FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9299

FusionGeneSummary for DAPP1_SLC4A4

check button Fusion gene summary
Fusion gene informationFusion gene name: DAPP1_SLC4A4
Fusion gene ID: 9299
HgeneTgene
Gene symbol

DAPP1

SLC4A4

Gene ID

27071

8671

Gene namedual adaptor of phosphotyrosine and 3-phosphoinositides 1solute carrier family 4 member 4
SynonymsBAM32HNBC1|KNBC|NBC1|NBC2|NBCe1-A|SLC4A5|hhNMC|kNBC1|pNBC
Cytomap

4q23

4q13.3

Type of geneprotein-codingprotein-coding
Descriptiondual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositideB-cell adapter molecule of 32 kDab lymphocyte adapter protein Bam32hDAPP1electrogenic sodium bicarbonate cotransporter 1Na(+)/HCO3(-) cotransportersodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney; sodium bicarbonate cotransporter, pancreas)solute carrier family 4 (sodium bicarbonate cotransporter
Modification date2018052320180523
UniProtAcc

Q9UN19

Q9Y6R1

Ensembl transtripts involved in fusion geneENST00000296414, ENST00000512369, 
ENST00000264485, ENST00000425175, 
ENST00000351898, ENST00000340595, 
ENST00000514331, ENST00000512686, 
Fusion gene scores* DoF score2 X 2 X 2=810 X 8 X 5=400
# samples 211
** MAII scorelog2(2/8*10)=1.32192809488736log2(11/400*10)=-1.86249647625006
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DAPP1 [Title/Abstract] AND SLC4A4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSLC4A4

GO:0006814

sodium ion transport

16769890


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-85-8070-01ADAPP1chr4

100774505

+SLC4A4chr4

72399944

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000296414ENST00000264485DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
In-frameENST00000296414ENST00000425175DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
In-frameENST00000296414ENST00000351898DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
In-frameENST00000296414ENST00000340595DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
5CDS-intronENST00000296414ENST00000514331DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
5CDS-intronENST00000296414ENST00000512686DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
In-frameENST00000512369ENST00000264485DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
In-frameENST00000512369ENST00000425175DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
In-frameENST00000512369ENST00000351898DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
In-frameENST00000512369ENST00000340595DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
5CDS-intronENST00000512369ENST00000514331DAPP1chr4

100774505

+SLC4A4chr4

72399944

+
5CDS-intronENST00000512369ENST00000512686DAPP1chr4

100774505

+SLC4A4chr4

72399944

+

Top

FusionProtFeatures for DAPP1_SLC4A4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DAPP1

Q9UN19

SLC4A4

Q9Y6R1

May act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.{ECO:0000269|PubMed:10770799}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDAPP1chr4:100774505chr4:72399944ENST00000512369+4935_129163281DomainSH2
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+16261009_10247601684Compositional biasNote=Lys-rich
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+13231009_10247162318Compositional biasNote=Lys-rich
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+16241009_10247601194Compositional biasNote=Lys-rich
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+16251009_10247601095Compositional biasNote=Lys-rich
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+0111009_1024-66647Compositional biasNote=Lys-rich
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626961_9867601684IntramembraneDiscontinuously helical
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323961_9867162318IntramembraneDiscontinuously helical
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624961_9867601194IntramembraneDiscontinuously helical
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625961_9867601095IntramembraneDiscontinuously helical
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011961_986-66647IntramembraneDiscontinuously helical
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+16261002_10047601684RegionNote=CA2-binding
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+16261057_10597601684RegionNote=Required for basolateral targeting
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+13231002_10047162318RegionNote=CA2-binding
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+13231057_10597162318RegionNote=Required for basolateral targeting
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+16241002_10047601194RegionNote=CA2-binding
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+16241057_10597601194RegionNote=Required for basolateral targeting
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+16251002_10047601095RegionNote=CA2-binding
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+16251057_10597601095RegionNote=Required for basolateral targeting
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+0111002_1004-66647RegionNote=CA2-binding
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+0111057_1059-66647RegionNote=Required for basolateral targeting
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626808_8197601684Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626837_8377601684Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626856_8777601684Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626895_9017601684Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626919_9607601684Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626987_10797601684Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323746_7797162318Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323808_8197162318Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323837_8377162318Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323856_8777162318Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323895_9017162318Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323919_9607162318Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323987_10797162318Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624808_8197601194Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624837_8377601194Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624856_8777601194Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624895_9017601194Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624919_9607601194Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624987_10797601194Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625808_8197601095Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625837_8377601095Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625856_8777601095Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625895_9017601095Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625919_9607601095Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625987_10797601095Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+0111_466-66647Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011492_501-66647Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011521_521-66647Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011543_550-66647Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011572_585-66647Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011610_692-66647Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011711_725-66647Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011746_779-66647Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011808_819-66647Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011837_837-66647Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011856_877-66647Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011895_901-66647Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011919_960-66647Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011987_1079-66647Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626780_8077601684TransmembraneHelical%3B Name%3D8
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626820_8367601684TransmembraneHelical%3B Name%3D9
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626838_8557601684TransmembraneDiscontinuously helical%3B Name%3D10
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626878_8947601684TransmembraneHelical%3B Name%3D11
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626902_9187601684TransmembraneHelical%3B Name%3D12
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323726_7457162318TransmembraneHelical%3B Name%3D7
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323780_8077162318TransmembraneHelical%3B Name%3D8
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323820_8367162318TransmembraneHelical%3B Name%3D9
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323838_8557162318TransmembraneDiscontinuously helical%3B Name%3D10
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323878_8947162318TransmembraneHelical%3B Name%3D11
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323902_9187162318TransmembraneHelical%3B Name%3D12
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624780_8077601194TransmembraneHelical%3B Name%3D8
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624820_8367601194TransmembraneHelical%3B Name%3D9
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624838_8557601194TransmembraneDiscontinuously helical%3B Name%3D10
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624878_8947601194TransmembraneHelical%3B Name%3D11
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624902_9187601194TransmembraneHelical%3B Name%3D12
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625780_8077601095TransmembraneHelical%3B Name%3D8
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625820_8367601095TransmembraneHelical%3B Name%3D9
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625838_8557601095TransmembraneDiscontinuously helical%3B Name%3D10
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625878_8947601095TransmembraneHelical%3B Name%3D11
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625902_9187601095TransmembraneHelical%3B Name%3D12
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011467_491-66647TransmembraneHelical%3B Name%3D1
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011502_520-66647TransmembraneHelical%3B Name%3D2
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011522_542-66647TransmembraneDiscontinuously helical%3B Name%3D3
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011551_571-66647TransmembraneHelical%3B Name%3D4
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011586_609-66647TransmembraneHelical%3B Name%3D5
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011693_710-66647TransmembraneHelical%3B Name%3D6
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011726_745-66647TransmembraneHelical%3B Name%3D7
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011780_807-66647TransmembraneHelical%3B Name%3D8
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011820_836-66647TransmembraneHelical%3B Name%3D9
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011838_855-66647TransmembraneDiscontinuously helical%3B Name%3D10
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011878_894-66647TransmembraneHelical%3B Name%3D11
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011902_918-66647TransmembraneHelical%3B Name%3D12

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDAPP1chr4:100774505chr4:72399944ENST00000512369+49164_259163281DomainPH
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+16261_4667601684Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626492_5017601684Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626521_5217601684Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626543_5507601684Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626572_5857601684Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626610_6927601684Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626711_7257601684Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626746_7797601684Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+13231_4667162318Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323492_5017162318Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323521_5217162318Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323543_5507162318Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323572_5857162318Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323610_6927162318Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323711_7257162318Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+16241_4667601194Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624492_5017601194Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624521_5217601194Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624543_5507601194Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624572_5857601194Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624610_6927601194Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624711_7257601194Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624746_7797601194Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+16251_4667601095Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625492_5017601095Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625521_5217601095Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625543_5507601095Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625572_5857601095Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625610_6927601095Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625711_7257601095Topological domainCytoplasmic
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625746_7797601095Topological domainExtracellular
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626467_4917601684TransmembraneHelical%3B Name%3D1
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626502_5207601684TransmembraneHelical%3B Name%3D2
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626522_5427601684TransmembraneDiscontinuously helical%3B Name%3D3
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626551_5717601684TransmembraneHelical%3B Name%3D4
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626586_6097601684TransmembraneHelical%3B Name%3D5
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626693_7107601684TransmembraneHelical%3B Name%3D6
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626726_7457601684TransmembraneHelical%3B Name%3D7
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323467_4917162318TransmembraneHelical%3B Name%3D1
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323502_5207162318TransmembraneHelical%3B Name%3D2
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323522_5427162318TransmembraneDiscontinuously helical%3B Name%3D3
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323551_5717162318TransmembraneHelical%3B Name%3D4
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323586_6097162318TransmembraneHelical%3B Name%3D5
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323693_7107162318TransmembraneHelical%3B Name%3D6
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624467_4917601194TransmembraneHelical%3B Name%3D1
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624502_5207601194TransmembraneHelical%3B Name%3D2
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624522_5427601194TransmembraneDiscontinuously helical%3B Name%3D3
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624551_5717601194TransmembraneHelical%3B Name%3D4
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624586_6097601194TransmembraneHelical%3B Name%3D5
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624693_7107601194TransmembraneHelical%3B Name%3D6
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624726_7457601194TransmembraneHelical%3B Name%3D7
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625467_4917601095TransmembraneHelical%3B Name%3D1
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625502_5207601095TransmembraneHelical%3B Name%3D2
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625522_5427601095TransmembraneDiscontinuously helical%3B Name%3D3
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625551_5717601095TransmembraneHelical%3B Name%3D4
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625586_6097601095TransmembraneHelical%3B Name%3D5
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625693_7107601095TransmembraneHelical%3B Name%3D6
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625726_7457601095TransmembraneHelical%3B Name%3D7


Top

FusionGeneSequence for DAPP1_SLC4A4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000264485_chr4_72399944_+_483aa
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWTHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVETTGT
SFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSITESVRVHTAMQTGRTEDDLVPTAPSPTSPNRGWFVPPFGENP
WWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGTHLDLFWVAILMVICSLMALPWTVAATVISIAHIDSLKMETETSAPGEQ
PKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLTGVFLTMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQ
VLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKI

>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000425175_chr4_72399944_+_498aa
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWTHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVETTGT
SFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSITESVRVHTAMQTGRTEDDLVPTAPSPTSPNRGWFVPPFGENP
WWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGTHLDLFWVAILMVICSLMALPWTVAATVISIAHIDSLKMETETSAPGEQ
PKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLTGVFLTMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQ
VLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDEKDHQHSLNATHHA

>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000351898_chr4_72399944_+_399aa
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWTHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVETTGT
SFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSITESVRVHTAMQTGRTEDDLVPTAPSPTSPNRGWFVPPFGENP
WWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKFIPMPVLTGVFLTMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVH
LFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEK

>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000340595_chr4_72399944_+_483aa
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWTHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVETTGT
SFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSITESVRVHTAMQTGRTEDDLVPTAPSPTSPNRGWFVPPFGENP
WWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGTHLDLFWVAILMVICSLMALPWTVAATVISIAHIDSLKMETETSAPGEQ
PKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLTGVFLTMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQ
VLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKI

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000264485_chr4_72399944_+_483aa
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWTHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVETTGT
SFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSITESVRVHTAMQTGRTEDDLVPTAPSPTSPNRGWFVPPFGENP
WWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGTHLDLFWVAILMVICSLMALPWTVAATVISIAHIDSLKMETETSAPGEQ
PKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLTGVFLTMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQ
VLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKI

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000425175_chr4_72399944_+_498aa
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWTHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVETTGT
SFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSITESVRVHTAMQTGRTEDDLVPTAPSPTSPNRGWFVPPFGENP
WWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGTHLDLFWVAILMVICSLMALPWTVAATVISIAHIDSLKMETETSAPGEQ
PKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLTGVFLTMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQ
VLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDEKDHQHSLNATHHA

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000351898_chr4_72399944_+_399aa
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWTHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVETTGT
SFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSITESVRVHTAMQTGRTEDDLVPTAPSPTSPNRGWFVPPFGENP
WWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKFIPMPVLTGVFLTMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVH
LFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEK

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000340595_chr4_72399944_+_483aa
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWTHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVETTGT
SFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSITESVRVHTAMQTGRTEDDLVPTAPSPTSPNRGWFVPPFGENP
WWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGTHLDLFWVAILMVICSLMALPWTVAATVISIAHIDSLKMETETSAPGEQ
PKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLTGVFLTMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQ
VLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000264485_chr4_72399944_+_1449nt
ATGGGCAGAGCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTC
CAGGACTTGGGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTG
AGGGACAGCAATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATAT
TCATTTAAATTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGC
ACTCTGATGGTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACA
GGAAGAACAGAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCC
TGGTGGGTGTGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAAC
AGGAAAGAACATAAACTCAAGAAAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCT
CTTCCGTGGTATGTAGCTGCTACGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAA
CCAAAGTTTCTAGGAGTGAGGGAACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTG
AAGTTTATACCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAG
CTGCTTCTGATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAG
GTGTTGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGA
AAAGGCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAG
AAGAAAAAGAAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGTATTAAAATT
CCAATGGACATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACATTCCTTGAACGCCACACA

>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000425175_chr4_72399944_+_1494nt
ATGGGCAGAGCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTC
CAGGACTTGGGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTG
AGGGACAGCAATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATAT
TCATTTAAATTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGC
ACTCTGATGGTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACA
GGAAGAACAGAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCC
TGGTGGGTGTGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAAC
AGGAAAGAACATAAACTCAAGAAAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCT
CTTCCGTGGTATGTAGCTGCTACGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAA
CCAAAGTTTCTAGGAGTGAGGGAACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTG
AAGTTTATACCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAG
CTGCTTCTGATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAG
GTGTTGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGA
AAAGGCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAG
AAGAAAAAGAAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATGAGAAAGATCACCAACATTCCTTGAACGCCACACATCATGCT
GATAAAATTCCTTTCCTTCAGTCACTCGGTATGCCAAGTCCTCCTAGAACTCCAGTAAAAGTTGTGCCTCAAATTAGAATAGAACTTGAA

>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000351898_chr4_72399944_+_1197nt
ATGGGCAGAGCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTC
CAGGACTTGGGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTG
AGGGACAGCAATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATAT
TCATTTAAATTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGC
ACTCTGATGGTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACA
GGAAGAACAGAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCC
TGGTGGGTGTGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAAC
AGGAAAGAACATAAACTCAAGTTTATACCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAG
TTCATGGATCGTCTGAAGCTGCTTCTGATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCAC
CTGTTCACTTTCCTGCAGGTGTTGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTG
GCACTTGTAGCTGTCAGAAAAGGCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAG
AAAAAGAAGGAGGATGAGAAGAAAAAGAAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAA
GTTCCAAGTATTAAAATTCCAATGGACATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACA

>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000340595_chr4_72399944_+_1449nt
ATGGGCAGAGCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTC
CAGGACTTGGGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTG
AGGGACAGCAATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATAT
TCATTTAAATTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGC
ACTCTGATGGTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACA
GGAAGAACAGAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCC
TGGTGGGTGTGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAAC
AGGAAAGAACATAAACTCAAGAAAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCT
CTTCCGTGGTATGTAGCTGCTACGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAA
CCAAAGTTTCTAGGAGTGAGGGAACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTG
AAGTTTATACCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAG
CTGCTTCTGATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAG
GTGTTGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGA
AAAGGCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAG
AAGAAAAAGAAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGTATTAAAATT
CCAATGGACATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACATTCCTTGAACGCCACACA

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000264485_chr4_72399944_+_1449nt
ATGGGCAGAGCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTC
CAGGACTTGGGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTG
AGGGACAGCAATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATAT
TCATTTAAATTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGC
ACTCTGATGGTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACA
GGAAGAACAGAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCC
TGGTGGGTGTGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAAC
AGGAAAGAACATAAACTCAAGAAAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCT
CTTCCGTGGTATGTAGCTGCTACGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAA
CCAAAGTTTCTAGGAGTGAGGGAACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTG
AAGTTTATACCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAG
CTGCTTCTGATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAG
GTGTTGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGA
AAAGGCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAG
AAGAAAAAGAAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGTATTAAAATT
CCAATGGACATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACATTCCTTGAACGCCACACA

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000425175_chr4_72399944_+_1494nt
ATGGGCAGAGCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTC
CAGGACTTGGGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTG
AGGGACAGCAATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATAT
TCATTTAAATTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGC
ACTCTGATGGTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACA
GGAAGAACAGAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCC
TGGTGGGTGTGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAAC
AGGAAAGAACATAAACTCAAGAAAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCT
CTTCCGTGGTATGTAGCTGCTACGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAA
CCAAAGTTTCTAGGAGTGAGGGAACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTG
AAGTTTATACCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAG
CTGCTTCTGATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAG
GTGTTGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGA
AAAGGCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAG
AAGAAAAAGAAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATGAGAAAGATCACCAACATTCCTTGAACGCCACACATCATGCT
GATAAAATTCCTTTCCTTCAGTCACTCGGTATGCCAAGTCCTCCTAGAACTCCAGTAAAAGTTGTGCCTCAAATTAGAATAGAACTTGAA

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000351898_chr4_72399944_+_1197nt
ATGGGCAGAGCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTC
CAGGACTTGGGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTG
AGGGACAGCAATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATAT
TCATTTAAATTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGC
ACTCTGATGGTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACA
GGAAGAACAGAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCC
TGGTGGGTGTGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAAC
AGGAAAGAACATAAACTCAAGTTTATACCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAG
TTCATGGATCGTCTGAAGCTGCTTCTGATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCAC
CTGTTCACTTTCCTGCAGGTGTTGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTG
GCACTTGTAGCTGTCAGAAAAGGCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAG
AAAAAGAAGGAGGATGAGAAGAAAAAGAAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAA
GTTCCAAGTATTAAAATTCCAATGGACATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACA

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000340595_chr4_72399944_+_1449nt
ATGGGCAGAGCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTC
CAGGACTTGGGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTG
AGGGACAGCAATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATAT
TCATTTAAATTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGC
ACTCTGATGGTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACA
GGAAGAACAGAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCC
TGGTGGGTGTGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAAC
AGGAAAGAACATAAACTCAAGAAAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCT
CTTCCGTGGTATGTAGCTGCTACGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAA
CCAAAGTTTCTAGGAGTGAGGGAACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTG
AAGTTTATACCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAG
CTGCTTCTGATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAG
GTGTTGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGA
AAAGGCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAG
AAGAAAAAGAAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGTATTAAAATT
CCAATGGACATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACATTCCTTGAACGCCACACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000264485_chr4_72399944_+_3496nt
GCAGGCTGCTGTCTCACAGAGCGAGAAGGTGTCAGGAGCAGCCCAGTTGTGTCTCTCTCTCTACCTCTGTGAAGGGCGCGAATGGGCAGA
GCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTCCAGGACTTG
GGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTGAGGGACAGC
AATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATATTCATTTAAA
TTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGCACTCTGATG
GTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACAGGAAGAACA
GAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCCTGGTGGGTG
TGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAACAGGAAAGAA
CATAAACTCAAGAAAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCTCTTCCGTGG
TATGTAGCTGCTACGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAACCAAAGTTT
CTAGGAGTGAGGGAACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTGAAGTTTATA
CCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAGCTGCTTCTG
ATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAGGTGTTGTGT
CTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGAAAAGGCATG
GACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAGAAGAAAAAG
AAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGTATTAAAATTCCAATGGAC
ATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACATTCCTTGAACGCCACACATCATGCTGA
TAAAATTCCTTTCCTTCAGTCACTCGGTATGCCAAGTCCTCCTAGAACTCCAGTAAAAGTTGTGCCTCAAATTAGAATAGAACTTGAACC
TGAAGACAATGATTATTTCTGGAGGAGCAAGGGAACAGAAACTACATTGTAACCTGTTTGTCTTTCTTAAAACTGACATTTGTTGTTAAT
GTCATTTGTTTTTGTTTGGCTGTTTGTTTATTTTTTAACTTTTATTTCGTCTCAGTTTTTGGTCACAGGCCAAATAATACAGCGCTCTCT
CTGCTTCTCTCTTGCATAGACACAATCAAGACAATAGTGCACCGTTCCTTAAAAACAGCATCTGAGGAATCCCCCTTTTGTTCTTAAACT
TTCAGATGTGTCCTTTGATAACCAAATTCTGTCACTCAAGACACAGACACGCACAGACCCTGTCCTTTGCCTCTATTAAGCAGAGGATGG
AAGTATTAAGGATTTTGTAACACCTTTTATGAAAATGTTGAAGGAACTTAAAACTTTAGCTTTGGAGCTGTGCTTACTGGCTTGTCTTTG
TCTGGTAGAACAAACCTTGACCTCCAGACAGAGTCCCTTCTCACTTATAGAGCTCTCCAGGACTGGAAAAAGTGCTGCTATTTTAACTTG
CTCTTGCTTGTAAATCCTAATCTTAGAGTTATCAAAAGAAGAAAAAACTGAAGGTACTTTACTCCCTATAGAGAAACCATTGCCATCATT
GTAGCAAGTGCTGGAATGTCCCTTTTTTCCTATGCAACTTTTTTTAACCCTTTAATGAACTTATCTGTTGAGTACATTGAAGAATATTTT
TCTTCCTAGATTTTGTTGTTTAAATTATGGGGCCTAACCTGCCACTTATTTTTTGTCAATTTTTAAAACTTTTTTTTAATTACTGTAAAG
AAAATGAATTTTTTCCTGCAGCAGGAAACATAGTTTTGAGTAGTTCTACCTCTTATTTGTAGCTGCCAGGCTTTCTGTAAAAATTGTATT
GTATATAATGTGATTTTTACACATACATACACACACAAATACACAATCTCTAGGGTAAGCCAGAAGGCAAGATCAGATTAAAAACACCAT
GTTTCTAAGCATCCATTTTTCCCTTTCTTTAAAAGAAACTTAACTGTTCTATGAAGGAGATTGAGGGAGAAGAGACAAACTCCTATGTCA
TGAGAATAACCGATGTTCTGATAATAGTAGCATCTAGGTACAGATGCTGGTTGTATTACCACGTCAATGTCCTATGCAGTATTGTTAGAC
ATTTTCTCATTTTGAAATATTTGTGTGTTTGTGTATGTGCTCTGTGCCATGGCTGGTGTATATATGTGCAATGTTAGAAGGCAAAAGAGT
GATGGTAGGCAGAGGGCAAAGTCATTGAATCTCTTATGCCAGTTTTCATAAAACCCAAACCACATATGAAAAAATCCATTAAGGGTCCAA
GAAGTCTGTCCATATGAAAATGAGGGTAAATATAGTTTATTTCCCAGGTATCAGTCATTATAATTGATATAATAGCTCTAACATGCAATA
TAAAATTCATAGGAGTATTAATAGCCCATTTACACATCTATAAAATGTAATGGGATTGCAGAGCTGCAGAGTACAGTGTAACAGTACTCT
CATGCAATTTTTTTCAGGATGCAAAGGCAATTATTCTTTGTAAGCGGGACATTTAGAATATATTTGTGTACATATTATATGTATGTATAT
TTCAAAGTACCACACTGAAAATTAGACATTTATTAACCAAATTTAACGTGGTATTTAAAGGTAATATTTTTAATATGATACATTACATAT
TGTGAATGTATACTAAAAAAACATTTTAAATGTTAAAATTATAATTTCAGATTCATATAACCACAACTGTGATATATCCTAACTATAACC

>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000425175_chr4_72399944_+_5769nt
GCAGGCTGCTGTCTCACAGAGCGAGAAGGTGTCAGGAGCAGCCCAGTTGTGTCTCTCTCTCTACCTCTGTGAAGGGCGCGAATGGGCAGA
GCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTCCAGGACTTG
GGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTGAGGGACAGC
AATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATATTCATTTAAA
TTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGCACTCTGATG
GTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACAGGAAGAACA
GAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCCTGGTGGGTG
TGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAACAGGAAAGAA
CATAAACTCAAGAAAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCTCTTCCGTGG
TATGTAGCTGCTACGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAACCAAAGTTT
CTAGGAGTGAGGGAACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTGAAGTTTATA
CCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAGCTGCTTCTG
ATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAGGTGTTGTGT
CTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGAAAAGGCATG
GACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAGAAGAAAAAG
AAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATGAGAAAGATCACCAACATTCCTTGAACGCCACACATCATGCTGATAAAATT
CCTTTCCTTCAGTCACTCGGTATGCCAAGTCCTCCTAGAACTCCAGTAAAAGTTGTGCCTCAAATTAGAATAGAACTTGAACCTGAAGAC
AATGATTATTTCTGGAGGAGCAAGGGAACAGAAACTACATTGTAACCTGTTTGTCTTTCTTAAAACTGACATTTGTTGTTAATGTCATTT
GTTTTTGTTTGGCTGTTTGTTTATTTTTTAACTTTTATTTCGTCTCAGTTTTTGGTCACAGGCCAAATAATACAGCGCTCTCTCTGCTTC
TCTCTTGCATAGACACAATCAAGACAATAGTGCACCGTTCCTTAAAAACAGCATCTGAGGAATCCCCCTTTTGTTCTTAAACTTTCAGAT
GTGTCCTTTGATAACCAAATTCTGTCACTCAAGACACAGACACGCACAGACCCTGTCCTTTGCCTCTATTAAGCAGAGGATGGAAGTATT
AAGGATTTTGTAACACCTTTTATGAAAATGTTGAAGGAACTTAAAACTTTAGCTTTGGAGCTGTGCTTACTGGCTTGTCTTTGTCTGGTA
GAACAAACCTTGACCTCCAGACAGAGTCCCTTCTCACTTATAGAGCTCTCCAGGACTGGAAAAAGTGCTGCTATTTTAACTTGCTCTTGC
TTGTAAATCCTAATCTTAGAGTTATCAAAAGAAGAAAAAACTGAAGGTACTTTACTCCCTATAGAGAAACCATTGCCATCATTGTAGCAA
GTGCTGGAATGTCCCTTTTTTCCTATGCAACTTTTTTTAACCCTTTAATGAACTTATCTGTTGAGTACATTGAAGAATATTTTTCTTCCT
AGATTTTGTTGTTTAAATTATGGGGCCTAACCTGCCACTTATTTTTTGTCAATTTTTAAAACTTTTTTTTAATTACTGTAAAGAAAATGA
ATTTTTTCCTGCAGCAGGAAACATAGTTTTGAGTAGTTCTACCTCTTATTTGTAGCTGCCAGGCTTTCTGTAAAAATTGTATTGTATATA
ATGTGATTTTTACACATACATACACACACAAATACACAATCTCTAGGGTAAGCCAGAAGGCAAGATCAGATTAAAAACACCATGTTTCTA
AGCATCCATTTTTCCCTTTCTTTAAAAGAAACTTAACTGTTCTATGAAGGAGATTGAGGGAGAAGAGACAAACTCCTATGTCATGAGAAT
AACCGATGTTCTGATAATAGTAGCATCTAGGTACAGATGCTGGTTGTATTACCACGTCAATGTCCTATGCAGTATTGTTAGACATTTTCT
CATTTTGAAATATTTGTGTGTTTGTGTATGTGCTCTGTGCCATGGCTGGTGTATATATGTGCAATGTTAGAAGGCAAAAGAGTGATGGTA
GGCAGAGGGCAAAGTCATTGAATCTCTTATGCCAGTTTTCATAAAACCCAAACCACATATGAAAAAATCCATTAAGGGTCCAAGAAGTCT
GTCCATATGAAAATGAGGGTAAATATAGTTTATTTCCCAGGTATCAGTCATTATAATTGATATAATAGCTCTAACATGCAATATAAAATT
CATAGGAGTATTAATAGCCCATTTACACATCTATAAAATGTAATGGGATTGCAGAGCTGCAGAGTACAGTGTAACAGTACTCTCATGCAA
TTTTTTTCAGGATGCAAAGGCAATTATTCTTTGTAAGCGGGACATTTAGAATATATTTGTGTACATATTATATGTATGTATATTTCAAAG
TACCACACTGAAAATTAGACATTTATTAACCAAATTTAACGTGGTATTTAAAGGTAATATTTTTAATATGATACATTACATATTGTGAAT
GTATACTAAAAAAACATTTTAAATGTTAAAATTATAATTTCAGATTCATATAACCACAACTGTGATATATCCTAACTATAACCAGTTGTT
GAGGGGTATACTAGAAGCAGAATGAAACCACATTTTTTGGTTTGATAATATGCACTTATTGACTCCCACTCATTGTTATGTTAATTAAGT
TATTATTCTGTCTCCTTGTAATTTTGATTACAAAAATTTTATTATCCTGAGTTAGCTGTTACTTTTACAGTACCTGATACTCCTAAAACT
TTTAACTTATACAAATTAGTCAATAATGACCCCAATTTTTTCATTAAAATAATAGTGGTGAATTATATGTTATTGTGTTAAAACCTCACT
TGCCAAATTCTGGCTTCACATTTGTATTTAGGGCTATCCTTAAAATGATGAGTCTATATTATCTAGCTTTCTATTACCCTAATATAAACT
GGTATAAGAAGACTTTCCTTTTTTCTTTATGCATGGAAGCATCAATAAATTGTTTAAAAACCATGTATAGTAAATTCAGCTTAACCCGTG
ATCTTCTTAAGTTAAAGGTACTTTTGTTTTATAAAAGCTCTAGATAAAACTTTCTTTTCTGATCATGAATCAAGTATCTGTGGTTTCATG
CCCCTCTCTATACCTTTCAAAGAACTCCTGAAGCAACTTAACTCATCATTTCAGCCTCTGAGTAGAGGTAAAACCTATGTGTACTTCTGT
TTATGATCCATATTGATATTTATGACATGAACACAGAATAGTACCTTACATTTGCTAAACAGACAGTTAATATCAAATCCTTTCAATATT
CTGGGAACCCAGGGAAGTTTTTAAAAATGTCATTACTTTCAAAGGAACAGAAGTAGTTAACCAAACTAACAAGCAAAACCTGAGGTTTAC
CTAGTGACACCAAATTATCGGTATTTTAACTGAATTTACCCATTGACTAAGAATGAACCAGATTTGGTGGTGGTTTTGTTTCTATGCAAA
CTGGACACAAATTACAACAGTAAATTTTTTTATAAGTGCTTCTCCCTTCTCCATGATGTGACTTCCGGAGATAAAGGATTCAAAAGATAA
AGACAAAGTACGCTCAGAGTTGTTAACCAGAAAGTCCTGGCTGTGGTTGCAGAAACACTGTTGGAAGAAAAGAGATGACTAAGTCAAGTG
TCTGCCTTATCAAAAGAGCAAAAATGCCTCTGGTTTTGTGTTTGGGAGAAAAGTATCTTGGACGCACTGTTTTCCTTGATAAAAGTCATC
TTCTCTACTGTGTGAAATGAATACTTGGAATTCTAATTGTTTTGTGTGCCAGGGGCAGTAATGTCCCTGCCTCTTCTCCCAATCAAGGTT
GAGGAGTGGGGCTGGGGAGAGGACTTAACTGACTTAAGAAGTAGGAAAACAAAAACCTCTCTCCTCAGCCTTCCACCTCCAAGAGAGGAG
GAAAAACAGTTGTCTGCTGTCTGTAATTCAGTTTGCGTGTATTTTATGCTCATGCACCAACCCATACAGAGTAAATCTTTTATCAACTGT
ATACTGGTGTTTAATAGAGAATGATTGTCTTCCGAGTTTTTTGGTTCCTTTTTTAACTGTGTTAAAGTACTTGAAATGTATTGACTGCTG
ACTATATTTTAAAAACAAAATGAAATAATTTGAGTTGTATTACAGAGGTTGACATTGTTCAGGGATGGGACAAAGCCTTCTTCAATCCTT
TTCATACTACTTAATGATTTTGGTGCAGGAACCTGAGATTTTCTGATTTATATTTCATGATATTTCACATTTGCTCTTCACAGCATGAGC
ATGAAGCCCAGTGGCACCAAATGGCTGGGTACAATCAAGTGATATTTTGTAGCACCTCACTATCTGAAAGGCCATGAGTTTTCAGATGAT
TTCATTGAGCTTCATTGCAGCCTGAAATTTTAAAAAAGTTGTGTAATACGCCAACCAGTCAAGTTGTGTTTTGGCCAGAGATTTAGATAT
GTCCAATTTCCTGGCTCATTTCATTGTGCTCTATGGGTACGTATAAAAAGCAAGAATTCTGTTTCCTAGGCAAACATTGCAACTCAGGGC
TAAAGTCATCCAGTGAAACTTTTAGAGCCAGAAGTAACTTTGTCCCAGTCCTACAATGTGAAAAGAGTGAATAGTTGCCTCTTTTTAGCC
ATTTTCATGGCTGGTACATATTCGTACGCATTACTTTTCAGAATCAATACGCACTTTCAGATATTCTTATTTTTATTCTCTTAAGTCTTT
ATTAACTTTGGAGAGAGAAATGATGCATCTTTTTATTTTAAATGAAGTAGATCAACATGGTGGAACAAAATGATAAAGAACAGAAAACAT
TTCAATATATTACTAATAACTTTTTCCAATATAAATCCTAAAATTCCTATAACATAGTATTTTACAGTTTTATGAAGCTTTCTATTGTGA
CTTTTATGGAATTAAGAGATGAAGAAGATGAGATATTTTAGCATTTATATTTTTCAAAATTATATGTATACTTAAAAATAAAGTAACTTT

>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000351898_chr4_72399944_+_1985nt
GCAGGCTGCTGTCTCACAGAGCGAGAAGGTGTCAGGAGCAGCCCAGTTGTGTCTCTCTCTCTACCTCTGTGAAGGGCGCGAATGGGCAGA
GCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTCCAGGACTTG
GGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTGAGGGACAGC
AATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATATTCATTTAAA
TTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGCACTCTGATG
GTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACAGGAAGAACA
GAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCCTGGTGGGTG
TGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAACAGGAAAGAA
CATAAACTCAAGTTTATACCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGAT
CGTCTGAAGCTGCTTCTGATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACT
TTCCTGCAGGTGTTGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTA
GCTGTCAGAAAAGGCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAG
GAGGATGAGAAGAAAAAGAAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGT
ATTAAAATTCCAATGGACATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACATTCCTTGAA
CGCCACACATCATGCTGATAAAATTCCTTTCCTTCAGTCACTCGGTATGCCAAGTCCTCCTAGAACTCCAGTAAAAGTTGTGCCTCAAAT
TAGAATAGAACTTGAACCTGAAGACAATGATTATTTCTGGAGGAGCAAGGGAACAGAAACTACATTGTAACCTGTTTGTCTTTCTTAAAA
CTGACATTTGTTGTTAATGTCATTTGTTTTTGTTTGGCTGTTTGTTTATTTTTTAACTTTTATTTCGTCTCAGTTTTTGGTCACAGGCCA
AATAATACAGCGCTCTCTCTGCTTCTCTCTTGCATAGACACAATCAAGACAATAGTGCACCGTTCCTTAAAAACAGCATCTGAGGAATCC
CCCTTTTGTTCTTAAACTTTCAGATGTGTCCTTTGATAACCAAATTCTGTCACTCAAGACACAGACACGCACAGACCCTGTCCTTTGCCT
CTATTAAGCAGAGGATGGAAGTATTAAGGATTTTGTAACACCTTTTATGAAAATGTTGAAGGAACTTAAAACTTTAGCTTTGGAGCTGTG
CTTACTGGCTTGTCTTTGTCTGGTAGAACAAACCTTGACCTCCAGACAGAGTCCCTTCTCACTTATAGAGCTCTCCAGGACTGGAAAAAG
TGCTGCTATTTTAACTTGCTCTTGCTTGTAAATCCTAATCTTAGAGTTATCAAAAGAAGAAAAAACTGAAGGTACTTTACTCCCTATAGA

>In-frame_DAPP1_ENST00000296414_chr4_100774505_+_SLC4A4_ENST00000340595_chr4_72399944_+_5866nt
GCAGGCTGCTGTCTCACAGAGCGAGAAGGTGTCAGGAGCAGCCCAGTTGTGTCTCTCTCTCTACCTCTGTGAAGGGCGCGAATGGGCAGA
GCAGAACTTCTAGAAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTCCAGGACTTG
GGGTGGTATCACGGCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTGAGGGACAGC
AATGAGACCACCGGGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATATTCATTTAAA
TTTGGCTTTAATGAATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGCACTCTGATG
GTTCTAAAACATCCCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACAGGAAGAACA
GAAGATGACCTTGTGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCCTGGTGGGTG
TGCCTTGCTGCTGCTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAACAGGAAAGAA
CATAAACTCAAGAAAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCTCTTCCGTGG
TATGTAGCTGCTACGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAACCAAAGTTT
CTAGGAGTGAGGGAACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTGAAGTTTATA
CCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAGCTGCTTCTG
ATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAGGTGTTGTGT
CTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGAAAAGGCATG
GACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAGAAGAAAAAG
AAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGTATTAAAATTCCAATGGAC
ATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACATTCCTTGAACGCCACACATCATGCTGA
TAAAATTCCTTTCCTTCAGTCACTCGGTATGCCAAGTCCTCCTAGAACTCCAGTAAAAGTTGTGCCTCAAATTAGAATAGAACTTGAACC
TGAAGACAATGATTATTTCTGGAGGAGCAAGGGAACAGAAACTACATTGTAACCTGTTTGTCTTTCTTAAAACTGACATTTGTTGTTAAT
GTCATTTGTTTTTGTTTGGCTGTTTGTTTATTTTTTAACTTTTATTTCGTCTCAGTTTTTGGTCACAGGCCAAATAATACAGCGCTCTCT
CTGCTTCTCTCTTGCATAGACACAATCAAGACAATAGTGCACCGTTCCTTAAAAACAGCATCTGAGGAATCCCCCTTTTGTTCTTAAACT
TTCAGATGTGTCCTTTGATAACCAAATTCTGTCACTCAAGACACAGACACGCACAGACCCTGTCCTTTGCCTCTATTAAGCAGAGGATGG
AAGTATTAAGGATTTTGTAACACCTTTTATGAAAATGTTGAAGGAACTTAAAACTTTAGCTTTGGAGCTGTGCTTACTGGCTTGTCTTTG
TCTGGTAGAACAAACCTTGACCTCCAGACAGAGTCCCTTCTCACTTATAGAGCTCTCCAGGACTGGAAAAAGTGCTGCTATTTTAACTTG
CTCTTGCTTGTAAATCCTAATCTTAGAGTTATCAAAAGAAGAAAAAACTGAAGGTACTTTACTCCCTATAGAGAAACCATTGCCATCATT
GTAGCAAGTGCTGGAATGTCCCTTTTTTCCTATGCAACTTTTTTTAACCCTTTAATGAACTTATCTGTTGAGTACATTGAAGAATATTTT
TCTTCCTAGATTTTGTTGTTTAAATTATGGGGCCTAACCTGCCACTTATTTTTTGTCAATTTTTAAAACTTTTTTTTAATTACTGTAAAG
AAAATGAATTTTTTCCTGCAGCAGGAAACATAGTTTTGAGTAGTTCTACCTCTTATTTGTAGCTGCCAGGCTTTCTGTAAAAATTGTATT
GTATATAATGTGATTTTTACACATACATACACACACAAATACACAATCTCTAGGGTAAGCCAGAAGGCAAGATCAGATTAAAAACACCAT
GTTTCTAAGCATCCATTTTTCCCTTTCTTTAAAAGAAACTTAACTGTTCTATGAAGGAGATTGAGGGAGAAGAGACAAACTCCTATGTCA
TGAGAATAACCGATGTTCTGATAATAGTAGCATCTAGGTACAGATGCTGGTTGTATTACCACGTCAATGTCCTATGCAGTATTGTTAGAC
ATTTTCTCATTTTGAAATATTTGTGTGTTTGTGTATGTGCTCTGTGCCATGGCTGGTGTATATATGTGCAATGTTAGAAGGCAAAAGAGT
GATGGTAGGCAGAGGGCAAAGTCATTGAATCTCTTATGCCAGTTTTCATAAAACCCAAACCACATATGAAAAAATCCATTAAGGGTCCAA
GAAGTCTGTCCATATGAAAATGAGGGTAAATATAGTTTATTTCCCAGGTATCAGTCATTATAATTGATATAATAGCTCTAACATGCAATA
TAAAATTCATAGGAGTATTAATAGCCCATTTACACATCTATAAAATGTAATGGGATTGCAGAGCTGCAGAGTACAGTGTAACAGTACTCT
CATGCAATTTTTTTCAGGATGCAAAGGCAATTATTCTTTGTAAGCGGGACATTTAGAATATATTTGTGTACATATTATATGTATGTATAT
TTCAAAGTACCACACTGAAAATTAGACATTTATTAACCAAATTTAACGTGGTATTTAAAGGTAATATTTTTAATATGATACATTACATAT
TGTGAATGTATACTAAAAAAACATTTTAAATGTTAAAATTATAATTTCAGATTCATATAACCACAACTGTGATATATCCTAACTATAACC
AGTTGTTGAGGGGTATACTAGAAGCAGAATGAAACCACATTTTTTGGTTTGATAATATGCACTTATTGACTCCCACTCATTGTTATGTTA
ATTAAGTTATTATTCTGTCTCCTTGTAATTTTGATTACAAAAATTTTATTATCCTGAGTTAGCTGTTACTTTTACAGTACCTGATACTCC
TAAAACTTTTAACTTATACAAATTAGTCAATAATGACCCCAATTTTTTCATTAAAATAATAGTGGTGAATTATATGTTATTGTGTTAAAA
CCTCACTTGCCAAATTCTGGCTTCACATTTGTATTTAGGGCTATCCTTAAAATGATGAGTCTATATTATCTAGCTTTCTATTACCCTAAT
ATAAACTGGTATAAGAAGACTTTCCTTTTTTCTTTATGCATGGAAGCATCAATAAATTGTTTAAAAACCATGTATAGTAAATTCAGCTTA
ACCCGTGATCTTCTTAAGTTAAAGGTACTTTTGTTTTATAAAAGCTCTAGATAAAACTTTCTTTTCTGATCATGAATCAAGTATCTGTGG
TTTCATGCCCCTCTCTATACCTTTCAAAGAACTCCTGAAGCAACTTAACTCATCATTTCAGCCTCTGAGTAGAGGTAAAACCTATGTGTA
CTTCTGTTTATGATCCATATTGATATTTATGACATGAACACAGAATAGTACCTTACATTTGCTAAACAGACAGTTAATATCAAATCCTTT
CAATATTCTGGGAACCCAGGGAAGTTTTTAAAAATGTCATTACTTTCAAAGGAACAGAAGTAGTTAACCAAACTAACAAGCAAAACCTGA
GGTTTACCTAGTGACACCAAATTATCGGTATTTTAACTGAATTTACCCATTGACTAAGAATGAACCAGATTTGGTGGTGGTTTTGTTTCT
ATGCAAACTGGACACAAATTACAACAGTAAATTTTTTTATAAGTGCTTCTCCCTTCTCCATGATGTGACTTCCGGAGATAAAGGATTCAA
AAGATAAAGACAAAGTACGCTCAGAGTTGTTAACCAGAAAGTCCTGGCTGTGGTTGCAGAAACACTGTTGGAAGAAAAGAGATGACTAAG
TCAAGTGTCTGCCTTATCAAAAGAGCAAAAATGCCTCTGGTTTTGTGTTTGGGAGAAAAGTATCTTGGACGCACTGTTTTCCTTGATAAA
AGTCATCTTCTCTACTGTGTGAAATGAATACTTGGAATTCTAATTGTTTTGTGTGCCAGGGGCAGTAATGTCCCTGCCTCTTCTCCCAAT
CAAGGTTGAGGAGTGGGGCTGGGGAGAGGACTTAACTGACTTAAGAAGTAGGAAAACAAAAACCTCTCTCCTCAGCCTTCCACCTCCAAG
AGAGGAGGAAAAACAGTTGTCTGCTGTCTGTAATTCAGTTTGCGTGTATTTTATGCTCATGCACCAACCCATACAGAGTAAATCTTTTAT
CAACTGTATACTGGTGTTTAATAGAGAATGATTGTCTTCCGAGTTTTTTGGTTCCTTTTTTAACTGTGTTAAAGTACTTGAAATGTATTG
ACTGCTGACTATATTTTAAAAACAAAATGAAATAATTTGAGTTGTATTACAGAGGTTGACATTGTTCAGGGATGGGACAAAGCCTTCTTC
AATCCTTTTCATACTACTTAATGATTTTGGTGCAGGAACCTGAGATTTTCTGATTTATATTTCATGATATTTCACATTTGCTCTTCACAG
CATGAGCATGAAGCCCAGTGGCACCAAATGGCTGGGTACAATCAAGTGATATTTTGTAGCACCTCACTATCTGAAAGGCCATGAGTTTTC
AGATGATTTCATTGAGCTTCATTGCAGCCTGAAATTTTAAAAAAGTTGTGTAATACGCCAACCAGTCAAGTTGTGTTTTGGCCAGAGATT
TAGATATGTCCAATTTCCTGGCTCATTTCATTGTGCTCTATGGGTACGTATAAAAAGCAAGAATTCTGTTTCCTAGGCAAACATTGCAAC
TCAGGGCTAAAGTCATCCAGTGAAACTTTTAGAGCCAGAAGTAACTTTGTCCCAGTCCTACAATGTGAAAAGAGTGAATAGTTGCCTCTT
TTTAGCCATTTTCATGGCTGGTACATATTCGTACGCATTACTTTTCAGAATCAATACGCACTTTCAGATATTCTTATTTTTATTCTCTTA
AGTCTTTATTAACTTTGGAGAGAGAAATGATGCATCTTTTTATTTTAAATGAAGTAGATCAACATGGTGGAACAAAATGATAAAGAACAG
AAAACATTTCAATATATTACTAATAACTTTTTCCAATATAAATCCTAAAATTCCTATAACATAGTATTTTACAGTTTTATGAAGCTTTCT
ATTGTGACTTTTATGGAATTAAGAGATGAAGAAGATGAGATATTTTAGCATTTATATTTTTCAAAATTATATGTATACTTAAAAATAAAG

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000264485_chr4_72399944_+_3483nt
TCACAGAGCGAGAAGGTGTCAGGAGCAGCCCAGTTGTGTCTCTCTCTCTACCTCTGTGAAGGGCGCGAATGGGCAGAGCAGAACTTCTAG
AAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTCCAGGACTTGGGGTGGTATCACG
GCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTGAGGGACAGCAATGAGACCACCG
GGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATATTCATTTAAATTTGGCTTTAATG
AATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGCACTCTGATGGTTCTAAAACATC
CCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACAGGAAGAACAGAAGATGACCTTG
TGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCCTGGTGGGTGTGCCTTGCTGCTG
CTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAACAGGAAAGAACATAAACTCAAGA
AAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCTCTTCCGTGGTATGTAGCTGCTA
CGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAACCAAAGTTTCTAGGAGTGAGGG
AACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTGAAGTTTATACCCATGCCTGTAC
TCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAGCTGCTTCTGATGCCTCTGAAGC
ATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAGGTGTTGTGTCTGGCCCTGCTTT
GGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGAAAAGGCATGGACTACCTCTTCT
CCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAGAAGAAAAAGAAAAAGAAGAAGG
GAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGTATTAAAATTCCAATGGACATCATGGAACAGC
AACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACATTCCTTGAACGCCACACATCATGCTGATAAAATTCCTTTC
CTTCAGTCACTCGGTATGCCAAGTCCTCCTAGAACTCCAGTAAAAGTTGTGCCTCAAATTAGAATAGAACTTGAACCTGAAGACAATGAT
TATTTCTGGAGGAGCAAGGGAACAGAAACTACATTGTAACCTGTTTGTCTTTCTTAAAACTGACATTTGTTGTTAATGTCATTTGTTTTT
GTTTGGCTGTTTGTTTATTTTTTAACTTTTATTTCGTCTCAGTTTTTGGTCACAGGCCAAATAATACAGCGCTCTCTCTGCTTCTCTCTT
GCATAGACACAATCAAGACAATAGTGCACCGTTCCTTAAAAACAGCATCTGAGGAATCCCCCTTTTGTTCTTAAACTTTCAGATGTGTCC
TTTGATAACCAAATTCTGTCACTCAAGACACAGACACGCACAGACCCTGTCCTTTGCCTCTATTAAGCAGAGGATGGAAGTATTAAGGAT
TTTGTAACACCTTTTATGAAAATGTTGAAGGAACTTAAAACTTTAGCTTTGGAGCTGTGCTTACTGGCTTGTCTTTGTCTGGTAGAACAA
ACCTTGACCTCCAGACAGAGTCCCTTCTCACTTATAGAGCTCTCCAGGACTGGAAAAAGTGCTGCTATTTTAACTTGCTCTTGCTTGTAA
ATCCTAATCTTAGAGTTATCAAAAGAAGAAAAAACTGAAGGTACTTTACTCCCTATAGAGAAACCATTGCCATCATTGTAGCAAGTGCTG
GAATGTCCCTTTTTTCCTATGCAACTTTTTTTAACCCTTTAATGAACTTATCTGTTGAGTACATTGAAGAATATTTTTCTTCCTAGATTT
TGTTGTTTAAATTATGGGGCCTAACCTGCCACTTATTTTTTGTCAATTTTTAAAACTTTTTTTTAATTACTGTAAAGAAAATGAATTTTT
TCCTGCAGCAGGAAACATAGTTTTGAGTAGTTCTACCTCTTATTTGTAGCTGCCAGGCTTTCTGTAAAAATTGTATTGTATATAATGTGA
TTTTTACACATACATACACACACAAATACACAATCTCTAGGGTAAGCCAGAAGGCAAGATCAGATTAAAAACACCATGTTTCTAAGCATC
CATTTTTCCCTTTCTTTAAAAGAAACTTAACTGTTCTATGAAGGAGATTGAGGGAGAAGAGACAAACTCCTATGTCATGAGAATAACCGA
TGTTCTGATAATAGTAGCATCTAGGTACAGATGCTGGTTGTATTACCACGTCAATGTCCTATGCAGTATTGTTAGACATTTTCTCATTTT
GAAATATTTGTGTGTTTGTGTATGTGCTCTGTGCCATGGCTGGTGTATATATGTGCAATGTTAGAAGGCAAAAGAGTGATGGTAGGCAGA
GGGCAAAGTCATTGAATCTCTTATGCCAGTTTTCATAAAACCCAAACCACATATGAAAAAATCCATTAAGGGTCCAAGAAGTCTGTCCAT
ATGAAAATGAGGGTAAATATAGTTTATTTCCCAGGTATCAGTCATTATAATTGATATAATAGCTCTAACATGCAATATAAAATTCATAGG
AGTATTAATAGCCCATTTACACATCTATAAAATGTAATGGGATTGCAGAGCTGCAGAGTACAGTGTAACAGTACTCTCATGCAATTTTTT
TCAGGATGCAAAGGCAATTATTCTTTGTAAGCGGGACATTTAGAATATATTTGTGTACATATTATATGTATGTATATTTCAAAGTACCAC
ACTGAAAATTAGACATTTATTAACCAAATTTAACGTGGTATTTAAAGGTAATATTTTTAATATGATACATTACATATTGTGAATGTATAC
TAAAAAAACATTTTAAATGTTAAAATTATAATTTCAGATTCATATAACCACAACTGTGATATATCCTAACTATAACCAGTTGTTGAGGGG

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000425175_chr4_72399944_+_5756nt
TCACAGAGCGAGAAGGTGTCAGGAGCAGCCCAGTTGTGTCTCTCTCTCTACCTCTGTGAAGGGCGCGAATGGGCAGAGCAGAACTTCTAG
AAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTCCAGGACTTGGGGTGGTATCACG
GCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTGAGGGACAGCAATGAGACCACCG
GGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATATTCATTTAAATTTGGCTTTAATG
AATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGCACTCTGATGGTTCTAAAACATC
CCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACAGGAAGAACAGAAGATGACCTTG
TGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCCTGGTGGGTGTGCCTTGCTGCTG
CTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAACAGGAAAGAACATAAACTCAAGA
AAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCTCTTCCGTGGTATGTAGCTGCTA
CGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAACCAAAGTTTCTAGGAGTGAGGG
AACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTGAAGTTTATACCCATGCCTGTAC
TCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAGCTGCTTCTGATGCCTCTGAAGC
ATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAGGTGTTGTGTCTGGCCCTGCTTT
GGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGAAAAGGCATGGACTACCTCTTCT
CCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAGAAGAAAAAGAAAAAGAAGAAGG
GAAGTCTGGACAGTGACAATGATGATGAGAAAGATCACCAACATTCCTTGAACGCCACACATCATGCTGATAAAATTCCTTTCCTTCAGT
CACTCGGTATGCCAAGTCCTCCTAGAACTCCAGTAAAAGTTGTGCCTCAAATTAGAATAGAACTTGAACCTGAAGACAATGATTATTTCT
GGAGGAGCAAGGGAACAGAAACTACATTGTAACCTGTTTGTCTTTCTTAAAACTGACATTTGTTGTTAATGTCATTTGTTTTTGTTTGGC
TGTTTGTTTATTTTTTAACTTTTATTTCGTCTCAGTTTTTGGTCACAGGCCAAATAATACAGCGCTCTCTCTGCTTCTCTCTTGCATAGA
CACAATCAAGACAATAGTGCACCGTTCCTTAAAAACAGCATCTGAGGAATCCCCCTTTTGTTCTTAAACTTTCAGATGTGTCCTTTGATA
ACCAAATTCTGTCACTCAAGACACAGACACGCACAGACCCTGTCCTTTGCCTCTATTAAGCAGAGGATGGAAGTATTAAGGATTTTGTAA
CACCTTTTATGAAAATGTTGAAGGAACTTAAAACTTTAGCTTTGGAGCTGTGCTTACTGGCTTGTCTTTGTCTGGTAGAACAAACCTTGA
CCTCCAGACAGAGTCCCTTCTCACTTATAGAGCTCTCCAGGACTGGAAAAAGTGCTGCTATTTTAACTTGCTCTTGCTTGTAAATCCTAA
TCTTAGAGTTATCAAAAGAAGAAAAAACTGAAGGTACTTTACTCCCTATAGAGAAACCATTGCCATCATTGTAGCAAGTGCTGGAATGTC
CCTTTTTTCCTATGCAACTTTTTTTAACCCTTTAATGAACTTATCTGTTGAGTACATTGAAGAATATTTTTCTTCCTAGATTTTGTTGTT
TAAATTATGGGGCCTAACCTGCCACTTATTTTTTGTCAATTTTTAAAACTTTTTTTTAATTACTGTAAAGAAAATGAATTTTTTCCTGCA
GCAGGAAACATAGTTTTGAGTAGTTCTACCTCTTATTTGTAGCTGCCAGGCTTTCTGTAAAAATTGTATTGTATATAATGTGATTTTTAC
ACATACATACACACACAAATACACAATCTCTAGGGTAAGCCAGAAGGCAAGATCAGATTAAAAACACCATGTTTCTAAGCATCCATTTTT
CCCTTTCTTTAAAAGAAACTTAACTGTTCTATGAAGGAGATTGAGGGAGAAGAGACAAACTCCTATGTCATGAGAATAACCGATGTTCTG
ATAATAGTAGCATCTAGGTACAGATGCTGGTTGTATTACCACGTCAATGTCCTATGCAGTATTGTTAGACATTTTCTCATTTTGAAATAT
TTGTGTGTTTGTGTATGTGCTCTGTGCCATGGCTGGTGTATATATGTGCAATGTTAGAAGGCAAAAGAGTGATGGTAGGCAGAGGGCAAA
GTCATTGAATCTCTTATGCCAGTTTTCATAAAACCCAAACCACATATGAAAAAATCCATTAAGGGTCCAAGAAGTCTGTCCATATGAAAA
TGAGGGTAAATATAGTTTATTTCCCAGGTATCAGTCATTATAATTGATATAATAGCTCTAACATGCAATATAAAATTCATAGGAGTATTA
ATAGCCCATTTACACATCTATAAAATGTAATGGGATTGCAGAGCTGCAGAGTACAGTGTAACAGTACTCTCATGCAATTTTTTTCAGGAT
GCAAAGGCAATTATTCTTTGTAAGCGGGACATTTAGAATATATTTGTGTACATATTATATGTATGTATATTTCAAAGTACCACACTGAAA
ATTAGACATTTATTAACCAAATTTAACGTGGTATTTAAAGGTAATATTTTTAATATGATACATTACATATTGTGAATGTATACTAAAAAA
ACATTTTAAATGTTAAAATTATAATTTCAGATTCATATAACCACAACTGTGATATATCCTAACTATAACCAGTTGTTGAGGGGTATACTA
GAAGCAGAATGAAACCACATTTTTTGGTTTGATAATATGCACTTATTGACTCCCACTCATTGTTATGTTAATTAAGTTATTATTCTGTCT
CCTTGTAATTTTGATTACAAAAATTTTATTATCCTGAGTTAGCTGTTACTTTTACAGTACCTGATACTCCTAAAACTTTTAACTTATACA
AATTAGTCAATAATGACCCCAATTTTTTCATTAAAATAATAGTGGTGAATTATATGTTATTGTGTTAAAACCTCACTTGCCAAATTCTGG
CTTCACATTTGTATTTAGGGCTATCCTTAAAATGATGAGTCTATATTATCTAGCTTTCTATTACCCTAATATAAACTGGTATAAGAAGAC
TTTCCTTTTTTCTTTATGCATGGAAGCATCAATAAATTGTTTAAAAACCATGTATAGTAAATTCAGCTTAACCCGTGATCTTCTTAAGTT
AAAGGTACTTTTGTTTTATAAAAGCTCTAGATAAAACTTTCTTTTCTGATCATGAATCAAGTATCTGTGGTTTCATGCCCCTCTCTATAC
CTTTCAAAGAACTCCTGAAGCAACTTAACTCATCATTTCAGCCTCTGAGTAGAGGTAAAACCTATGTGTACTTCTGTTTATGATCCATAT
TGATATTTATGACATGAACACAGAATAGTACCTTACATTTGCTAAACAGACAGTTAATATCAAATCCTTTCAATATTCTGGGAACCCAGG
GAAGTTTTTAAAAATGTCATTACTTTCAAAGGAACAGAAGTAGTTAACCAAACTAACAAGCAAAACCTGAGGTTTACCTAGTGACACCAA
ATTATCGGTATTTTAACTGAATTTACCCATTGACTAAGAATGAACCAGATTTGGTGGTGGTTTTGTTTCTATGCAAACTGGACACAAATT
ACAACAGTAAATTTTTTTATAAGTGCTTCTCCCTTCTCCATGATGTGACTTCCGGAGATAAAGGATTCAAAAGATAAAGACAAAGTACGC
TCAGAGTTGTTAACCAGAAAGTCCTGGCTGTGGTTGCAGAAACACTGTTGGAAGAAAAGAGATGACTAAGTCAAGTGTCTGCCTTATCAA
AAGAGCAAAAATGCCTCTGGTTTTGTGTTTGGGAGAAAAGTATCTTGGACGCACTGTTTTCCTTGATAAAAGTCATCTTCTCTACTGTGT
GAAATGAATACTTGGAATTCTAATTGTTTTGTGTGCCAGGGGCAGTAATGTCCCTGCCTCTTCTCCCAATCAAGGTTGAGGAGTGGGGCT
GGGGAGAGGACTTAACTGACTTAAGAAGTAGGAAAACAAAAACCTCTCTCCTCAGCCTTCCACCTCCAAGAGAGGAGGAAAAACAGTTGT
CTGCTGTCTGTAATTCAGTTTGCGTGTATTTTATGCTCATGCACCAACCCATACAGAGTAAATCTTTTATCAACTGTATACTGGTGTTTA
ATAGAGAATGATTGTCTTCCGAGTTTTTTGGTTCCTTTTTTAACTGTGTTAAAGTACTTGAAATGTATTGACTGCTGACTATATTTTAAA
AACAAAATGAAATAATTTGAGTTGTATTACAGAGGTTGACATTGTTCAGGGATGGGACAAAGCCTTCTTCAATCCTTTTCATACTACTTA
ATGATTTTGGTGCAGGAACCTGAGATTTTCTGATTTATATTTCATGATATTTCACATTTGCTCTTCACAGCATGAGCATGAAGCCCAGTG
GCACCAAATGGCTGGGTACAATCAAGTGATATTTTGTAGCACCTCACTATCTGAAAGGCCATGAGTTTTCAGATGATTTCATTGAGCTTC
ATTGCAGCCTGAAATTTTAAAAAAGTTGTGTAATACGCCAACCAGTCAAGTTGTGTTTTGGCCAGAGATTTAGATATGTCCAATTTCCTG
GCTCATTTCATTGTGCTCTATGGGTACGTATAAAAAGCAAGAATTCTGTTTCCTAGGCAAACATTGCAACTCAGGGCTAAAGTCATCCAG
TGAAACTTTTAGAGCCAGAAGTAACTTTGTCCCAGTCCTACAATGTGAAAAGAGTGAATAGTTGCCTCTTTTTAGCCATTTTCATGGCTG
GTACATATTCGTACGCATTACTTTTCAGAATCAATACGCACTTTCAGATATTCTTATTTTTATTCTCTTAAGTCTTTATTAACTTTGGAG
AGAGAAATGATGCATCTTTTTATTTTAAATGAAGTAGATCAACATGGTGGAACAAAATGATAAAGAACAGAAAACATTTCAATATATTAC
TAATAACTTTTTCCAATATAAATCCTAAAATTCCTATAACATAGTATTTTACAGTTTTATGAAGCTTTCTATTGTGACTTTTATGGAATT

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000351898_chr4_72399944_+_1972nt
TCACAGAGCGAGAAGGTGTCAGGAGCAGCCCAGTTGTGTCTCTCTCTCTACCTCTGTGAAGGGCGCGAATGGGCAGAGCAGAACTTCTAG
AAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTCCAGGACTTGGGGTGGTATCACG
GCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTGAGGGACAGCAATGAGACCACCG
GGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATATTCATTTAAATTTGGCTTTAATG
AATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGCACTCTGATGGTTCTAAAACATC
CCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACAGGAAGAACAGAAGATGACCTTG
TGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCCTGGTGGGTGTGCCTTGCTGCTG
CTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAACAGGAAAGAACATAAACTCAAGT
TTATACCCATGCCTGTACTCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAGCTGC
TTCTGATGCCTCTGAAGCATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAGGTGT
TGTGTCTGGCCCTGCTTTGGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGAAAAG
GCATGGACTACCTCTTCTCCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAGAAGA
AAAAGAAAAAGAAGAAGGGAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGTATTAAAATTCCAA
TGGACATCATGGAACAGCAACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACATTCCTTGAACGCCACACATCAT
GCTGATAAAATTCCTTTCCTTCAGTCACTCGGTATGCCAAGTCCTCCTAGAACTCCAGTAAAAGTTGTGCCTCAAATTAGAATAGAACTT
GAACCTGAAGACAATGATTATTTCTGGAGGAGCAAGGGAACAGAAACTACATTGTAACCTGTTTGTCTTTCTTAAAACTGACATTTGTTG
TTAATGTCATTTGTTTTTGTTTGGCTGTTTGTTTATTTTTTAACTTTTATTTCGTCTCAGTTTTTGGTCACAGGCCAAATAATACAGCGC
TCTCTCTGCTTCTCTCTTGCATAGACACAATCAAGACAATAGTGCACCGTTCCTTAAAAACAGCATCTGAGGAATCCCCCTTTTGTTCTT
AAACTTTCAGATGTGTCCTTTGATAACCAAATTCTGTCACTCAAGACACAGACACGCACAGACCCTGTCCTTTGCCTCTATTAAGCAGAG
GATGGAAGTATTAAGGATTTTGTAACACCTTTTATGAAAATGTTGAAGGAACTTAAAACTTTAGCTTTGGAGCTGTGCTTACTGGCTTGT
CTTTGTCTGGTAGAACAAACCTTGACCTCCAGACAGAGTCCCTTCTCACTTATAGAGCTCTCCAGGACTGGAAAAAGTGCTGCTATTTTA

>In-frame_DAPP1_ENST00000512369_chr4_100774505_+_SLC4A4_ENST00000340595_chr4_72399944_+_5853nt
TCACAGAGCGAGAAGGTGTCAGGAGCAGCCCAGTTGTGTCTCTCTCTCTACCTCTGTGAAGGGCGCGAATGGGCAGAGCAGAACTTCTAG
AAGGGAAGATGAGCACCCAGGATCCCTCAGATCTGTGGAGCAGATCCGATGGAGAGGCTGAGCTGCTCCAGGACTTGGGGTGGTATCACG
GCAACCTCACACGCCATGCTGCTGAAGCTCTTCTCCTCTCAAATGGATGTGACGGCAGCTACCTTCTGAGGGACAGCAATGAGACCACCG
GGCTGTACTCTCTCTCTGTGAGGGCCAAAGATTCTGTTAAACACTTTCATGTTGAATATACTGGATATTCATTTAAATTTGGCTTTAATG
AATTCTCATCTTTGAAGGATTTTGTCAAGCATTTTGCAAATCAGCCTTTGATTGGAAGCGAGACAGGCACTCTGATGGTTCTAAAACATC
CCTACCCAAGAAAAGTGGAAGAACCCTCCATTTATGAATCTGTCCGGGTTCACACAGCAATGCAGACAGGAAGAACAGAAGATGACCTTG
TGCCCACAGCACCTTCTCCAACAAGTCCAAACCGAGGTTGGTTCGTTCCACCGTTTGGAGAAAACCCCTGGTGGGTGTGCCTTGCTGCTG
CTATCCCGGCTTTGTTGGTCACTATACTGATTTTCATGGACCAACAAATTACAGCTGTGATTGTAAACAGGAAAGAACATAAACTCAAGA
AAGGAGCAGGGTATCACTTGGATCTCTTTTGGGTGGCCATCCTCATGGTTATATGCTCCCTCATGGCTCTTCCGTGGTATGTAGCTGCTA
CGGTCATCTCCATTGCTCACATCGACAGTTTGAAGATGGAGACAGAGACTTCTGCACCTGGAGAACAACCAAAGTTTCTAGGAGTGAGGG
AACAAAGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGTCTGTCAGTCTTTATGGCTCCCATCTTGAAGTTTATACCCATGCCTGTAC
TCTATGGTGTGTTCCTGTATATGGGAGTAGCATCCCTTAATGGTGTGCAGTTCATGGATCGTCTGAAGCTGCTTCTGATGCCTCTGAAGC
ATCAGCCTGACTTCATCTACCTGCGTCATGTTCCTCTGCGCAGAGTCCACCTGTTCACTTTCCTGCAGGTGTTGTGTCTGGCCCTGCTTT
GGATCCTCAAGTCAACGGTGGCTGCTATCATTTTTCCAGTAATGATCTTGGCACTTGTAGCTGTCAGAAAAGGCATGGACTACCTCTTCT
CCCAGCACGACCTCAGCTTCCTGGATGATGTCATTCCAGAAAAGGACAAGAAAAAGAAGGAGGATGAGAAGAAAAAGAAAAAGAAGAAGG
GAAGTCTGGACAGTGACAATGATGATTCTGACTGCCCATACTCAGAAAAAGTTCCAAGTATTAAAATTCCAATGGACATCATGGAACAGC
AACCTTTCCTAAGCGATAGCAAACCTTCTGACAGAGAAAGATCACCAACATTCCTTGAACGCCACACATCATGCTGATAAAATTCCTTTC
CTTCAGTCACTCGGTATGCCAAGTCCTCCTAGAACTCCAGTAAAAGTTGTGCCTCAAATTAGAATAGAACTTGAACCTGAAGACAATGAT
TATTTCTGGAGGAGCAAGGGAACAGAAACTACATTGTAACCTGTTTGTCTTTCTTAAAACTGACATTTGTTGTTAATGTCATTTGTTTTT
GTTTGGCTGTTTGTTTATTTTTTAACTTTTATTTCGTCTCAGTTTTTGGTCACAGGCCAAATAATACAGCGCTCTCTCTGCTTCTCTCTT
GCATAGACACAATCAAGACAATAGTGCACCGTTCCTTAAAAACAGCATCTGAGGAATCCCCCTTTTGTTCTTAAACTTTCAGATGTGTCC
TTTGATAACCAAATTCTGTCACTCAAGACACAGACACGCACAGACCCTGTCCTTTGCCTCTATTAAGCAGAGGATGGAAGTATTAAGGAT
TTTGTAACACCTTTTATGAAAATGTTGAAGGAACTTAAAACTTTAGCTTTGGAGCTGTGCTTACTGGCTTGTCTTTGTCTGGTAGAACAA
ACCTTGACCTCCAGACAGAGTCCCTTCTCACTTATAGAGCTCTCCAGGACTGGAAAAAGTGCTGCTATTTTAACTTGCTCTTGCTTGTAA
ATCCTAATCTTAGAGTTATCAAAAGAAGAAAAAACTGAAGGTACTTTACTCCCTATAGAGAAACCATTGCCATCATTGTAGCAAGTGCTG
GAATGTCCCTTTTTTCCTATGCAACTTTTTTTAACCCTTTAATGAACTTATCTGTTGAGTACATTGAAGAATATTTTTCTTCCTAGATTT
TGTTGTTTAAATTATGGGGCCTAACCTGCCACTTATTTTTTGTCAATTTTTAAAACTTTTTTTTAATTACTGTAAAGAAAATGAATTTTT
TCCTGCAGCAGGAAACATAGTTTTGAGTAGTTCTACCTCTTATTTGTAGCTGCCAGGCTTTCTGTAAAAATTGTATTGTATATAATGTGA
TTTTTACACATACATACACACACAAATACACAATCTCTAGGGTAAGCCAGAAGGCAAGATCAGATTAAAAACACCATGTTTCTAAGCATC
CATTTTTCCCTTTCTTTAAAAGAAACTTAACTGTTCTATGAAGGAGATTGAGGGAGAAGAGACAAACTCCTATGTCATGAGAATAACCGA
TGTTCTGATAATAGTAGCATCTAGGTACAGATGCTGGTTGTATTACCACGTCAATGTCCTATGCAGTATTGTTAGACATTTTCTCATTTT
GAAATATTTGTGTGTTTGTGTATGTGCTCTGTGCCATGGCTGGTGTATATATGTGCAATGTTAGAAGGCAAAAGAGTGATGGTAGGCAGA
GGGCAAAGTCATTGAATCTCTTATGCCAGTTTTCATAAAACCCAAACCACATATGAAAAAATCCATTAAGGGTCCAAGAAGTCTGTCCAT
ATGAAAATGAGGGTAAATATAGTTTATTTCCCAGGTATCAGTCATTATAATTGATATAATAGCTCTAACATGCAATATAAAATTCATAGG
AGTATTAATAGCCCATTTACACATCTATAAAATGTAATGGGATTGCAGAGCTGCAGAGTACAGTGTAACAGTACTCTCATGCAATTTTTT
TCAGGATGCAAAGGCAATTATTCTTTGTAAGCGGGACATTTAGAATATATTTGTGTACATATTATATGTATGTATATTTCAAAGTACCAC
ACTGAAAATTAGACATTTATTAACCAAATTTAACGTGGTATTTAAAGGTAATATTTTTAATATGATACATTACATATTGTGAATGTATAC
TAAAAAAACATTTTAAATGTTAAAATTATAATTTCAGATTCATATAACCACAACTGTGATATATCCTAACTATAACCAGTTGTTGAGGGG
TATACTAGAAGCAGAATGAAACCACATTTTTTGGTTTGATAATATGCACTTATTGACTCCCACTCATTGTTATGTTAATTAAGTTATTAT
TCTGTCTCCTTGTAATTTTGATTACAAAAATTTTATTATCCTGAGTTAGCTGTTACTTTTACAGTACCTGATACTCCTAAAACTTTTAAC
TTATACAAATTAGTCAATAATGACCCCAATTTTTTCATTAAAATAATAGTGGTGAATTATATGTTATTGTGTTAAAACCTCACTTGCCAA
ATTCTGGCTTCACATTTGTATTTAGGGCTATCCTTAAAATGATGAGTCTATATTATCTAGCTTTCTATTACCCTAATATAAACTGGTATA
AGAAGACTTTCCTTTTTTCTTTATGCATGGAAGCATCAATAAATTGTTTAAAAACCATGTATAGTAAATTCAGCTTAACCCGTGATCTTC
TTAAGTTAAAGGTACTTTTGTTTTATAAAAGCTCTAGATAAAACTTTCTTTTCTGATCATGAATCAAGTATCTGTGGTTTCATGCCCCTC
TCTATACCTTTCAAAGAACTCCTGAAGCAACTTAACTCATCATTTCAGCCTCTGAGTAGAGGTAAAACCTATGTGTACTTCTGTTTATGA
TCCATATTGATATTTATGACATGAACACAGAATAGTACCTTACATTTGCTAAACAGACAGTTAATATCAAATCCTTTCAATATTCTGGGA
ACCCAGGGAAGTTTTTAAAAATGTCATTACTTTCAAAGGAACAGAAGTAGTTAACCAAACTAACAAGCAAAACCTGAGGTTTACCTAGTG
ACACCAAATTATCGGTATTTTAACTGAATTTACCCATTGACTAAGAATGAACCAGATTTGGTGGTGGTTTTGTTTCTATGCAAACTGGAC
ACAAATTACAACAGTAAATTTTTTTATAAGTGCTTCTCCCTTCTCCATGATGTGACTTCCGGAGATAAAGGATTCAAAAGATAAAGACAA
AGTACGCTCAGAGTTGTTAACCAGAAAGTCCTGGCTGTGGTTGCAGAAACACTGTTGGAAGAAAAGAGATGACTAAGTCAAGTGTCTGCC
TTATCAAAAGAGCAAAAATGCCTCTGGTTTTGTGTTTGGGAGAAAAGTATCTTGGACGCACTGTTTTCCTTGATAAAAGTCATCTTCTCT
ACTGTGTGAAATGAATACTTGGAATTCTAATTGTTTTGTGTGCCAGGGGCAGTAATGTCCCTGCCTCTTCTCCCAATCAAGGTTGAGGAG
TGGGGCTGGGGAGAGGACTTAACTGACTTAAGAAGTAGGAAAACAAAAACCTCTCTCCTCAGCCTTCCACCTCCAAGAGAGGAGGAAAAA
CAGTTGTCTGCTGTCTGTAATTCAGTTTGCGTGTATTTTATGCTCATGCACCAACCCATACAGAGTAAATCTTTTATCAACTGTATACTG
GTGTTTAATAGAGAATGATTGTCTTCCGAGTTTTTTGGTTCCTTTTTTAACTGTGTTAAAGTACTTGAAATGTATTGACTGCTGACTATA
TTTTAAAAACAAAATGAAATAATTTGAGTTGTATTACAGAGGTTGACATTGTTCAGGGATGGGACAAAGCCTTCTTCAATCCTTTTCATA
CTACTTAATGATTTTGGTGCAGGAACCTGAGATTTTCTGATTTATATTTCATGATATTTCACATTTGCTCTTCACAGCATGAGCATGAAG
CCCAGTGGCACCAAATGGCTGGGTACAATCAAGTGATATTTTGTAGCACCTCACTATCTGAAAGGCCATGAGTTTTCAGATGATTTCATT
GAGCTTCATTGCAGCCTGAAATTTTAAAAAAGTTGTGTAATACGCCAACCAGTCAAGTTGTGTTTTGGCCAGAGATTTAGATATGTCCAA
TTTCCTGGCTCATTTCATTGTGCTCTATGGGTACGTATAAAAAGCAAGAATTCTGTTTCCTAGGCAAACATTGCAACTCAGGGCTAAAGT
CATCCAGTGAAACTTTTAGAGCCAGAAGTAACTTTGTCCCAGTCCTACAATGTGAAAAGAGTGAATAGTTGCCTCTTTTTAGCCATTTTC
ATGGCTGGTACATATTCGTACGCATTACTTTTCAGAATCAATACGCACTTTCAGATATTCTTATTTTTATTCTCTTAAGTCTTTATTAAC
TTTGGAGAGAGAAATGATGCATCTTTTTATTTTAAATGAAGTAGATCAACATGGTGGAACAAAATGATAAAGAACAGAAAACATTTCAAT
ATATTACTAATAACTTTTTCCAATATAAATCCTAAAATTCCTATAACATAGTATTTTACAGTTTTATGAAGCTTTCTATTGTGACTTTTA
TGGAATTAAGAGATGAAGAAGATGAGATATTTTAGCATTTATATTTTTCAAAATTATATGTATACTTAAAAATAAAGTAACTTTATGCAT


Top

FusionGenePPI for DAPP1_SLC4A4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DAPP1ERBB3, HSPA1A, RPL23, FCHSD2, HSD3B7, GSTCD, MYLIP, WDR20, TNFAIP1, ZNHIT1, CNDP2, MGARP, RBP7, TM4SF19, APBB3, PLAGL2SLC4A4SREBF2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000340595+1323748_7797162318CA4
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000512686+011748_779-66647CA4


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000264485+1626748_7797601684CA4
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000351898+1624748_7797601194CA4
TgeneSLC4A4chr4:100774505chr4:72399944ENST00000425175+1625748_7797601095CA4


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DAPP1_SLC4A4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DAPP1_SLC4A4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneDAPP1C0029408Degenerative polyarthritis1CTD_human
TgeneSLC4A4C1970309Renal Tubular Acidosis, Proximal, With Ocular Abnormalities And Mental Retardation3CTD_human;ORPHANET;UNIPROT
TgeneSLC4A4C0001126Renal tubular acidosis1CTD_human
TgeneSLC4A4C0008073Developmental Disabilities1CTD_human
TgeneSLC4A4C0010038Corneal Opacity1CTD_human
TgeneSLC4A4C0017601Glaucoma1CTD_human;HPO
TgeneSLC4A4C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneSLC4A4C0086543Cataract1CTD_human;HPO