA
GAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAG
CTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAG
CCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACT
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAA
AACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCT
GCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAG
GAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGAC
ACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCT
CTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGT
GTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAG
AAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGAC
TATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGAT
GGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAG
TTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGT
GGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAA
ACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGTCAGACCAGAG

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000407946_chr4_155533353_-_3315nt
ATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGAT
ACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCG
GGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTG
CCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCG
GACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTG
GTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGC
CCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCC
GACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCG
TCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGAC
GGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAG
TACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTC
GTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAG
CTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCC
GAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAG
GGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAG
GAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTG
CTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTG
GCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGC
CAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGC
AGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCA
GAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAG
CTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAG
CCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACT
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAA
AACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCT
GCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAG
GAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGAC
ACGGTGCAAATCCATGATATCACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAG
AGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTG
TTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACA
ACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGG
AATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGT
GGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGT
ACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCAT
CTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAA
ACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000404648_chr4_155533353_-_3810nt
AATAATGCACCTGACTTTACCAGGGGGGAACAACCAGCCGAGTAGAACAAGGAACAGATGTAAAGGGAATAAAAGGAGAGAGAAAAAGAG
ATGAGATTCGTTTAAAGAAATCCAGGGGCAGAAGAGGTGGCTGCCGCGGCAGAGGCAGCTAGAGCTTACTTCCCTGTCTGCGTGAGCTGC
AGGCAGAGGACGCTTTCACCAGTTGCAGATGTAACCTCGGGAATTCCTGGGCCGTCGGTTTGTTTGCCAAACAAAGTCTTTTCTTCTCTG
GCTCAGACACTGAAGAGGCTCCTGGATTTTTCTGCGATCCTGCCACAAGCTGGCAGTTACCCGAGAGCCTTCCCAAGGAGCTGGAGGAGA
AATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGA
TACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTC
GGGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCT
GCCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCC
GGACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGT
GGTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAG
CCCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTC
CGACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTC
GTCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGA
CGGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGA
GTACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTT
CGTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGA
GCTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGC
CGAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGA
GGGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAA
GGAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTT
GCTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGT
GGCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAG
CCAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGG
CAGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGC
AGAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGA
GCTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGA
GCCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAAC
TACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGA
AAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGC
TGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCA
GGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGA
CACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACC
TCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAG
TGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGA
GAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGA
CTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGA
TGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAA
GTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGG
TGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAA
AACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGCTGGAGACGT
TTAAAAGACCGTTTCAAAAGAGATTTACTTTTTTAAAGGACTTTATCTGAACAGAGAGATATAATATTTTTCCTATTGGACAATGGACTT
GCAAAGCTTCACTTCATTTTAAGAGCAAAAGACCCCATGTTGAAAACTCCATAACAGTTTTATGCTGATGATAATTTATCTACATGCATT

>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000405164_chr4_155533353_-_3795nt
AATAATGCACCTGACTTTACCAGGGGGGAACAACCAGCCGAGTAGAACAAGGAACAGATGTAAAGGGAATAAAAGGAGAGAGAAAAAGAG
ATGAGATTCGTTTAAAGAAATCCAGGGGCAGAAGAGGTGGCTGCCGCGGCAGAGGCAGCTAGAGCTTACTTCCCTGTCTGCGTGAGCTGC
AGGCAGAGGACGCTTTCACCAGTTGCAGATGTAACCTCGGGAATTCCTGGGCCGTCGGTTTGTTTGCCAAACAAAGTCTTTTCTTCTCTG
GCTCAGACACTGAAGAGGCTCCTGGATTTTTCTGCGATCCTGCCACAAGCTGGCAGTTACCCGAGAGCCTTCCCAAGGAGCTGGAGGAGA
AATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGA
TACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTC
GGGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCT
GCCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCC
GGACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGT
GGTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAG
CCCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTC
CGACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTC
GTCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGA
CGGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGA
GTACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTT
CGTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGA
GCTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGC
CGAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGA
GGGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAA
GGAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTT
GCTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGT
GGCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAG
CCAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGG
CAGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGC
AGAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGA
GCTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGA
GCCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAAC
TACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGA
AAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGC
TGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCA
GGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGA
CACGGTGCAAATCCATGATATCACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACA
GAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGT
GTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCAC
AACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTG
GAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGG
TGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAG
TACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCA
TCTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAA
AACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGG
GGGAGCCAAACAGGCTGGAGACGTTTAAAAGACCGTTTCAAAAGAGATTTACTTTTTTAAAGGACTTTATCTGAACAGAGAGATATAATA
TTTTTCCTATTGGACAATGGACTTGCAAAGCTTCACTTCATTTTAAGAGCAAAAGACCCCATGTTGAAAACTCCATAACAGTTTTATGCT

>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000336098_chr4_155533353_-_3910nt
AATAATGCACCTGACTTTACCAGGGGGGAACAACCAGCCGAGTAGAACAAGGAACAGATGTAAAGGGAATAAAAGGAGAGAGAAAAAGAG
ATGAGATTCGTTTAAAGAAATCCAGGGGCAGAAGAGGTGGCTGCCGCGGCAGAGGCAGCTAGAGCTTACTTCCCTGTCTGCGTGAGCTGC
AGGCAGAGGACGCTTTCACCAGTTGCAGATGTAACCTCGGGAATTCCTGGGCCGTCGGTTTGTTTGCCAAACAAAGTCTTTTCTTCTCTG
GCTCAGACACTGAAGAGGCTCCTGGATTTTTCTGCGATCCTGCCACAAGCTGGCAGTTACCCGAGAGCCTTCCCAAGGAGCTGGAGGAGA
AATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGA
TACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTC
GGGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCT
GCCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCC
GGACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGT
GGTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAG
CCCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTC
CGACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTC
GTCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGA
CGGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGA
GTACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTT
CGTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGA
GCTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGC
CGAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGA
GGGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAA
GGAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTT
GCTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGT
GGCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAG
CCAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGG
CAGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGC
AGAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGA
GCTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGA
GCCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAAC
TACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGA
AAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGC
TGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCA
GGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGA
CACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACC
TCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAG
TGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGA
GAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGA
CTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGA
TGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAA
GTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGG
TGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAA
AACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGTCAGACCAGA
GCACCCTGCGGAAACAGAATATGACTCACTTTACCCTGAGGATGATTTGTAGAAAATTAACTGCTAACTTCTATTGACCCACAAAGTTTC
AGAAATTCTCTGAAAGTTTCTTCCTTTTTTCTCTTACTATATTTATTGATTTCAAGTCTTCTATTAAGGACATTTAGCCTTCAATGGAAA
TTAAAACTCATTTAGGACTGTATTTCCAAATTACTGATATCAGAGTTATTTAAAAATTGTTTATTTGAGGAGATAACATTTCAACTTTGT

>In-frame_DCHS2_ENST00000339452_chr4_155410456_-_FGG_ENST00000407946_chr4_155533353_-_3900nt
AATAATGCACCTGACTTTACCAGGGGGGAACAACCAGCCGAGTAGAACAAGGAACAGATGTAAAGGGAATAAAAGGAGAGAGAAAAAGAG
ATGAGATTCGTTTAAAGAAATCCAGGGGCAGAAGAGGTGGCTGCCGCGGCAGAGGCAGCTAGAGCTTACTTCCCTGTCTGCGTGAGCTGC
AGGCAGAGGACGCTTTCACCAGTTGCAGATGTAACCTCGGGAATTCCTGGGCCGTCGGTTTGTTTGCCAAACAAAGTCTTTTCTTCTCTG
GCTCAGACACTGAAGAGGCTCCTGGATTTTTCTGCGATCCTGCCACAAGCTGGCAGTTACCCGAGAGCCTTCCCAAGGAGCTGGAGGAGA
AATGAGCCCTTGTGGGCGGAAGATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGA
TACACCCCATGGGCGGTCAGGCAGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTC
GGGCTCCTCTGCCCAGTTGTTCAACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCT
GCCGGCCGCGCAGCAGCAGGAGGGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCC
GGACACCGGCATCATCCGCACTGCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGT
GGTGCAGGTGGAGATTCGCGTCAACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAG
CCCGCCAGGGACCGCCTTCCGCCTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTC
CGACCTGCCCAAGGACCCCGCAGGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTC
GTCACCCCTGGAGCCTCTAGATCTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGA
CGGCGGCCGACCCCGGCGCACCGGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGA
GTACCGCGCCGCGGTGCGCGAGGACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTT
CGTGCGCTACAGCGTCCGCGCCCGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGA
GCTGAGCGGCGTGGTGCGAGTGTGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGC
CGAGCCTGAGGTTGCCACGGTGCGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGA
GGGAGGCGTCGCCCGTGTCTCTGAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAA
GGAAGATGAGGCCACAGGGGAGCTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTT
GCTACCCGGCGGCCCCCCAGGGGTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGT
GGCCACGGACGCGGGGTCCCCGCCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAG
CCAACAGCATTACAAGGCCTCAGTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGG
CAGTGATCACGCCTGGCTGCGCTACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGC
AGAGTGTGGACCATCTTTTGCCATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGA
GCTGAAAGTGGTGGCCCAGGACCTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGA
GCCCATCTTCTGGAGGCAGGTGTACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAAC
TACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGA
AAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGC
TGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCA
GGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGA
CACGGTGCAAATCCATGATATCACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACA
GAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGT
GTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCAC
AACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTG
GAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGG
TGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAG
TACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCA
TCTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAA
AACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGG
GGGAGCCAAACAGGTCAGACCAGAGCACCCTGCGGAAACAGAATATGACTCACTTTACCCTGAGGATGATTTGTAGAAAATTAACTGCTA
ACTTCTATTGACCCACAAAGTTTCAGAAATTCTCTGAAAGTTTCTTCCTTTTTTCTCTTACTATATTTATTGATTTCAAGTCTTCTATTA
AGGACATTTAGCCTTCAATGGAAATTAAAACTCATTTAGGACTGTATTTCCAAATTACTGATATCAGAGTTATTTAAAAATTGTTTATTT

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000404648_chr4_155533353_-_3428nt
ATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGC
AGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTC
AACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAG
GGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACT
GCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTC
AACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGC
CTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCA
GGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGAT
CTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACC
GGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAG
GACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCC
CGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTG
TGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTG
CGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCT
GAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAG
CTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGG
GTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCG
CCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCA
GTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGC
TACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCC
ATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGAC
CTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTG
TACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTC
CTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAA
CAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAA
ATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAAT
CAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATC
ACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTC
TTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGG
ATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACA
CAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGA
CCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGAT
CCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAA
CAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCT
ACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCA
TTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGCTGGAGACGTTTAAAAGACCGTTTCAAAAGAG
ATTTACTTTTTTAAAGGACTTTATCTGAACAGAGAGATATAATATTTTTCCTATTGGACAATGGACTTGCAAAGCTTCACTTCATTTTAA
GAGCAAAAGACCCCATGTTGAAAACTCCATAACAGTTTTATGCTGATGATAATTTATCTACATGCATTTCAATAAACCTTTTGTTTCCTA

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000405164_chr4_155533353_-_3413nt
ATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGC
AGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTC
AACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAG
GGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACT
GCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTC
AACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGC
CTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCA
GGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGAT
CTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACC
GGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAG
GACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCC
CGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTG
TGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTG
CGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCT
GAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAG
CTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGG
GTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCG
CCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCA
GTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGC
TACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCC
ATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGAC
CTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTG
TACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTC
CTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAA
CAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAA
ATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAAT
CAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATC
ACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAA
CCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGC
AGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAAT
GAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCA
GACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTT
GATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGAT
AAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAA
GGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAG
AAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGCTGGAGAC
GTTTAAAAGACCGTTTCAAAAGAGATTTACTTTTTTAAAGGACTTTATCTGAACAGAGAGATATAATATTTTTCCTATTGGACAATGGAC

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000336098_chr4_155533353_-_3528nt
ATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGC
AGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTC
AACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAG
GGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACT
GCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTC
AACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGC
CTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCA
GGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGAT
CTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACC
GGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAG
GACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCC
CGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTG
TGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTG
CGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCT
GAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAG
CTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGG
GTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCG
CCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCA
GTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGC
TACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCC
ATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGAC
CTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTG
TACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTC
CTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAA
CAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAA
ATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAAT
CAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATC
ACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTC
TTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGG
ATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACA
CAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGA
CCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGAT
CCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAA
CAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCT
ACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCA
TTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGTCAGACCAGAGCACCCTGCGGAAACAGAATAT
GACTCACTTTACCCTGAGGATGATTTGTAGAAAATTAACTGCTAACTTCTATTGACCCACAAAGTTTCAGAAATTCTCTGAAAGTTTCTT
CCTTTTTTCTCTTACTATATTTATTGATTTCAAGTCTTCTATTAAGGACATTTAGCCTTCAATGGAAATTAAAACTCATTTAGGACTGTA
TTTCCAAATTACTGATATCAGAGTTATTTAAAAATTGTTTATTTGAGGAGATAACATTTCAACTTTGTTCCTAAATATATAATAATAAAA

>In-frame_DCHS2_ENST00000456341_chr4_155410456_-_FGG_ENST00000407946_chr4_155533353_-_3518nt
ATGGGCGAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGC
AGCAGCGGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTC
AACCTCACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAG
GGGAGCGGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACT
GCGCGGCGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTC
AACGACGTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGC
CTGCCAGTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCA
GGCCCGTTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGAT
CTGGTGCTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACC
GGCCTCCTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAG
GACGCCCAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCC
CGGCAAGTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTG
TGGAGACCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTG
CGCGTGTCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCT
GAAGGCGCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAG
CTTGGTGTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGG
GTATTTTTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCG
CCGCTGAGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCA
GTGTCCGAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGC
TACACTGTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCC
ATTGATTCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGAC
CTCGGAGAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTG
TACAATGCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTC
CTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAA
CAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAA
ATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAAT
CAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATC
ACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAA
CCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGC
AGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAAT
GAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCA
GACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTT
GATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGAT
AAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAA
GGTGGCACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAG
AAAACCACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGTCAGACCA
GAGCACCCTGCGGAAACAGAATATGACTCACTTTACCCTGAGGATGATTTGTAGAAAATTAACTGCTAACTTCTATTGACCCACAAAGTT
TCAGAAATTCTCTGAAAGTTTCTTCCTTTTTTCTCTTACTATATTTATTGATTTCAAGTCTTCTATTAAGGACATTTAGCCTTCAATGGA
AATTAAAACTCATTTAGGACTGTATTTCCAAATTACTGATATCAGAGTTATTTAAAAATTGTTTATTTGAGGAGATAACATTTCAACTTT

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000404648_chr4_155533353_-_3872nt
AGATCCCCATCCTCTCCTTGTGTGTGCGCGCTTCATATAATCTCCTCCTTTTTGGCAAAAGAAATAATGCACCTGACTTTACCAGGGGGG
AACAACCAGCCGAGTAGAACAAGGAACAGATGTAAAGGGAATAAAAGGAGAGAGAAAAAGAGATGAGATTCGTTTAAAGAAATCCAGGGG
CAGAAGAGGTGGCTGCCGCGGCAGAGGCAGCTAGAGCTTACTTCCCTGTCTGCGTGAGCTGCAGGCAGAGGACGCTTTCACCAGTTGCAG
ATGTAACCTCGGGAATTCCTGGGCCGTCGGTTTGTTTGCCAAACAAAGTCTTTTCTTCTCTGGCTCAGACACTGAAGAGGCTCCTGGATT
TTTCTGCGATCCTGCCACAAGCTGGCAGTTACCCGAGAGCCTTCCCAAGGAGCTGGAGGAGAAATGAGCCCTTGTGGGCGGAAGATGGGC
GAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGCAGCAGC
GGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTCAACCTC
ACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAGGGGAGC
GGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACTGCGCGG
CGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTCAACGAC
GTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGCCTGCCA
GTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCAGGCCCG
TTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGATCTGGTG
CTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACCGGCCTC
CTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAGGACGCC
CAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCCCGGCAA
GTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTGTGGAGA
CCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTGCGCGTG
TCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCTGAAGGC
GCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAGCTTGGT
GTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGGGTATTT
TTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCGCCGCTG
AGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCAGTGTCC
GAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGCTACACT
GTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCCATTGAT
TCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGACCTCGGA
GAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTGTACAAT
GCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCT
ACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTG
ATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTA
GAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAG
ATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGG
AAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTC
TACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAA
TATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCT
GCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAA
GCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGT
GACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGAT
GGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCTACTCCT
AATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCATTCAAC
AGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGCTGGAGACGTTTAAAAGACCGTTTCAAAAGAGATTTAC
TTTTTTAAAGGACTTTATCTGAACAGAGAGATATAATATTTTTCCTATTGGACAATGGACTTGCAAAGCTTCACTTCATTTTAAGAGCAA
AAGACCCCATGTTGAAAACTCCATAACAGTTTTATGCTGATGATAATTTATCTACATGCATTTCAATAAACCTTTTGTTTCCTAAGACTA

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000405164_chr4_155533353_-_3857nt
AGATCCCCATCCTCTCCTTGTGTGTGCGCGCTTCATATAATCTCCTCCTTTTTGGCAAAAGAAATAATGCACCTGACTTTACCAGGGGGG
AACAACCAGCCGAGTAGAACAAGGAACAGATGTAAAGGGAATAAAAGGAGAGAGAAAAAGAGATGAGATTCGTTTAAAGAAATCCAGGGG
CAGAAGAGGTGGCTGCCGCGGCAGAGGCAGCTAGAGCTTACTTCCCTGTCTGCGTGAGCTGCAGGCAGAGGACGCTTTCACCAGTTGCAG
ATGTAACCTCGGGAATTCCTGGGCCGTCGGTTTGTTTGCCAAACAAAGTCTTTTCTTCTCTGGCTCAGACACTGAAGAGGCTCCTGGATT
TTTCTGCGATCCTGCCACAAGCTGGCAGTTACCCGAGAGCCTTCCCAAGGAGCTGGAGGAGAAATGAGCCCTTGTGGGCGGAAGATGGGC
GAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGCAGCAGC
GGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTCAACCTC
ACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAGGGGAGC
GGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACTGCGCGG
CGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTCAACGAC
GTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGCCTGCCA
GTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCAGGCCCG
TTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGATCTGGTG
CTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACCGGCCTC
CTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAGGACGCC
CAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCCCGGCAA
GTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTGTGGAGA
CCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTGCGCGTG
TCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCTGAAGGC
GCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAGCTTGGT
GTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGGGTATTT
TTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCGCCGCTG
AGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCAGTGTCC
GAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGCTACACT
GTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCCATTGAT
TCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGACCTCGGA
GAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTGTACAAT
GCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCT
ACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTG
ATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTA
GAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAG
ATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGG
AAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTG
AAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTA
GATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAG
ATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTAT
GCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGC
TTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTT
GAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGTGGC
ACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAAACC
ACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGCTGGAGACGTTTAA
AAGACCGTTTCAAAAGAGATTTACTTTTTTAAAGGACTTTATCTGAACAGAGAGATATAATATTTTTCCTATTGGACAATGGACTTGCAA

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000336098_chr4_155533353_-_3972nt
AGATCCCCATCCTCTCCTTGTGTGTGCGCGCTTCATATAATCTCCTCCTTTTTGGCAAAAGAAATAATGCACCTGACTTTACCAGGGGGG
AACAACCAGCCGAGTAGAACAAGGAACAGATGTAAAGGGAATAAAAGGAGAGAGAAAAAGAGATGAGATTCGTTTAAAGAAATCCAGGGG
CAGAAGAGGTGGCTGCCGCGGCAGAGGCAGCTAGAGCTTACTTCCCTGTCTGCGTGAGCTGCAGGCAGAGGACGCTTTCACCAGTTGCAG
ATGTAACCTCGGGAATTCCTGGGCCGTCGGTTTGTTTGCCAAACAAAGTCTTTTCTTCTCTGGCTCAGACACTGAAGAGGCTCCTGGATT
TTTCTGCGATCCTGCCACAAGCTGGCAGTTACCCGAGAGCCTTCCCAAGGAGCTGGAGGAGAAATGAGCCCTTGTGGGCGGAAGATGGGC
GAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGCAGCAGC
GGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTCAACCTC
ACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAGGGGAGC
GGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACTGCGCGG
CGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTCAACGAC
GTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGCCTGCCA
GTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCAGGCCCG
TTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGATCTGGTG
CTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACCGGCCTC
CTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAGGACGCC
CAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCCCGGCAA
GTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTGTGGAGA
CCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTGCGCGTG
TCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCTGAAGGC
GCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAGCTTGGT
GTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGGGTATTT
TTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCGCCGCTG
AGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCAGTGTCC
GAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGCTACACT
GTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCCATTGAT
TCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGACCTCGGA
GAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTGTACAAT
GCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCT
ACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTG
ATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTA
GAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAG
ATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGG
AAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTC
TACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAA
TATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCT
GCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAA
GCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGT
GACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGAT
GGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGTGGCACTTACTCAAAAGCATCTACTCCT
AATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAAACCACTATGAAGATAATCCCATTCAAC
AGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGTCAGACCAGAGCACCCTGCGGAAACAGAATATGACTCA
CTTTACCCTGAGGATGATTTGTAGAAAATTAACTGCTAACTTCTATTGACCCACAAAGTTTCAGAAATTCTCTGAAAGTTTCTTCCTTTT
TTCTCTTACTATATTTATTGATTTCAAGTCTTCTATTAAGGACATTTAGCCTTCAATGGAAATTAAAACTCATTTAGGACTGTATTTCCA
AATTACTGATATCAGAGTTATTTAAAAATTGTTTATTTGAGGAGATAACATTTCAACTTTGTTCCTAAATATATAATAATAAAATGATTG

>In-frame_DCHS2_ENST00000443500_chr4_155410456_-_FGG_ENST00000407946_chr4_155533353_-_3962nt
AGATCCCCATCCTCTCCTTGTGTGTGCGCGCTTCATATAATCTCCTCCTTTTTGGCAAAAGAAATAATGCACCTGACTTTACCAGGGGGG
AACAACCAGCCGAGTAGAACAAGGAACAGATGTAAAGGGAATAAAAGGAGAGAGAAAAAGAGATGAGATTCGTTTAAAGAAATCCAGGGG
CAGAAGAGGTGGCTGCCGCGGCAGAGGCAGCTAGAGCTTACTTCCCTGTCTGCGTGAGCTGCAGGCAGAGGACGCTTTCACCAGTTGCAG
ATGTAACCTCGGGAATTCCTGGGCCGTCGGTTTGTTTGCCAAACAAAGTCTTTTCTTCTCTGGCTCAGACACTGAAGAGGCTCCTGGATT
TTTCTGCGATCCTGCCACAAGCTGGCAGTTACCCGAGAGCCTTCCCAAGGAGCTGGAGGAGAAATGAGCCCTTGTGGGCGGAAGATGGGC
GAAGGGCGTCAGCAGCGGCGGGCTCCGGTCGGGAAGCTCCTTCTGCTCCCCGGGAGGAGAGATACACCCCATGGGCGGTCAGGCAGCAGC
GGCGCCAGGACGCAGCGCTCCCTGCTCTGGCTCTTGGTGCACGTGTGGCTGTGGGCGGCCTCGGGCTCCTCTGCCCAGTTGTTCAACCTC
ACCCTTTCCGTAGATGAGGGGCTTCCCCCGGACACGCTGGTAGGTGACATCCGCGCCGGGCTGCCGGCCGCGCAGCAGCAGGAGGGGAGC
GGCTTCTTTCTGTCGGAGGACTCCGATGACTCCCCGCTGCTGGACGACTTCCACGTGCACCCGGACACCGGCATCATCCGCACTGCGCGG
CGCCTGGACCGCGAGCGGCGGGACCACTACAGCTTCGTCGCCGCCACGCTGCTGGGCGCTGTGGTGCAGGTGGAGATTCGCGTCAACGAC
GTGAATGACCACTCGCCCCGCTTTCCCCTCGACTCCCTGCAACTCGACGTCTCCGAGCTCAGCCCGCCAGGGACCGCCTTCCGCCTGCCA
GTTGCCCACGATCCGGACGCCGGACTGTTCAGCACTCAGGGCTACACCCTGGTGCAACCGTCCGACCTGCCCAAGGACCCCGCAGGCCCG
TTCTTCCAGTTGCGCTACCGGACTCCGGGGCCACTACCGTCACCGCTTTTGCCAGGCTCCTCGTCACCCCTGGAGCCTCTAGATCTGGTG
CTGCTGCGGCGCTTGGACCGAGAGGAGGCGGCGGCGCACCGGCTGCAGATCGAGGCATGGGACGGCGGCCGACCCCGGCGCACCGGCCTC
CTGAGCGTGGAGCTGCGCGTGCTGGATGAGAACGACAACCCGCCGGTCTTTGAGCAGGACGAGTACCGCGCCGCGGTGCGCGAGGACGCC
CAGCCGGGCGCCGAGGTCTGTCGCGTGCGCGCCACCGACCGCGACCTGGGGCCCAATGGCTTCGTGCGCTACAGCGTCCGCGCCCGGCAA
GTGCCTGGGGCGGGTAGCGGCGGCGGGGCACTGGGCGACGCGGCCTACTTCGCGGTGGAGGAGCTGAGCGGCGTGGTGCGAGTGTGGAGA
CCTCTGGACCGCGAGGCACAGGCCTGGCACCAGTTGGTGGTGGAGGCCCGCGATGGAGGCGCCGAGCCTGAGGTTGCCACGGTGCGCGTG
TCCATCGCCGTGCTGGACGTGAATGACAACCGGCCAGCAATTCACGTGCTCTTTCTCACAGAGGGAGGCGTCGCCCGTGTCTCTGAAGGC
GCCCGACCGGGCGACTACGTGGCTCGCGTCTCGGTGTCTGACGCGGACGGTGACTGGGAGAAGGAAGATGAGGCCACAGGGGAGCTTGGT
GTGGGTCTTGGAGACGGGAGCATCTCTCTGTCCTTGGAAGGCGGAGAGGGAGACTTCGCGTTGCTACCCGGCGGCCCCCCAGGGGTATTT
TTCCTTTGCGTGGAGGGGCCCCTGGACAGAGAGAGCCGCGATCTGTATGAGTTACTACTGGTGGCCACGGACGCGGGGTCCCCGCCGCTG
AGCACGGAGGAGACGCTGCTACTCCGGGTCGCTGACCTCAATGACCAACCACCTCTCTTCAGCCAACAGCATTACAAGGCCTCAGTGTCC
GAGGCCGCGGCCCCTGGCACTGTAGTCATGTGGGTCAGCGCCTCCGATGCCGACGAGGCAGGCAGTGATCACGCCTGGCTGCGCTACACT
GTAGTCCAACTCTCGGCTCCCTGCAATCTCGGCTCCCTGCAATCAAAGATGGTCCACACCGCAGAGTGTGGACCATCTTTTGCCATTGAT
TCCGAAAGCGGTGCGATCAGCACTATCCGGACTCTAGACCGAGAGGTCCAGGAGGCGGTGGAGCTGAAAGTGGTGGCCCAGGACCTCGGA
GAGCCCCCACTCTCTGCCACCTGCCTGGTGAGCATCACCGTAGATGATGTGAATGACAATGAGCCCATCTTCTGGAGGCAGGTGTACAAT
GCCACCATTGCAGAGCATGCCCCGGTTGGACACTGCTTTCTGCAGGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCT
ACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTG
ATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTA
GAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAG
ATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGG
AAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTG
AAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTA
GATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAG
ATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTAT
GCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGC
TTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTT
GAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGGTGGC
ACTTACTCAAAAGCATCTACTCCTAATGGTTATGATAATGGCATTATTTGGGCCACTTGGAAAACCCGGTGGTATTCCATGAAGAAAACC
ACTATGAAGATAATCCCATTCAACAGACTCACAATTGGAGAAGGACAGCAACACCACCTGGGGGGAGCCAAACAGGTCAGACCAGAGCAC
CCTGCGGAAACAGAATATGACTCACTTTACCCTGAGGATGATTTGTAGAAAATTAACTGCTAACTTCTATTGACCCACAAAGTTTCAGAA
ATTCTCTGAAAGTTTCTTCCTTTTTTCTCTTACTATATTTATTGATTTCAAGTCTTCTATTAAGGACATTTAGCCTTCAATGGAAATTAA
AACTCATTTAGGACTGTATTTCCAAATTACTGATATCAGAGTTATTTAAAAATTGTTTATTTGAGGAGATAACATTTCAACTTTGTTCCT


Top

FusionGenePPI for DCHS2_FGG


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DCHS2COPS5FGGFGA, FGB, F13B, FGG, KHDRBS2, VKORC1, FN1, ASB6, ASB7, ASB12, CA8, ASCC1, DDX19B, ALDH2, CHD9, NUP93, ICAM1, HIST1H2BJ, MAPK6, RING1, SNX27, CDK15, CCNYL1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DCHS2_FGG


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneFGGP02679DB00364SucralfateFibrinogen gamma chainsmall moleculeapproved

Top

RelatedDiseases for DCHS2_FGG


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneFGGC0272350Dysfibrinogenemia, Congenital7ORPHANET;UNIPROT
TgeneFGGC0022548Keloid1CTD_human
TgeneFGGC0038356Stomach Neoplasms1CTD_human
TgeneFGGC2584774Congenital hypofibrinogenemia1ORPHANET;UNIPROT