FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9217

FusionGeneSummary for DAAM1_C12orf10

check button Fusion gene summary
Fusion gene informationFusion gene name: DAAM1_C12orf10
Fusion gene ID: 9217
HgeneTgene
Gene symbol

DAAM1

C12orf10

Gene ID

23002

60314

Gene namedishevelled associated activator of morphogenesis 1chromosome 12 open reading frame 10
Synonyms-Gamm1|MST024|MSTP024|MYG|MYG1
Cytomap

14q23.1

12q13.13

Type of geneprotein-codingprotein-coding
Descriptiondisheveled-associated activator of morphogenesis 1UPF0160 protein MYG1, mitochondrialmelanocyte proliferating gene 1melanocyte related
Modification date2018051920180523
UniProtAcc

Q9Y4D1

Q9HB07

Ensembl transtripts involved in fusion geneENST00000360909, ENST00000351081, 
ENST00000395125, ENST00000556135, 
ENST00000553966, 
ENST00000267103, 
ENST00000548632, ENST00000549488, 
Fusion gene scores* DoF score8 X 7 X 5=2807 X 7 X 5=245
# samples 1011
** MAII scorelog2(10/280*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/245*10)=-1.15527822547791
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: DAAM1 [Title/Abstract] AND C12orf10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-EE-A2A6-06ADAAM1chr14

59798638

+C12orf10chr12

53699692

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000360909ENST00000267103DAAM1chr14

59798638

+C12orf10chr12

53699692

+
5CDS-intronENST00000360909ENST00000548632DAAM1chr14

59798638

+C12orf10chr12

53699692

+
5CDS-intronENST00000360909ENST00000549488DAAM1chr14

59798638

+C12orf10chr12

53699692

+
In-frameENST00000351081ENST00000267103DAAM1chr14

59798638

+C12orf10chr12

53699692

+
5CDS-intronENST00000351081ENST00000548632DAAM1chr14

59798638

+C12orf10chr12

53699692

+
5CDS-intronENST00000351081ENST00000549488DAAM1chr14

59798638

+C12orf10chr12

53699692

+
In-frameENST00000395125ENST00000267103DAAM1chr14

59798638

+C12orf10chr12

53699692

+
5CDS-intronENST00000395125ENST00000548632DAAM1chr14

59798638

+C12orf10chr12

53699692

+
5CDS-intronENST00000395125ENST00000549488DAAM1chr14

59798638

+C12orf10chr12

53699692

+
intron-3CDSENST00000556135ENST00000267103DAAM1chr14

59798638

+C12orf10chr12

53699692

+
intron-intronENST00000556135ENST00000548632DAAM1chr14

59798638

+C12orf10chr12

53699692

+
intron-intronENST00000556135ENST00000549488DAAM1chr14

59798638

+C12orf10chr12

53699692

+
intron-3CDSENST00000553966ENST00000267103DAAM1chr14

59798638

+C12orf10chr12

53699692

+
intron-intronENST00000553966ENST00000548632DAAM1chr14

59798638

+C12orf10chr12

53699692

+
intron-intronENST00000553966ENST00000549488DAAM1chr14

59798638

+C12orf10chr12

53699692

+

Top

FusionProtFeatures for DAAM1_C12orf10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DAAM1

Q9Y4D1

C12orf10

Q9HB07

Binds to disheveled (Dvl) and Rho, and mediates Wnt-induced Dvl-Rho complex formation. May play a role as ascaffolding protein to recruit Rho-GDP and Rho-GEF, therebyenhancing Rho-GTP formation. Can direct nucleation and elongationof new actin filaments. Involved in building functional cilia(PubMed:16630611, PubMed:17482208). Involved in the organizationof the subapical actin network in multiciliated epithelial cells(By similarity). Together with DAAM2, required for myocardialmaturation and sarcomere assembly (By similarity).{ECO:0000250|UniProtKB:B0DOB5, ECO:0000250|UniProtKB:Q8BPM0,ECO:0000269|PubMed:16630611, ECO:0000269|PubMed:17482208}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDAAM1chr14:59798638chr12:53699692ENST00000351081+1526437_5266561079Coiled coilOntology_term=ECO:0000255
HgeneDAAM1chr14:59798638chr12:53699692ENST00000360909+1525437_5266561069Coiled coilOntology_term=ECO:0000255
HgeneDAAM1chr14:59798638chr12:53699692ENST00000395125+1425437_5266561079Coiled coilOntology_term=ECO:0000255
HgeneDAAM1chr14:59798638chr12:53699692ENST00000351081+1526528_5936561079Compositional biasNote=Pro-rich
HgeneDAAM1chr14:59798638chr12:53699692ENST00000360909+1525528_5936561069Compositional biasNote=Pro-rich
HgeneDAAM1chr14:59798638chr12:53699692ENST00000395125+1425528_5936561079Compositional biasNote=Pro-rich
HgeneDAAM1chr14:59798638chr12:53699692ENST00000351081+152645_4206561079DomainGBD/FH3
HgeneDAAM1chr14:59798638chr12:53699692ENST00000351081+1526528_5996561079DomainNote=FH1
HgeneDAAM1chr14:59798638chr12:53699692ENST00000360909+152545_4206561069DomainGBD/FH3
HgeneDAAM1chr14:59798638chr12:53699692ENST00000360909+1525528_5996561069DomainNote=FH1
HgeneDAAM1chr14:59798638chr12:53699692ENST00000395125+142545_4206561079DomainGBD/FH3
HgeneDAAM1chr14:59798638chr12:53699692ENST00000395125+1425528_5996561079DomainNote=FH1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDAAM1chr14:59798638chr12:53699692ENST00000351081+15261027_10586561079DomainDAD
HgeneDAAM1chr14:59798638chr12:53699692ENST00000351081+1526600_10096561079DomainFH2
HgeneDAAM1chr14:59798638chr12:53699692ENST00000360909+15251027_10586561069DomainDAD
HgeneDAAM1chr14:59798638chr12:53699692ENST00000360909+1525600_10096561069DomainFH2
HgeneDAAM1chr14:59798638chr12:53699692ENST00000395125+14251027_10586561079DomainDAD
HgeneDAAM1chr14:59798638chr12:53699692ENST00000395125+1425600_10096561079DomainFH2
HgeneDAAM1chr14:59798638chr12:53699692ENST00000351081+1526693_7026561079RegionNote=Actin-binding
HgeneDAAM1chr14:59798638chr12:53699692ENST00000360909+1525693_7026561069RegionNote=Actin-binding
HgeneDAAM1chr14:59798638chr12:53699692ENST00000395125+1425693_7026561079RegionNote=Actin-binding


Top

FusionGeneSequence for DAAM1_C12orf10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DAAM1_ENST00000360909_chr14_59798638_+_C12orf10_ENST00000267103_chr12_53699692_+_870aa
MAPRKRGGRGISFIFCCFRNNDHPEITTRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKK
KDQEENKGATSWPEFYIDQLNSMAARKSLLALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTS
LIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKTASERTRFQTLINDLDKSTGR
TRDEVSLKTAIMSFINAVLSQGAGVESLDFRLHLRTEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFELVHIDTKSA
TQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKE
QAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPF
PSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTE
IDDTKVFKILDLEDLERTFSATQRQQMTENFVEEVDAVDNGISQWAEGEPRTALTTTLSARVARLNPTWNHPDQDTEAGFKRAMDLVQEE
FLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLESGLSPPVAIFFVIYTDQAGQWRIQCVPKEPHSFQSRL

>In-frame_DAAM1_ENST00000351081_chr14_59798638_+_C12orf10_ENST00000267103_chr12_53699692_+_870aa
MAPRKRGGRGISFIFCCFRNNDHPEITTRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKK
KDQEENKGATSWPEFYIDQLNSMAARKSLLALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTS
LIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKTASERTRFQTLINDLDKSTGR
TRDEVSLKTAIMSFINAVLSQGAGVESLDFRLHLRTEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFELVHIDTKSA
TQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKE
QAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPF
PSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTE
IDDTKVFKILDLEDLERTFSATQRQQMTENFVEEVDAVDNGISQWAEGEPRTALTTTLSARVARLNPTWNHPDQDTEAGFKRAMDLVQEE
FLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLESGLSPPVAIFFVIYTDQAGQWRIQCVPKEPHSFQSRL

>In-frame_DAAM1_ENST00000395125_chr14_59798638_+_C12orf10_ENST00000267103_chr12_53699692_+_870aa
MAPRKRGGRGISFIFCCFRNNDHPEITTRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKK
KDQEENKGATSWPEFYIDQLNSMAARKSLLALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTS
LIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKTASERTRFQTLINDLDKSTGR
TRDEVSLKTAIMSFINAVLSQGAGVESLDFRLHLRTEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFELVHIDTKSA
TQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKE
QAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPF
PSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTE
IDDTKVFKILDLEDLERTFSATQRQQMTENFVEEVDAVDNGISQWAEGEPRTALTTTLSARVARLNPTWNHPDQDTEAGFKRAMDLVQEE
FLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLESGLSPPVAIFFVIYTDQAGQWRIQCVPKEPHSFQSRL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DAAM1_ENST00000360909_chr14_59798638_+_C12orf10_ENST00000267103_chr12_53699692_+_2610nt
ATGGCCCCAAGAAAGAGAGGTGGACGAGGTATTTCATTCATCTTTTGCTGTTTCCGAAATAATGATCACCCAGAAATCACGTATCGGCTG
CGAAATGATAGCAACTTTGCGCTTCAGACCATGGAACCAGCATTGCCCATGCCCCCTGTGGAGGAGCTGGATGTCATGTTCAGTGAACTG
GTGGATGAACTGGACCTCACAGACAAACACAGAGAAGCCATGTTTGCACTTCCAGCTGAGAAAAAATGGCAAATATACTGTAGCAAGAAA
AAGGACCAGGAAGAAAACAAGGGAGCTACAAGTTGGCCTGAATTCTACATTGATCAGCTCAATTCCATGGCTGCTAGAAAATCTCTGCTG
GCTTTAGAGAAGGAAGAAGAAGAAGAAAGAAGTAAAACTATAGAGAGTTTAAAGACAGCACTGAGGACAAAACCAATGAGGTTTGTAACC
AGATTCATCGACTTGGATGGCCTATCATGTATCCTCAACTTTCTAAAGACCATGGACTACGAGACCTCAGAGTCTCGAATACATACTTCT
CTCATTGGCTGTATAAAGGCGTTAATGAACAACTCTCAAGGCCGGGCTCACGTCCTGGCTCATTCTGAGAGTATTAATGTAATTGCTCAG
AGTCTGAGCACAGAGAACATTAAAACGAAGGTGGCCGTGCTGGAAATCTTGGGCGCCGTGTGCCTGGTTCCCGGGGGCCACAAGAAGGTT
CTGCAGGCCATGCTGCACTACCAGAAGTATGCCAGCGAAAGGACCCGCTTTCAGACATTAATTAACGACTTGGATAAAAGCACTGGGCGG
TATCGAGATGAAGTGAGTCTCAAGACTGCCATCATGTCCTTCATTAATGCAGTGCTCAGCCAAGGTGCAGGAGTGGAGAGTTTGGACTTT
AGACTTCATCTTCGCTATGAATTTCTGATGTTAGGAATTCAACCTGTAATAGATAAATTAAGGGAACACGAAAATTCAACATTAGATAGG
CATTTAGACTTTTTTGAAATGCTCCGAAATGAAGATGAACTAGAATTTGCCAAAAGATTTGAACTGGTTCACATAGACACAAAAAGTGCA
ACTCAGATGTTTGAGCTGACCAGGAAGAGGCTGACACATAGTGAAGCTTACCCGCATTTCATGTCCATCCTGCACCACTGCCTCCAAATG
CCTTACAAGAGGAGTGGCAACACTGTTCAGTACTGGCTACTACTAGATAGAATTATACAGCAGATAGTTATCCAGAATGACAAAGGACAG
GACCCTGACTCCACACCTTTGGAAAACTTTAATATTAAGAATGTCGTACGAATGTTGGTTAATGAAAATGAAGTTAAGCAGTGGAAAGAA
CAAGCGGAAAAAATGAGAAAAGAGCACAATGAGCTACAACAGAAACTGGAAAAGAAAGAACGAGAATGTGATGCTAAGACTCAAGAGAAG
GAAGAGATGATGCAGACCTTAAATAAAATGAAAGAGAAACTTGAAAAGGAGACTACTGAGCATAAGCAAGTCAAGCAGCAGGTGGCGGAC
CTCACAGCACAGCTCCATGAGCTCAGCAGGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTT
CCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCT
CCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAG
AAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAA
ATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGATGTATGAGAAC
TTTGTGGAGGAGGTGGATGCTGTGGACAATGGGATCTCCCAGTGGGCAGAGGGGGAGCCTCGATATGCACTGACCACTACCCTGAGTGCA
CGAGTTGCTCGACTTAATCCTACCTGGAACCACCCCGACCAAGACACTGAGGCAGGGTTCAAGCGTGCAATGGATCTGGTTCAAGAGGAG
TTTCTGCAGAGATTAGATTTCTACCAACACAGCTGGCTGCCAGCCCGGGCCTTGGTGGAAGAGGCCCTTGCCCAGCGATTCCAGGTGGAC
CCAAGTGGAGAGATTGTGGAACTGGCGAAAGGTGCATGTCCCTGGAAGGAGCATCTCTACCACCTGGAATCTGGGCTGTCCCCTCCAGTG
GCCATCTTCTTTGTTATCTACACTGACCAGGCTGGACAGTGGCGAATACAGTGTGTGCCCAAGGAGCCCCACTCATTCCAAAGCCGGCTG
CCCCTGCCAGAGCCATGGCGGGGTCTTCGGGACGAGGCCCTGGACCAGGTCAGTGGGATCCCTGGCTGCATCTTCGTCCATGCAAGCGGC
TTCACTGGCGGTCACCACACCCGAGAGGGTGCCTTGAGCATGGCCCGTGCCACCTTGGCCCAGCGCTCATACCTCCCACAAATCTCCTAG

>In-frame_DAAM1_ENST00000351081_chr14_59798638_+_C12orf10_ENST00000267103_chr12_53699692_+_2610nt
ATGGCCCCAAGAAAGAGAGGTGGACGAGGTATTTCATTCATCTTTTGCTGTTTCCGAAATAATGATCACCCAGAAATCACGTATCGGCTG
CGAAATGATAGCAACTTTGCGCTTCAGACCATGGAACCAGCATTGCCCATGCCCCCTGTGGAGGAGCTGGATGTCATGTTCAGTGAACTG
GTGGATGAACTGGACCTCACAGACAAACACAGAGAAGCCATGTTTGCACTTCCAGCTGAGAAAAAATGGCAAATATACTGTAGCAAGAAA
AAGGACCAGGAAGAAAACAAGGGAGCTACAAGTTGGCCTGAATTCTACATTGATCAGCTCAATTCCATGGCTGCTAGAAAATCTCTGCTG
GCTTTAGAGAAGGAAGAAGAAGAAGAAAGAAGTAAAACTATAGAGAGTTTAAAGACAGCACTGAGGACAAAACCAATGAGGTTTGTAACC
AGATTCATCGACTTGGATGGCCTATCATGTATCCTCAACTTTCTAAAGACCATGGACTACGAGACCTCAGAGTCTCGAATACATACTTCT
CTCATTGGCTGTATAAAGGCGTTAATGAACAACTCTCAAGGCCGGGCTCACGTCCTGGCTCATTCTGAGAGTATTAATGTAATTGCTCAG
AGTCTGAGCACAGAGAACATTAAAACGAAGGTGGCCGTGCTGGAAATCTTGGGCGCCGTGTGCCTGGTTCCCGGGGGCCACAAGAAGGTT
CTGCAGGCCATGCTGCACTACCAGAAGTATGCCAGCGAAAGGACCCGCTTTCAGACATTAATTAACGACTTGGATAAAAGCACTGGGCGG
TATCGAGATGAAGTGAGTCTCAAGACTGCCATCATGTCCTTCATTAATGCAGTGCTCAGCCAAGGTGCAGGAGTGGAGAGTTTGGACTTT
AGACTTCATCTTCGCTATGAATTTCTGATGTTAGGAATTCAACCTGTAATAGATAAATTAAGGGAACACGAAAATTCAACATTAGATAGG
CATTTAGACTTTTTTGAAATGCTCCGAAATGAAGATGAACTAGAATTTGCCAAAAGATTTGAACTGGTTCACATAGACACAAAAAGTGCA
ACTCAGATGTTTGAGCTGACCAGGAAGAGGCTGACACATAGTGAAGCTTACCCGCATTTCATGTCCATCCTGCACCACTGCCTCCAAATG
CCTTACAAGAGGAGTGGCAACACTGTTCAGTACTGGCTACTACTAGATAGAATTATACAGCAGATAGTTATCCAGAATGACAAAGGACAG
GACCCTGACTCCACACCTTTGGAAAACTTTAATATTAAGAATGTCGTACGAATGTTGGTTAATGAAAATGAAGTTAAGCAGTGGAAAGAA
CAAGCGGAAAAAATGAGAAAAGAGCACAATGAGCTACAACAGAAACTGGAAAAGAAAGAACGAGAATGTGATGCTAAGACTCAAGAGAAG
GAAGAGATGATGCAGACCTTAAATAAAATGAAAGAGAAACTTGAAAAGGAGACTACTGAGCATAAGCAAGTCAAGCAGCAGGTGGCGGAC
CTCACAGCACAGCTCCATGAGCTCAGCAGGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTT
CCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCT
CCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAG
AAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAA
ATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGATGTATGAGAAC
TTTGTGGAGGAGGTGGATGCTGTGGACAATGGGATCTCCCAGTGGGCAGAGGGGGAGCCTCGATATGCACTGACCACTACCCTGAGTGCA
CGAGTTGCTCGACTTAATCCTACCTGGAACCACCCCGACCAAGACACTGAGGCAGGGTTCAAGCGTGCAATGGATCTGGTTCAAGAGGAG
TTTCTGCAGAGATTAGATTTCTACCAACACAGCTGGCTGCCAGCCCGGGCCTTGGTGGAAGAGGCCCTTGCCCAGCGATTCCAGGTGGAC
CCAAGTGGAGAGATTGTGGAACTGGCGAAAGGTGCATGTCCCTGGAAGGAGCATCTCTACCACCTGGAATCTGGGCTGTCCCCTCCAGTG
GCCATCTTCTTTGTTATCTACACTGACCAGGCTGGACAGTGGCGAATACAGTGTGTGCCCAAGGAGCCCCACTCATTCCAAAGCCGGCTG
CCCCTGCCAGAGCCATGGCGGGGTCTTCGGGACGAGGCCCTGGACCAGGTCAGTGGGATCCCTGGCTGCATCTTCGTCCATGCAAGCGGC
TTCACTGGCGGTCACCACACCCGAGAGGGTGCCTTGAGCATGGCCCGTGCCACCTTGGCCCAGCGCTCATACCTCCCACAAATCTCCTAG

>In-frame_DAAM1_ENST00000395125_chr14_59798638_+_C12orf10_ENST00000267103_chr12_53699692_+_2610nt
ATGGCCCCAAGAAAGAGAGGTGGACGAGGTATTTCATTCATCTTTTGCTGTTTCCGAAATAATGATCACCCAGAAATCACGTATCGGCTG
CGAAATGATAGCAACTTTGCGCTTCAGACCATGGAACCAGCATTGCCCATGCCCCCTGTGGAGGAGCTGGATGTCATGTTCAGTGAACTG
GTGGATGAACTGGACCTCACAGACAAACACAGAGAAGCCATGTTTGCACTTCCAGCTGAGAAAAAATGGCAAATATACTGTAGCAAGAAA
AAGGACCAGGAAGAAAACAAGGGAGCTACAAGTTGGCCTGAATTCTACATTGATCAGCTCAATTCCATGGCTGCTAGAAAATCTCTGCTG
GCTTTAGAGAAGGAAGAAGAAGAAGAAAGAAGTAAAACTATAGAGAGTTTAAAGACAGCACTGAGGACAAAACCAATGAGGTTTGTAACC
AGATTCATCGACTTGGATGGCCTATCATGTATCCTCAACTTTCTAAAGACCATGGACTACGAGACCTCAGAGTCTCGAATACATACTTCT
CTCATTGGCTGTATAAAGGCGTTAATGAACAACTCTCAAGGCCGGGCTCACGTCCTGGCTCATTCTGAGAGTATTAATGTAATTGCTCAG
AGTCTGAGCACAGAGAACATTAAAACGAAGGTGGCCGTGCTGGAAATCTTGGGCGCCGTGTGCCTGGTTCCCGGGGGCCACAAGAAGGTT
CTGCAGGCCATGCTGCACTACCAGAAGTATGCCAGCGAAAGGACCCGCTTTCAGACATTAATTAACGACTTGGATAAAAGCACTGGGCGG
TATCGAGATGAAGTGAGTCTCAAGACTGCCATCATGTCCTTCATTAATGCAGTGCTCAGCCAAGGTGCAGGAGTGGAGAGTTTGGACTTT
AGACTTCATCTTCGCTATGAATTTCTGATGTTAGGAATTCAACCTGTAATAGATAAATTAAGGGAACACGAAAATTCAACATTAGATAGG
CATTTAGACTTTTTTGAAATGCTCCGAAATGAAGATGAACTAGAATTTGCCAAAAGATTTGAACTGGTTCACATAGACACAAAAAGTGCA
ACTCAGATGTTTGAGCTGACCAGGAAGAGGCTGACACATAGTGAAGCTTACCCGCATTTCATGTCCATCCTGCACCACTGCCTCCAAATG
CCTTACAAGAGGAGTGGCAACACTGTTCAGTACTGGCTACTACTAGATAGAATTATACAGCAGATAGTTATCCAGAATGACAAAGGACAG
GACCCTGACTCCACACCTTTGGAAAACTTTAATATTAAGAATGTCGTACGAATGTTGGTTAATGAAAATGAAGTTAAGCAGTGGAAAGAA
CAAGCGGAAAAAATGAGAAAAGAGCACAATGAGCTACAACAGAAACTGGAAAAGAAAGAACGAGAATGTGATGCTAAGACTCAAGAGAAG
GAAGAGATGATGCAGACCTTAAATAAAATGAAAGAGAAACTTGAAAAGGAGACTACTGAGCATAAGCAAGTCAAGCAGCAGGTGGCGGAC
CTCACAGCACAGCTCCATGAGCTCAGCAGGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTT
CCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCT
CCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAG
AAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAACAAACTGGAAGGAACAGTATGGACCGAA
ATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGATGTATGAGAAC
TTTGTGGAGGAGGTGGATGCTGTGGACAATGGGATCTCCCAGTGGGCAGAGGGGGAGCCTCGATATGCACTGACCACTACCCTGAGTGCA
CGAGTTGCTCGACTTAATCCTACCTGGAACCACCCCGACCAAGACACTGAGGCAGGGTTCAAGCGTGCAATGGATCTGGTTCAAGAGGAG
TTTCTGCAGAGATTAGATTTCTACCAACACAGCTGGCTGCCAGCCCGGGCCTTGGTGGAAGAGGCCCTTGCCCAGCGATTCCAGGTGGAC
CCAAGTGGAGAGATTGTGGAACTGGCGAAAGGTGCATGTCCCTGGAAGGAGCATCTCTACCACCTGGAATCTGGGCTGTCCCCTCCAGTG
GCCATCTTCTTTGTTATCTACACTGACCAGGCTGGACAGTGGCGAATACAGTGTGTGCCCAAGGAGCCCCACTCATTCCAAAGCCGGCTG
CCCCTGCCAGAGCCATGGCGGGGTCTTCGGGACGAGGCCCTGGACCAGGTCAGTGGGATCCCTGGCTGCATCTTCGTCCATGCAAGCGGC
TTCACTGGCGGTCACCACACCCGAGAGGGTGCCTTGAGCATGGCCCGTGCCACCTTGGCCCAGCGCTCATACCTCCCACAAATCTCCTAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_DAAM1_ENST00000360909_chr14_59798638_+_C12orf10_ENST00000267103_chr12_53699692_+_2745nt
CTACGAGCGGCTGTGAAGGAAACTGTTTAACCGGATCCCATTGTACCCAGAGTGCAGAGCCGCCTTTCCAGCATGCAGGGGCTGCTCAGC
GTTTAGTCACATCAAGAAATAGAACAGAATTCAGCCATGGCCCCAAGAAAGAGAGGTGGACGAGGTATTTCATTCATCTTTTGCTGTTTC
CGAAATAATGATCACCCAGAAATCACGTATCGGCTGCGAAATGATAGCAACTTTGCGCTTCAGACCATGGAACCAGCATTGCCCATGCCC
CCTGTGGAGGAGCTGGATGTCATGTTCAGTGAACTGGTGGATGAACTGGACCTCACAGACAAACACAGAGAAGCCATGTTTGCACTTCCA
GCTGAGAAAAAATGGCAAATATACTGTAGCAAGAAAAAGGACCAGGAAGAAAACAAGGGAGCTACAAGTTGGCCTGAATTCTACATTGAT
CAGCTCAATTCCATGGCTGCTAGAAAATCTCTGCTGGCTTTAGAGAAGGAAGAAGAAGAAGAAAGAAGTAAAACTATAGAGAGTTTAAAG
ACAGCACTGAGGACAAAACCAATGAGGTTTGTAACCAGATTCATCGACTTGGATGGCCTATCATGTATCCTCAACTTTCTAAAGACCATG
GACTACGAGACCTCAGAGTCTCGAATACATACTTCTCTCATTGGCTGTATAAAGGCGTTAATGAACAACTCTCAAGGCCGGGCTCACGTC
CTGGCTCATTCTGAGAGTATTAATGTAATTGCTCAGAGTCTGAGCACAGAGAACATTAAAACGAAGGTGGCCGTGCTGGAAATCTTGGGC
GCCGTGTGCCTGGTTCCCGGGGGCCACAAGAAGGTTCTGCAGGCCATGCTGCACTACCAGAAGTATGCCAGCGAAAGGACCCGCTTTCAG
ACATTAATTAACGACTTGGATAAAAGCACTGGGCGGTATCGAGATGAAGTGAGTCTCAAGACTGCCATCATGTCCTTCATTAATGCAGTG
CTCAGCCAAGGTGCAGGAGTGGAGAGTTTGGACTTTAGACTTCATCTTCGCTATGAATTTCTGATGTTAGGAATTCAACCTGTAATAGAT
AAATTAAGGGAACACGAAAATTCAACATTAGATAGGCATTTAGACTTTTTTGAAATGCTCCGAAATGAAGATGAACTAGAATTTGCCAAA
AGATTTGAACTGGTTCACATAGACACAAAAAGTGCAACTCAGATGTTTGAGCTGACCAGGAAGAGGCTGACACATAGTGAAGCTTACCCG
CATTTCATGTCCATCCTGCACCACTGCCTCCAAATGCCTTACAAGAGGAGTGGCAACACTGTTCAGTACTGGCTACTACTAGATAGAATT
ATACAGCAGATAGTTATCCAGAATGACAAAGGACAGGACCCTGACTCCACACCTTTGGAAAACTTTAATATTAAGAATGTCGTACGAATG
TTGGTTAATGAAAATGAAGTTAAGCAGTGGAAAGAACAAGCGGAAAAAATGAGAAAAGAGCACAATGAGCTACAACAGAAACTGGAAAAG
AAAGAACGAGAATGTGATGCTAAGACTCAAGAGAAGGAAGAGATGATGCAGACCTTAAATAAAATGAAAGAGAAACTTGAAAAGGAGACT
ACTGAGCATAAGCAAGTCAAGCAGCAGGTGGCGGACCTCACAGCACAGCTCCATGAGCTCAGCAGGAGGGCCGTCTGTGCTTCAATCCCA
GGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCA
GGTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCA
CCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTG
CCCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACC
TTCTCTGCCTATCAAAGACAGCAGATGTATGAGAACTTTGTGGAGGAGGTGGATGCTGTGGACAATGGGATCTCCCAGTGGGCAGAGGGG
GAGCCTCGATATGCACTGACCACTACCCTGAGTGCACGAGTTGCTCGACTTAATCCTACCTGGAACCACCCCGACCAAGACACTGAGGCA
GGGTTCAAGCGTGCAATGGATCTGGTTCAAGAGGAGTTTCTGCAGAGATTAGATTTCTACCAACACAGCTGGCTGCCAGCCCGGGCCTTG
GTGGAAGAGGCCCTTGCCCAGCGATTCCAGGTGGACCCAAGTGGAGAGATTGTGGAACTGGCGAAAGGTGCATGTCCCTGGAAGGAGCAT
CTCTACCACCTGGAATCTGGGCTGTCCCCTCCAGTGGCCATCTTCTTTGTTATCTACACTGACCAGGCTGGACAGTGGCGAATACAGTGT
GTGCCCAAGGAGCCCCACTCATTCCAAAGCCGGCTGCCCCTGCCAGAGCCATGGCGGGGTCTTCGGGACGAGGCCCTGGACCAGGTCAGT
GGGATCCCTGGCTGCATCTTCGTCCATGCAAGCGGCTTCACTGGCGGTCACCACACCCGAGAGGGTGCCTTGAGCATGGCCCGTGCCACC

>In-frame_DAAM1_ENST00000351081_chr14_59798638_+_C12orf10_ENST00000267103_chr12_53699692_+_2744nt
TACGAGCGGCTGTGAAGGAAACTGTTTAACCGGATCCCATTGTACCCAGAGTGCAGAGCCGCCTTTCCAGCATGCAGGGGCTGCTCAGCG
TTTAGTCACATCAAGAAATAGAACAGAATTCAGCCATGGCCCCAAGAAAGAGAGGTGGACGAGGTATTTCATTCATCTTTTGCTGTTTCC
GAAATAATGATCACCCAGAAATCACGTATCGGCTGCGAAATGATAGCAACTTTGCGCTTCAGACCATGGAACCAGCATTGCCCATGCCCC
CTGTGGAGGAGCTGGATGTCATGTTCAGTGAACTGGTGGATGAACTGGACCTCACAGACAAACACAGAGAAGCCATGTTTGCACTTCCAG
CTGAGAAAAAATGGCAAATATACTGTAGCAAGAAAAAGGACCAGGAAGAAAACAAGGGAGCTACAAGTTGGCCTGAATTCTACATTGATC
AGCTCAATTCCATGGCTGCTAGAAAATCTCTGCTGGCTTTAGAGAAGGAAGAAGAAGAAGAAAGAAGTAAAACTATAGAGAGTTTAAAGA
CAGCACTGAGGACAAAACCAATGAGGTTTGTAACCAGATTCATCGACTTGGATGGCCTATCATGTATCCTCAACTTTCTAAAGACCATGG
ACTACGAGACCTCAGAGTCTCGAATACATACTTCTCTCATTGGCTGTATAAAGGCGTTAATGAACAACTCTCAAGGCCGGGCTCACGTCC
TGGCTCATTCTGAGAGTATTAATGTAATTGCTCAGAGTCTGAGCACAGAGAACATTAAAACGAAGGTGGCCGTGCTGGAAATCTTGGGCG
CCGTGTGCCTGGTTCCCGGGGGCCACAAGAAGGTTCTGCAGGCCATGCTGCACTACCAGAAGTATGCCAGCGAAAGGACCCGCTTTCAGA
CATTAATTAACGACTTGGATAAAAGCACTGGGCGGTATCGAGATGAAGTGAGTCTCAAGACTGCCATCATGTCCTTCATTAATGCAGTGC
TCAGCCAAGGTGCAGGAGTGGAGAGTTTGGACTTTAGACTTCATCTTCGCTATGAATTTCTGATGTTAGGAATTCAACCTGTAATAGATA
AATTAAGGGAACACGAAAATTCAACATTAGATAGGCATTTAGACTTTTTTGAAATGCTCCGAAATGAAGATGAACTAGAATTTGCCAAAA
GATTTGAACTGGTTCACATAGACACAAAAAGTGCAACTCAGATGTTTGAGCTGACCAGGAAGAGGCTGACACATAGTGAAGCTTACCCGC
ATTTCATGTCCATCCTGCACCACTGCCTCCAAATGCCTTACAAGAGGAGTGGCAACACTGTTCAGTACTGGCTACTACTAGATAGAATTA
TACAGCAGATAGTTATCCAGAATGACAAAGGACAGGACCCTGACTCCACACCTTTGGAAAACTTTAATATTAAGAATGTCGTACGAATGT
TGGTTAATGAAAATGAAGTTAAGCAGTGGAAAGAACAAGCGGAAAAAATGAGAAAAGAGCACAATGAGCTACAACAGAAACTGGAAAAGA
AAGAACGAGAATGTGATGCTAAGACTCAAGAGAAGGAAGAGATGATGCAGACCTTAAATAAAATGAAAGAGAAACTTGAAAAGGAGACTA
CTGAGCATAAGCAAGTCAAGCAGCAGGTGGCGGACCTCACAGCACAGCTCCATGAGCTCAGCAGGAGGGCCGTCTGTGCTTCAATCCCAG
GTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAG
GTGGGATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCAC
CTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGC
CCGAGAACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCT
TCTCTGCCTATCAAAGACAGCAGATGTATGAGAACTTTGTGGAGGAGGTGGATGCTGTGGACAATGGGATCTCCCAGTGGGCAGAGGGGG
AGCCTCGATATGCACTGACCACTACCCTGAGTGCACGAGTTGCTCGACTTAATCCTACCTGGAACCACCCCGACCAAGACACTGAGGCAG
GGTTCAAGCGTGCAATGGATCTGGTTCAAGAGGAGTTTCTGCAGAGATTAGATTTCTACCAACACAGCTGGCTGCCAGCCCGGGCCTTGG
TGGAAGAGGCCCTTGCCCAGCGATTCCAGGTGGACCCAAGTGGAGAGATTGTGGAACTGGCGAAAGGTGCATGTCCCTGGAAGGAGCATC
TCTACCACCTGGAATCTGGGCTGTCCCCTCCAGTGGCCATCTTCTTTGTTATCTACACTGACCAGGCTGGACAGTGGCGAATACAGTGTG
TGCCCAAGGAGCCCCACTCATTCCAAAGCCGGCTGCCCCTGCCAGAGCCATGGCGGGGTCTTCGGGACGAGGCCCTGGACCAGGTCAGTG
GGATCCCTGGCTGCATCTTCGTCCATGCAAGCGGCTTCACTGGCGGTCACCACACCCGAGAGGGTGCCTTGAGCATGGCCCGTGCCACCT

>In-frame_DAAM1_ENST00000395125_chr14_59798638_+_C12orf10_ENST00000267103_chr12_53699692_+_2642nt
AAGAAATAGAACAGAATTCAGCCATGGCCCCAAGAAAGAGAGGTGGACGAGGTATTTCATTCATCTTTTGCTGTTTCCGAAATAATGATC
ACCCAGAAATCACGTATCGGCTGCGAAATGATAGCAACTTTGCGCTTCAGACCATGGAACCAGCATTGCCCATGCCCCCTGTGGAGGAGC
TGGATGTCATGTTCAGTGAACTGGTGGATGAACTGGACCTCACAGACAAACACAGAGAAGCCATGTTTGCACTTCCAGCTGAGAAAAAAT
GGCAAATATACTGTAGCAAGAAAAAGGACCAGGAAGAAAACAAGGGAGCTACAAGTTGGCCTGAATTCTACATTGATCAGCTCAATTCCA
TGGCTGCTAGAAAATCTCTGCTGGCTTTAGAGAAGGAAGAAGAAGAAGAAAGAAGTAAAACTATAGAGAGTTTAAAGACAGCACTGAGGA
CAAAACCAATGAGGTTTGTAACCAGATTCATCGACTTGGATGGCCTATCATGTATCCTCAACTTTCTAAAGACCATGGACTACGAGACCT
CAGAGTCTCGAATACATACTTCTCTCATTGGCTGTATAAAGGCGTTAATGAACAACTCTCAAGGCCGGGCTCACGTCCTGGCTCATTCTG
AGAGTATTAATGTAATTGCTCAGAGTCTGAGCACAGAGAACATTAAAACGAAGGTGGCCGTGCTGGAAATCTTGGGCGCCGTGTGCCTGG
TTCCCGGGGGCCACAAGAAGGTTCTGCAGGCCATGCTGCACTACCAGAAGTATGCCAGCGAAAGGACCCGCTTTCAGACATTAATTAACG
ACTTGGATAAAAGCACTGGGCGGTATCGAGATGAAGTGAGTCTCAAGACTGCCATCATGTCCTTCATTAATGCAGTGCTCAGCCAAGGTG
CAGGAGTGGAGAGTTTGGACTTTAGACTTCATCTTCGCTATGAATTTCTGATGTTAGGAATTCAACCTGTAATAGATAAATTAAGGGAAC
ACGAAAATTCAACATTAGATAGGCATTTAGACTTTTTTGAAATGCTCCGAAATGAAGATGAACTAGAATTTGCCAAAAGATTTGAACTGG
TTCACATAGACACAAAAAGTGCAACTCAGATGTTTGAGCTGACCAGGAAGAGGCTGACACATAGTGAAGCTTACCCGCATTTCATGTCCA
TCCTGCACCACTGCCTCCAAATGCCTTACAAGAGGAGTGGCAACACTGTTCAGTACTGGCTACTACTAGATAGAATTATACAGCAGATAG
TTATCCAGAATGACAAAGGACAGGACCCTGACTCCACACCTTTGGAAAACTTTAATATTAAGAATGTCGTACGAATGTTGGTTAATGAAA
ATGAAGTTAAGCAGTGGAAAGAACAAGCGGAAAAAATGAGAAAAGAGCACAATGAGCTACAACAGAAACTGGAAAAGAAAGAACGAGAAT
GTGATGCTAAGACTCAAGAGAAGGAAGAGATGATGCAGACCTTAAATAAAATGAAAGAGAAACTTGAAAAGGAGACTACTGAGCATAAGC
AAGTCAAGCAGCAGGTGGCGGACCTCACAGCACAGCTCCATGAGCTCAGCAGGAGGGCCGTCTGTGCTTCAATCCCAGGTGGACCCTCGC
CTGGAGCACCAGGAGGGCCCTTTCCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGGATGCTTC
CCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCTCCTCCCTTAGGGGCAATCATGCCACCTCCTGGTGCTC
CAATGGGCCTAGCACTGAAGAAGAAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAGAACAAAC
TGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTAGATCTTGAAGACCTGGAAAGAACCTTCTCTGCCTATC
AAAGACAGCAGATGTATGAGAACTTTGTGGAGGAGGTGGATGCTGTGGACAATGGGATCTCCCAGTGGGCAGAGGGGGAGCCTCGATATG
CACTGACCACTACCCTGAGTGCACGAGTTGCTCGACTTAATCCTACCTGGAACCACCCCGACCAAGACACTGAGGCAGGGTTCAAGCGTG
CAATGGATCTGGTTCAAGAGGAGTTTCTGCAGAGATTAGATTTCTACCAACACAGCTGGCTGCCAGCCCGGGCCTTGGTGGAAGAGGCCC
TTGCCCAGCGATTCCAGGTGGACCCAAGTGGAGAGATTGTGGAACTGGCGAAAGGTGCATGTCCCTGGAAGGAGCATCTCTACCACCTGG
AATCTGGGCTGTCCCCTCCAGTGGCCATCTTCTTTGTTATCTACACTGACCAGGCTGGACAGTGGCGAATACAGTGTGTGCCCAAGGAGC
CCCACTCATTCCAAAGCCGGCTGCCCCTGCCAGAGCCATGGCGGGGTCTTCGGGACGAGGCCCTGGACCAGGTCAGTGGGATCCCTGGCT
GCATCTTCGTCCATGCAAGCGGCTTCACTGGCGGTCACCACACCCGAGAGGGTGCCTTGAGCATGGCCCGTGCCACCTTGGCCCAGCGCT


Top

FusionGenePPI for DAAM1_C12orf10


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DAAM1MAP3K7, PRPF40A, B3GALT4, AMBP, RHOD, GPN3, GNAZ, TMEM185A, PIFO, RHOA, CDH1, RHOC, FBXL16, SERHL2, RANBP6, FBXL14, TUBA4A, ARMC6, TUBB, SLC37A3, CHEK2, CHEK1C12orf10COPS5, DSTN, DAK, HSP90AB1, HSP90AA1, OXCT1, DDX39A, DDX39B, GLRX3, HSPD1, IDH1, PGD, RBBP7, SORD, SUGT1, THOP1, ARL6IP1, AGTRAP, CMTM5, FAM9B, TMEM239, HSPB1, AHSA1, DPH5, ELAC2, XPNPEP1, DNAJC17, HIBCH, HSPA8, UBQLN1, UBQLN2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DAAM1_C12orf10


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DAAM1_C12orf10


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource