FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9197

FusionGeneSummary for CYTH1_MACROD1

check button Fusion gene summary
Fusion gene informationFusion gene name: CYTH1_MACROD1
Fusion gene ID: 9197
HgeneTgene
Gene symbol

CYTH1

MACROD1

Gene ID

9267

28992

Gene namecytohesin 1MACRO domain containing 1
SynonymsB2-1|CYTOHESIN-1|D17S811E|PSCD1|SEC7LRP16
Cytomap

17q25.3

11q13.1

Type of geneprotein-codingprotein-coding
Descriptioncytohesin-1PH, SEC7 and coiled-coil domain-containing protein 1SEC7 homolog B2-1cytoadhesin 1homolog of secretory protein SEC7pleckstrin homology, Sec7 and coiled-coil domains 1O-acetyl-ADP-ribose deacetylase MACROD1MACRO domain-containing protein 1[Protein ADP-ribosylglutamate] hydrolase
Modification date2018051920180519
UniProtAcc

Q15438

Q9BQ69

Ensembl transtripts involved in fusion geneENST00000585509, ENST00000589297, 
ENST00000591455, ENST00000446868, 
ENST00000361101, ENST00000589296, 
ENST00000586175, 
ENST00000255681, 
ENST00000538595, 
Fusion gene scores* DoF score12 X 8 X 5=4806 X 4 X 6=144
# samples 146
** MAII scorelog2(14/480*10)=-1.77760757866355
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/144*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CYTH1 [Title/Abstract] AND MACROD1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCYTH1

GO:0030155

regulation of cell adhesion

12606567

TgeneMACROD1

GO:0042278

purine nucleoside metabolic process

21257746

TgeneMACROD1

GO:0051725

protein de-ADP-ribosylation

23474712


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-HT-A619-01ACYTH1chr17

76694351

-MACROD1chr11

63782753

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000585509ENST00000255681CYTH1chr17

76694351

-MACROD1chr11

63782753

-
5CDS-intronENST00000585509ENST00000538595CYTH1chr17

76694351

-MACROD1chr11

63782753

-
In-frameENST00000589297ENST00000255681CYTH1chr17

76694351

-MACROD1chr11

63782753

-
5CDS-intronENST00000589297ENST00000538595CYTH1chr17

76694351

-MACROD1chr11

63782753

-
In-frameENST00000591455ENST00000255681CYTH1chr17

76694351

-MACROD1chr11

63782753

-
5CDS-intronENST00000591455ENST00000538595CYTH1chr17

76694351

-MACROD1chr11

63782753

-
In-frameENST00000446868ENST00000255681CYTH1chr17

76694351

-MACROD1chr11

63782753

-
5CDS-intronENST00000446868ENST00000538595CYTH1chr17

76694351

-MACROD1chr11

63782753

-
Frame-shitENST00000361101ENST00000255681CYTH1chr17

76694351

-MACROD1chr11

63782753

-
5CDS-intronENST00000361101ENST00000538595CYTH1chr17

76694351

-MACROD1chr11

63782753

-
intron-3CDSENST00000589296ENST00000255681CYTH1chr17

76694351

-MACROD1chr11

63782753

-
intron-intronENST00000589296ENST00000538595CYTH1chr17

76694351

-MACROD1chr11

63782753

-
intron-3CDSENST00000586175ENST00000255681CYTH1chr17

76694351

-MACROD1chr11

63782753

-
intron-intronENST00000586175ENST00000538595CYTH1chr17

76694351

-MACROD1chr11

63782753

-

Top

FusionProtFeatures for CYTH1_MACROD1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CYTH1

Q15438

MACROD1

Q9BQ69

Promotes guanine-nucleotide exchange on ARF1, ARF5 andARF6. Promotes the activation of ARF factors through replacementof GDP with GTP. Plays an important role in membrane trafficking,during junctional remodeling and epithelial polarization, throughregulation of ARF6 activity. {ECO:0000250|UniProtKB:Q9QX11,ECO:0000269|PubMed:10652308, ECO:0000269|PubMed:29420262,ECO:0000269|PubMed:9653114}. Removes ADP-ribose from glutamate residues in proteinsbearing a single ADP-ribose moiety. Inactive towards proteinsbearing poly-ADP-ribose. Deacetylates O-acetyl-ADP ribose, asignaling molecule generated by the deacetylation of acetylatedlysine residues in histones and other proteins. Plays a role inestrogen signaling. Binds to androgen receptor (AR) and amplifiesthe transactivation function of AR in response to androgen. Mayplay an important role in carcinogenesis and/or progression ofhormone-dependent cancers by feed-forward mechanism that activatesESR1 transactivation. Could be an ESR1 coactivator, providing apositive feedback regulatory loop for ESR1 signal transduction.Could be involved in invasive growth by down-regulating CDH1 inendometrial cancer cells. Enhances ESR1-mediated transcriptionactivity. {ECO:0000269|PubMed:17893710,ECO:0000269|PubMed:17914104, ECO:0000269|PubMed:19022849,ECO:0000269|PubMed:19403568, ECO:0000269|PubMed:21257746,ECO:0000269|PubMed:23474712}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CYTH1_MACROD1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CYTH1_ENST00000589297_chr17_76694351_-_MACROD1_ENST00000255681_chr11_63782753_-_365aa
MQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLTKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFL
WSFRLPGEAQKIDRMMEAFAQRTCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLTESI
KNEPFKIPEDDGNDLTHTFFNPDREGWLLKLANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGTRLPAKYVIHTVGPIA
YGEPSASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPCEAAAEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHY

>In-frame_CYTH1_ENST00000591455_chr17_76694351_-_MACROD1_ENST00000255681_chr11_63782753_-_424aa
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLL
KNTCEDIAQFLTKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRTCQCNNGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLTESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKL
ANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGTRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSV

>In-frame_CYTH1_ENST00000446868_chr17_76694351_-_MACROD1_ENST00000255681_chr11_63782753_-_424aa
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLL
KNTCEDIAQFLTKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRTCQCNNGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLTESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKL
ANSSLLGGGGVDGCIHRAAGPLLTDECRTLQSCKTGKAKITGGTRLPAKYVIHTVGPIAYGEPSASQAAELRSCYLSSLDLLLEHRLRSV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CYTH1_ENST00000589297_chr17_76694351_-_MACROD1_ENST00000255681_chr11_63782753_-_1095nt
ATGCAGAGGAACAAACAGGTAGCCATGGGCAGGAAAAAATTTAATATGGACCCTAAAAAGGGGATCCAGTTCTTAATAGAGAACGACCTC
CTGAAGAACACTTGTGAAGACATTGCCCAGTTCTTATATAAAGGCGAAGGGCTCAACAAGACAGCCATCGGCGACTACCTAGGGGAGAGA
GATGAGTTTAATATCCAGGTTCTTCATGCATTTGTGGAGCTGCATGAGTTCACTGATCTTAATCTCGTCCAGGCACTACGGCAGTTCCTG
TGGAGCTTCCGGCTACCCGGAGAGGCCCAGAAGATCGACCGGATGATGGAGGCGTTTGCCCAGCGATATTGTCAGTGCAATAATGGCGTG
TTCCAGTCCACGGATACTTGTTACGTCCTCTCCTTTGCCATCATCATGTTGAACACCAGTCTGCACAACCCCAATGTCAAAGATAAGCCC
ACTGTGGAGAGGTTCATTGCCATGAACCGAGGCATCAATGATGGGGGAGACCTGCCGGAGGAGCTCCTCCGGAATCTCTATGAGAGCATA
AAAAATGAACCCTTTAAAATCCCAGAAGACGACGGGAATGACCTCACTCACACTTTCTTCAATCCAGACCGAGAAGGCTGGCTATTGAAA
CTCGCCAACAGCTCCCTGCTCGGAGGCGGTGGCGTGGACGGCTGCATTCATCGGGCCGCCGGCCCCCTGCTTACCGACGAGTGCCGGACC
CTGCAGAGCTGTAAGACTGGCAAGGCCAAGATCACCGGCGGCTATCGGCTCCCGGCCAAGTACGTCATCCACACAGTGGGGCCCATCGCC
TACGGGGAGCCCAGCGCCAGTCAGGCTGCCGAGCTCCGCAGCTGCTACCTGAGCAGTCTGGACCTGCTGCTGGAGCACCGGCTCCGCTCG
GTGGCGTTCCCCTGCATCTCCACCGGCGTGTTTGGCTACCCCTGTGAGGCGGCCGCCGAGATCGTGCTGGCCACGCTGCGAGAGTGGCTG
GAGCAGCACAAGGACAAGGTGGACCGGCTGATCATCTGCGTGTTCCTCGAGAAGGACGAGGACATCTACCGGAGCCGGCTCCCCCACTAC

>In-frame_CYTH1_ENST00000591455_chr17_76694351_-_MACROD1_ENST00000255681_chr11_63782753_-_1272nt
ATGGAGGAGGACGACAGCTACGTTCCCAGTGACCTGACAGCAGAGGAGCGTCAAGAACTGGAGAACATCCGACGGAGAAAACAGGAGCTG
CTGGCTGACATTCAGAGGCTGAAGGATGAGATAGCAGAAGTAGCTAATGAAATTGAAAACCTGGGATCCACAGAGGAAAGGAAAAACATG
CAGAGGAACAAACAGGTAGCCATGGGCAGGAAAAAATTTAATATGGACCCTAAAAAGGGGATCCAGTTCTTAATAGAGAACGACCTCCTG
AAGAACACTTGTGAAGACATTGCCCAGTTCTTATATAAAGGCGAAGGGCTCAACAAGACAGCCATCGGCGACTACCTAGGGGAGAGAGAT
GAGTTTAATATCCAGGTTCTTCATGCATTTGTGGAGCTGCATGAGTTCACTGATCTTAATCTCGTCCAGGCACTACGGCAGTTCCTGTGG
AGCTTCCGGCTACCCGGAGAGGCCCAGAAGATCGACCGGATGATGGAGGCGTTTGCCCAGCGATATTGTCAGTGCAATAATGGCGTGTTC
CAGTCCACGGATACTTGTTACGTCCTCTCCTTTGCCATCATCATGTTGAACACCAGTCTGCACAACCCCAATGTCAAAGATAAGCCCACT
GTGGAGAGGTTCATTGCCATGAACCGAGGCATCAATGATGGGGGAGACCTGCCGGAGGAGCTCCTCCGGAATCTCTATGAGAGCATAAAA
AATGAACCCTTTAAAATCCCAGAAGACGACGGGAATGACCTCACTCACACTTTCTTCAATCCAGACCGAGAAGGCTGGCTATTGAAACTC
GCCAACAGCTCCCTGCTCGGAGGCGGTGGCGTGGACGGCTGCATTCATCGGGCCGCCGGCCCCCTGCTTACCGACGAGTGCCGGACCCTG
CAGAGCTGTAAGACTGGCAAGGCCAAGATCACCGGCGGCTATCGGCTCCCGGCCAAGTACGTCATCCACACAGTGGGGCCCATCGCCTAC
GGGGAGCCCAGCGCCAGTCAGGCTGCCGAGCTCCGCAGCTGCTACCTGAGCAGTCTGGACCTGCTGCTGGAGCACCGGCTCCGCTCGGTG
GCGTTCCCCTGCATCTCCACCGGCGTGTTTGGCTACCCCTGTGAGGCGGCCGCCGAGATCGTGCTGGCCACGCTGCGAGAGTGGCTGGAG
CAGCACAAGGACAAGGTGGACCGGCTGATCATCTGCGTGTTCCTCGAGAAGGACGAGGACATCTACCGGAGCCGGCTCCCCCACTACTTC

>In-frame_CYTH1_ENST00000446868_chr17_76694351_-_MACROD1_ENST00000255681_chr11_63782753_-_1272nt
ATGGAGGAGGACGACAGCTACGTTCCCAGTGACCTGACAGCAGAGGAGCGTCAAGAACTGGAGAACATCCGACGGAGAAAACAGGAGCTG
CTGGCTGACATTCAGAGGCTGAAGGATGAGATAGCAGAAGTAGCTAATGAAATTGAAAACCTGGGATCCACAGAGGAAAGGAAAAACATG
CAGAGGAACAAACAGGTAGCCATGGGCAGGAAAAAATTTAATATGGACCCTAAAAAGGGGATCCAGTTCTTAATAGAGAACGACCTCCTG
AAGAACACTTGTGAAGACATTGCCCAGTTCTTATATAAAGGCGAAGGGCTCAACAAGACAGCCATCGGCGACTACCTAGGGGAGAGAGAT
GAGTTTAATATCCAGGTTCTTCATGCATTTGTGGAGCTGCATGAGTTCACTGATCTTAATCTCGTCCAGGCACTACGGCAGTTCCTGTGG
AGCTTCCGGCTACCCGGAGAGGCCCAGAAGATCGACCGGATGATGGAGGCGTTTGCCCAGCGATATTGTCAGTGCAATAATGGCGTGTTC
CAGTCCACGGATACTTGTTACGTCCTCTCCTTTGCCATCATCATGTTGAACACCAGTCTGCACAACCCCAATGTCAAAGATAAGCCCACT
GTGGAGAGGTTCATTGCCATGAACCGAGGCATCAATGATGGGGGAGACCTGCCGGAGGAGCTCCTCCGGAATCTCTATGAGAGCATAAAA
AATGAACCCTTTAAAATCCCAGAAGACGACGGGAATGACCTCACTCACACTTTCTTCAATCCAGACCGAGAAGGCTGGCTATTGAAACTC
GCCAACAGCTCCCTGCTCGGAGGCGGTGGCGTGGACGGCTGCATTCATCGGGCCGCCGGCCCCCTGCTTACCGACGAGTGCCGGACCCTG
CAGAGCTGTAAGACTGGCAAGGCCAAGATCACCGGCGGCTATCGGCTCCCGGCCAAGTACGTCATCCACACAGTGGGGCCCATCGCCTAC
GGGGAGCCCAGCGCCAGTCAGGCTGCCGAGCTCCGCAGCTGCTACCTGAGCAGTCTGGACCTGCTGCTGGAGCACCGGCTCCGCTCGGTG
GCGTTCCCCTGCATCTCCACCGGCGTGTTTGGCTACCCCTGTGAGGCGGCCGCCGAGATCGTGCTGGCCACGCTGCGAGAGTGGCTGGAG
CAGCACAAGGACAAGGTGGACCGGCTGATCATCTGCGTGTTCCTCGAGAAGGACGAGGACATCTACCGGAGCCGGCTCCCCCACTACTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CYTH1_ENST00000589297_chr17_76694351_-_MACROD1_ENST00000255681_chr11_63782753_-_1948nt
GGCATTCTTGCAGTGAAAGCAGGCATTAGGCTTTTGCTTCTGAGGGAGAGAGGAAAGCAAGTGCAGCCTGTGCGCAAATGCTGGTGGTGC
CTCCCCTCCCCCCCGGGAGGCCGGGAATGGGGGATAGTAGGAGGGGCTGGCTGTGACTGCATTCATGGAAATGAGCCTGGAGGAGCGGAG
CAGCACACACTCGGAGCGTCTGCTAGGGCTGCAGCTCTGCGCGTCCATCTCTGCGCTCTGCGCCAGCCTTCCCCACCGGGCCCAGCGAGT
TTCCACCTGCAGGGCCGGTGCTCTCAGCTTTTGTTTTCTCTGGACACCTTCTTCTCTACCCCTGCTGTGCTGGCGCACACATGCTGTCCT
TGCTCCGGCTCTCCCTGCACCTACAGCTGTGGGAGCTCCCGGCAGCCTGGTACTGTGGGGTCGCTGCACGGAGCCACCATGGCCTCTGAC
GTGGAGAGCTGTGACCTGCCGAGGCTTTGATGTTGCTGCCCAGGGCTGGCCAGGACACTGGGGCCGCAGGAGAGGGGACTCACCGTGGTT
CCCAGTGACCTGACAGCAGAGGAGCGTCAAGAACTGGAGAACATCCGACGGAGAAAACAGGAGCTGCTGGCTGACATTCAGAGGCTGAAG
GATGAGATAGCAGAAGTAGCTAATGAAATTGAAAACCTGGGATCCACAGAGGAAAGGAAAAACATGCAGAGGAACAAACAGGTAGCCATG
GGCAGGAAAAAATTTAATATGGACCCTAAAAAGGGGATCCAGTTCTTAATAGAGAACGACCTCCTGAAGAACACTTGTGAAGACATTGCC
CAGTTCTTATATAAAGGCGAAGGGCTCAACAAGACAGCCATCGGCGACTACCTAGGGGAGAGAGATGAGTTTAATATCCAGGTTCTTCAT
GCATTTGTGGAGCTGCATGAGTTCACTGATCTTAATCTCGTCCAGGCACTACGGCAGTTCCTGTGGAGCTTCCGGCTACCCGGAGAGGCC
CAGAAGATCGACCGGATGATGGAGGCGTTTGCCCAGCGATATTGTCAGTGCAATAATGGCGTGTTCCAGTCCACGGATACTTGTTACGTC
CTCTCCTTTGCCATCATCATGTTGAACACCAGTCTGCACAACCCCAATGTCAAAGATAAGCCCACTGTGGAGAGGTTCATTGCCATGAAC
CGAGGCATCAATGATGGGGGAGACCTGCCGGAGGAGCTCCTCCGGAATCTCTATGAGAGCATAAAAAATGAACCCTTTAAAATCCCAGAA
GACGACGGGAATGACCTCACTCACACTTTCTTCAATCCAGACCGAGAAGGCTGGCTATTGAAACTCGCCAACAGCTCCCTGCTCGGAGGC
GGTGGCGTGGACGGCTGCATTCATCGGGCCGCCGGCCCCCTGCTTACCGACGAGTGCCGGACCCTGCAGAGCTGTAAGACTGGCAAGGCC
AAGATCACCGGCGGCTATCGGCTCCCGGCCAAGTACGTCATCCACACAGTGGGGCCCATCGCCTACGGGGAGCCCAGCGCCAGTCAGGCT
GCCGAGCTCCGCAGCTGCTACCTGAGCAGTCTGGACCTGCTGCTGGAGCACCGGCTCCGCTCGGTGGCGTTCCCCTGCATCTCCACCGGC
GTGTTTGGCTACCCCTGTGAGGCGGCCGCCGAGATCGTGCTGGCCACGCTGCGAGAGTGGCTGGAGCAGCACAAGGACAAGGTGGACCGG
CTGATCATCTGCGTGTTCCTCGAGAAGGACGAGGACATCTACCGGAGCCGGCTCCCCCACTACTTCCCCGTGGCCTGAGGCTCCCGCAGC
CCACCCTGACCGGGACTGACCCGCCTTCGGGACCCCGCTCCCAGCTCTGAGAGGTCGCCAAAGCCTGCAGCCTGGCCTGGGCCTGGCCAC

>In-frame_CYTH1_ENST00000591455_chr17_76694351_-_MACROD1_ENST00000255681_chr11_63782753_-_1481nt
CGGCGGGACGCGAGCGGCGAGCCGGAGCGCGGAGCCCGGCTCCCGCACCATGGAGGAGGACGACAGCTACGTTCCCAGTGACCTGACAGC
AGAGGAGCGTCAAGAACTGGAGAACATCCGACGGAGAAAACAGGAGCTGCTGGCTGACATTCAGAGGCTGAAGGATGAGATAGCAGAAGT
AGCTAATGAAATTGAAAACCTGGGATCCACAGAGGAAAGGAAAAACATGCAGAGGAACAAACAGGTAGCCATGGGCAGGAAAAAATTTAA
TATGGACCCTAAAAAGGGGATCCAGTTCTTAATAGAGAACGACCTCCTGAAGAACACTTGTGAAGACATTGCCCAGTTCTTATATAAAGG
CGAAGGGCTCAACAAGACAGCCATCGGCGACTACCTAGGGGAGAGAGATGAGTTTAATATCCAGGTTCTTCATGCATTTGTGGAGCTGCA
TGAGTTCACTGATCTTAATCTCGTCCAGGCACTACGGCAGTTCCTGTGGAGCTTCCGGCTACCCGGAGAGGCCCAGAAGATCGACCGGAT
GATGGAGGCGTTTGCCCAGCGATATTGTCAGTGCAATAATGGCGTGTTCCAGTCCACGGATACTTGTTACGTCCTCTCCTTTGCCATCAT
CATGTTGAACACCAGTCTGCACAACCCCAATGTCAAAGATAAGCCCACTGTGGAGAGGTTCATTGCCATGAACCGAGGCATCAATGATGG
GGGAGACCTGCCGGAGGAGCTCCTCCGGAATCTCTATGAGAGCATAAAAAATGAACCCTTTAAAATCCCAGAAGACGACGGGAATGACCT
CACTCACACTTTCTTCAATCCAGACCGAGAAGGCTGGCTATTGAAACTCGCCAACAGCTCCCTGCTCGGAGGCGGTGGCGTGGACGGCTG
CATTCATCGGGCCGCCGGCCCCCTGCTTACCGACGAGTGCCGGACCCTGCAGAGCTGTAAGACTGGCAAGGCCAAGATCACCGGCGGCTA
TCGGCTCCCGGCCAAGTACGTCATCCACACAGTGGGGCCCATCGCCTACGGGGAGCCCAGCGCCAGTCAGGCTGCCGAGCTCCGCAGCTG
CTACCTGAGCAGTCTGGACCTGCTGCTGGAGCACCGGCTCCGCTCGGTGGCGTTCCCCTGCATCTCCACCGGCGTGTTTGGCTACCCCTG
TGAGGCGGCCGCCGAGATCGTGCTGGCCACGCTGCGAGAGTGGCTGGAGCAGCACAAGGACAAGGTGGACCGGCTGATCATCTGCGTGTT
CCTCGAGAAGGACGAGGACATCTACCGGAGCCGGCTCCCCCACTACTTCCCCGTGGCCTGAGGCTCCCGCAGCCCACCCTGACCGGGACT
GACCCGCCTTCGGGACCCCGCTCCCAGCTCTGAGAGGTCGCCAAAGCCTGCAGCCTGGCCTGGGCCTGGCCACCCCTTCTTTCCCTCCGC

>In-frame_CYTH1_ENST00000446868_chr17_76694351_-_MACROD1_ENST00000255681_chr11_63782753_-_1503nt
GCGAGCGGGGGCGCGGGTGGCGCGGCGGGACGCGAGCGGCGAGCCGGAGCGCGGAGCCCGGCTCCCGCACCATGGAGGAGGACGACAGCT
ACGTTCCCAGTGACCTGACAGCAGAGGAGCGTCAAGAACTGGAGAACATCCGACGGAGAAAACAGGAGCTGCTGGCTGACATTCAGAGGC
TGAAGGATGAGATAGCAGAAGTAGCTAATGAAATTGAAAACCTGGGATCCACAGAGGAAAGGAAAAACATGCAGAGGAACAAACAGGTAG
CCATGGGCAGGAAAAAATTTAATATGGACCCTAAAAAGGGGATCCAGTTCTTAATAGAGAACGACCTCCTGAAGAACACTTGTGAAGACA
TTGCCCAGTTCTTATATAAAGGCGAAGGGCTCAACAAGACAGCCATCGGCGACTACCTAGGGGAGAGAGATGAGTTTAATATCCAGGTTC
TTCATGCATTTGTGGAGCTGCATGAGTTCACTGATCTTAATCTCGTCCAGGCACTACGGCAGTTCCTGTGGAGCTTCCGGCTACCCGGAG
AGGCCCAGAAGATCGACCGGATGATGGAGGCGTTTGCCCAGCGATATTGTCAGTGCAATAATGGCGTGTTCCAGTCCACGGATACTTGTT
ACGTCCTCTCCTTTGCCATCATCATGTTGAACACCAGTCTGCACAACCCCAATGTCAAAGATAAGCCCACTGTGGAGAGGTTCATTGCCA
TGAACCGAGGCATCAATGATGGGGGAGACCTGCCGGAGGAGCTCCTCCGGAATCTCTATGAGAGCATAAAAAATGAACCCTTTAAAATCC
CAGAAGACGACGGGAATGACCTCACTCACACTTTCTTCAATCCAGACCGAGAAGGCTGGCTATTGAAACTCGCCAACAGCTCCCTGCTCG
GAGGCGGTGGCGTGGACGGCTGCATTCATCGGGCCGCCGGCCCCCTGCTTACCGACGAGTGCCGGACCCTGCAGAGCTGTAAGACTGGCA
AGGCCAAGATCACCGGCGGCTATCGGCTCCCGGCCAAGTACGTCATCCACACAGTGGGGCCCATCGCCTACGGGGAGCCCAGCGCCAGTC
AGGCTGCCGAGCTCCGCAGCTGCTACCTGAGCAGTCTGGACCTGCTGCTGGAGCACCGGCTCCGCTCGGTGGCGTTCCCCTGCATCTCCA
CCGGCGTGTTTGGCTACCCCTGTGAGGCGGCCGCCGAGATCGTGCTGGCCACGCTGCGAGAGTGGCTGGAGCAGCACAAGGACAAGGTGG
ACCGGCTGATCATCTGCGTGTTCCTCGAGAAGGACGAGGACATCTACCGGAGCCGGCTCCCCCACTACTTCCCCGTGGCCTGAGGCTCCC
GCAGCCCACCCTGACCGGGACTGACCCGCCTTCGGGACCCCGCTCCCAGCTCTGAGAGGTCGCCAAAGCCTGCAGCCTGGCCTGGGCCTG


Top

FusionGenePPI for CYTH1_MACROD1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CYTH1ARFRP1, IPCEF1, ITGB2, CYTIP, TRIM23, ITSN1, GNAQ, ARRB2, ARF6, ARRB1, UBA5, CNKSR1, CCDC120, C1orf106, CCDC40MACROD1BAG3, PARP1, IKBKG, XRCC6, XRCC5, IKBKB, ERC1, EIF2AK2, HNRNPU, CSTF3, YBX1, DHX9, DDX21, PPP2R1A, PTP4A1, H2AFX, PARP2, SUPT16H, HIST2H3PS2, XPC, SSRP1, HBA2, EXOC3, CETN2, LIG3, HBE1, RPA1, PTPN6, PTPN7, DLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CYTH1_MACROD1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CYTH1_MACROD1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource