FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9053

FusionGeneSummary for CXADR_FAM184B

check button Fusion gene summary
Fusion gene informationFusion gene name: CXADR_FAM184B
Fusion gene ID: 9053
HgeneTgene
Gene symbol

CXADR

FAM184B

Gene ID

1525

27146

Gene nameCXADR, Ig-like cell adhesion moleculefamily with sequence similarity 184 member B
SynonymsCAR|CAR4/6|HCAR-
Cytomap

21q21.1

4p15.32-p15.31

Type of geneprotein-codingprotein-coding
Descriptioncoxsackievirus and adenovirus receptor46 kD coxsackievirus and adenovirus receptor (CAR) proteinCVB3-binding proteinHCVADRcoxsackie virus and adenovirus receptorcoxsackievirus B-adenovirus receptorprotein FAM184B
Modification date2018051920180519
UniProtAcc

P78310

Q9ULE4

Ensembl transtripts involved in fusion geneENST00000284878, ENST00000400166, 
ENST00000356275, ENST00000400165, 
ENST00000306618, ENST00000400169, 
ENST00000265018, 
Fusion gene scores* DoF score6 X 3 X 4=721 X 1 X 1=1
# samples 51
** MAII scorelog2(5/72*10)=-0.526068811667588
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: CXADR [Title/Abstract] AND FAM184B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCXADR

GO:0007157

heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules

12869515|15800062

HgeneCXADR

GO:0031532

actin cytoskeleton reorganization

17675666


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-21-1081-01ACXADRchr21

18937929

+FAM184Bchr4

17666282

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000284878ENST00000265018CXADRchr21

18937929

+FAM184Bchr4

17666282

-
In-frameENST00000400166ENST00000265018CXADRchr21

18937929

+FAM184Bchr4

17666282

-
intron-3CDSENST00000356275ENST00000265018CXADRchr21

18937929

+FAM184Bchr4

17666282

-
In-frameENST00000400165ENST00000265018CXADRchr21

18937929

+FAM184Bchr4

17666282

-
In-frameENST00000306618ENST00000265018CXADRchr21

18937929

+FAM184Bchr4

17666282

-
In-frameENST00000400169ENST00000265018CXADRchr21

18937929

+FAM184Bchr4

17666282

-

Top

FusionProtFeatures for CXADR_FAM184B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CXADR

P78310

FAM184B

Q9ULE4


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CXADR_FAM184B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CXADR_ENST00000400166_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_861aa
MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGR
VHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSD
SQKMPTSWLAGKMCHLQRAVRPLPEATSAVIIHPWGPCLLPTWKDIPRLSITKYQVKTLNALLRVRLSHLLRXLPLIXVEWVRFLXXFQH
RARMGLXYRASICLICALRVPFLFLIYENLFWSKLCYXPQNTSKNKLIRNCTEYIFKNFCLVDPCLKLDETSPRGEEYQDKLAAEEGTSS
DEEERTKVLLKEGSDPQPPLGSLLKEKTSKIQRLEEDWQSQKAKLQAQVSQMQQALEQCTSNYREDLQALKQLSDLEREKLQRELQETTQ
QNHAMKAQLEASHQRALRMLEKARHQELKATEERLKKESSHSLQIQHQTHRLELQALEEKARQELQEERERMQAQQALLLESLRQELSEQ
QAACSGHQKDLEALQAELRALGRQQASSQCPGDSKDHIIATEERGGPGQAGSPPGAAGQGSGEGCGLWEENAQLQDAVRRLRAEVEQHQQ
EAQKLRDQRRFLEETQQAQRAREVETLRQEHRKEMQAMVADFSSAQAQLQARLAALEAELKDSGEKPGKGASRPEDLQLIGRLQTRLKER
EDIIKQLTEERRFHYAAFPSAMSHRNRSFSFNPHPGYLTPSMKKKKVEDVPSRVVSVPNLASYAKNFLSGDLSSRINAPPITTSPSLDPS

>In-frame_CXADR_ENST00000400165_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_730aa
MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGR
VHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLGKMCHLQRAVRPLPEATSAVIIHPWGPCLLPTWKDIPRLSIT
KYQVKTLNALLRVRLSHLLRXDPCLKLDETSPRGEEYQDKLAAEEGTSSDEEERTKVLLKEGSDPQPPLGSLLKEKTSKIQRLEEDWQSQ
KAKLQAQVSQMQQALEQCTSNYREDLQALKQLSDLEREKLQRELQETTQQNHAMKAQLEASHQRALRMLEKARHQELKATEERLKKESSH
SLQIQHQTHRLELQALEEKARQELQEERERMQAQQALLLESLRQELSEQQAACSGHQKDLEALQAELRALGRQQASSQCPGDSKDHIIAT
EERGGPGQAGSPPGAAGQGSGEGCGLWEENAQLQDAVRRLRAEVEQHQQEAQKLRDQRRFLEETQQAQRAREVETLRQEHRKEMQAMVAD
FSSAQAQLQARLAALEAELKDSGEKPGKGASRPEDLQLIGRLQTRLKEREDIIKQLTEERRFHYAAFPSAMSHRNRSFSFNPHPGYLTPS
MKKKKVEDVPSRVVSVPNLASYAKNFLSGDLSSRINAPPITTSPSLDPSPSCGRTYKPNQSTDAKTATRTPDGETAQAKEVQQKQGSPHQ

>In-frame_CXADR_ENST00000306618_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_854aa
MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGR
VHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSD
SQKMPTSWLAASNKAGLIAGAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNME
GYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSKDGSIVXDPCLKLDETSPRGEEYQDKLAAEEGTSSDEEERTK
VLLKEGSDPQPPLGSLLKEKTSKIQRLEEDWQSQKAKLQAQVSQMQQALEQCTSNYREDLQALKQLSDLEREKLQRELQETTQQNHAMKA
QLEASHQRALRMLEKARHQELKATEERLKKESSHSLQIQHQTHRLELQALEEKARQELQEERERMQAQQALLLESLRQELSEQQAACSGH
QKDLEALQAELRALGRQQASSQCPGDSKDHIIATEERGGPGQAGSPPGAAGQGSGEGCGLWEENAQLQDAVRRLRAEVEQHQQEAQKLRD
QRRFLEETQQAQRAREVETLRQEHRKEMQAMVADFSSAQAQLQARLAALEAELKDSGEKPGKGASRPEDLQLIGRLQTRLKEREDIIKQL
TEERRFHYAAFPSAMSHRNRSFSFNPHPGYLTPSMKKKKVEDVPSRVVSVPNLASYAKNFLSGDLSSRINAPPITTSPSLDPSPSCGRTY

>In-frame_CXADR_ENST00000400169_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_868aa
MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGR
VHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSD
SQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCCRKKRREEKYE
KEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKDPCLKLDETSPRGEEYQDKLA
AEEGTSSDEEERTKVLLKEGSDPQPPLGSLLKEKTSKIQRLEEDWQSQKAKLQAQVSQMQQALEQCTSNYREDLQALKQLSDLEREKLQR
ELQETTQQNHAMKAQLEASHQRALRMLEKARHQELKATEERLKKESSHSLQIQHQTHRLELQALEEKARQELQEERERMQAQQALLLESL
RQELSEQQAACSGHQKDLEALQAELRALGRQQASSQCPGDSKDHIIATEERGGPGQAGSPPGAAGQGSGEGCGLWEENAQLQDAVRRLRA
EVEQHQQEAQKLRDQRRFLEETQQAQRAREVETLRQEHRKEMQAMVADFSSAQAQLQARLAALEAELKDSGEKPGKGASRPEDLQLIGRL
QTRLKEREDIIKQLTEERRFHYAAFPSAMSHRNRSFSFNPHPGYLTPSMKKKKVEDVPSRVVSVPNLASYAKNFLSGDLSSRINAPPITT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CXADR_ENST00000400166_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_2583nt
ATGGCGCTCCTGCTGTGCTTCGTGCTCCTGTGCGGAGTAGTGGATTTCGCCAGAAGTTTGAGTATCACTACTCCTGAAGAGATGATTGAA
AAAGCCAAAGGGGAAACTGCCTATCTGCCATGCAAATTTACGCTTAGTCCCGAAGACCAGGGACCGCTGGACATCGAGTGGCTGATATCA
CCAGCTGATAATCAGAAGGTGGATCAAGTGATTATTTTATATTCTGGAGACAAAATTTATGATGACTACTATCCAGATCTGAAAGGCCGA
GTACATTTTACGAGTAATGATCTCAAATCTGGTGATGCATCAATAAATGTAACGAATTTACAACTGTCAGATATTGGCACATATCAGTGC
AAAGTGAAAAAAGCTCCTGGTGTTGCAAATAAGAAGATTCATCTGGTAGTTCTTGTTAAGCCTTCAGGTGCGAGATGTTACGTTGATGGA
TCTGAAGAAATTGGAAGTGACTTTAAGATAAAATGTGAACCAAAAGAAGGTTCACTTCCATTACAGTATGAGTGGCAAAAATTGTCTGAC
TCACAGAAAATGCCCACTTCATGGTTAGCAGGGAAGATGTGCCACCTCCAAAGAGCCGTACGTCCACTGCCAGAAGCTACATCGGCAGTA
ATCATTCATCCCTGGGGTCCATGTCTCCTTCCAACATGGAAGGATATTCCAAGACTCAGTATAACCAAGTACCAAGTGAAGACTTTGAAC
GCACTCCTCAGAGTCCGACTCTCCCACCTGCTAAGGTAGCTGCCCCTAATCTAAGTCGAATGGGTGCGATTCCTGTGATGATTCCAGCAC
AGAGCAAGGATGGGTCTATAGTATAGAGCCTCCATATGTCTCATCTGTGCTCTCCGTGTTCCTTTCCTTTTTTTGATATATGAAAACCTA
TTCTGGTCTAAATTGTGTTACTAGCCTCAAAATACATCAAAAAATAAGTTAATCAGGAACTGTACGGAATATATTTTTAAAAATTTTTGT
TTGGTTGATCCATGCTTGAAGCTGGATGAAACTTCGCCGAGAGGAGAGGAGTATCAAGATAAGTTAGCAGCTGAAGAAGGAACCAGCAGT
GATGAAGAAGAAAGGACCAAAGTGCTTCTCAAGGAGGGAAGTGACCCACAACCTCCACTGGGCTCTTTGTTGAAGGAGAAAACATCCAAA
ATCCAGCGTCTAGAGGAGGACTGGCAAAGCCAGAAGGCCAAATTGCAAGCCCAGGTCTCACAGATGCAGCAGGCTCTGGAGCAGTGCACC
AGCAACTACAGGGAGGACCTGCAGGCACTCAAGCAGCTCTCGGACCTGGAGAGGGAGAAGCTGCAGCGTGAGCTCCAGGAGACCACTCAG
CAGAACCACGCCATGAAAGCCCAGCTCGAGGCTTCCCACCAGAGAGCCCTGCGCATGCTGGAGAAGGCCAGACATCAGGAACTCAAGGCC
ACAGAGGAACGCTTGAAGAAGGAATCCAGCCACAGCCTCCAGATCCAACACCAGACACACCGACTGGAGCTCCAGGCCTTGGAGGAAAAG
GCCAGGCAAGAGCTGCAGGAGGAGCGTGAGAGGATGCAGGCACAGCAGGCCCTGCTGCTAGAGTCGCTCAGACAGGAGCTGTCGGAGCAG
CAAGCTGCCTGTTCTGGGCACCAGAAGGACTTGGAGGCACTGCAGGCCGAGCTGAGGGCTCTGGGCAGACAGCAAGCCAGCAGCCAGTGT
CCAGGAGACAGCAAGGATCACATAATCGCCACAGAGGAGCGGGGCGGCCCGGGCCAGGCCGGCTCCCCACCGGGCGCTGCTGGGCAGGGT
TCCGGCGAGGGATGCGGGCTCTGGGAGGAGAACGCGCAGCTCCAGGACGCGGTGCGGCGGCTGCGCGCGGAGGTGGAGCAGCATCAGCAG
GAGGCGCAGAAGCTCCGAGACCAGCGCAGGTTCCTGGAGGAGACTCAGCAAGCCCAGCGGGCCAGGGAGGTGGAGACACTGCGCCAGGAA
CACCGGAAGGAGATGCAGGCCATGGTGGCAGATTTCAGTAGTGCCCAGGCCCAGCTCCAGGCCCGGCTGGCTGCCCTGGAAGCCGAACTG
AAAGATTCCGGAGAGAAGCCAGGGAAGGGAGCGTCCAGGCCCGAGGACCTTCAGCTCATTGGCCGCCTGCAGACCCGCCTGAAGGAGAGA
GAGGACATCATCAAGCAGCTCACGGAAGAGAGAAGATTTCACTACGCAGCATTCCCCAGTGCCATGTCCCACCGGAATCGGTCTTTCTCT
TTCAATCCTCACCCGGGATATTTGACCCCTTCCATGAAGAAAAAGAAGGTGGAGGACGTGCCCAGCCGCGTGGTCAGCGTGCCGAACCTC
GCCTCCTATGCAAAGAACTTTCTGAGTGGCGATCTGAGTTCCAGGATTAATGCCCCTCCAATAACTACATCACCCAGCTTGGACCCAAGC
CCCAGCTGTGGCCGGACCTACAAACCCAACCAGTCTACAGATGCAAAAACTGCCACAAGGACCCCAGATGGTGAAACGGCCCAAGCCAAA

>In-frame_CXADR_ENST00000400165_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_2190nt
ATGGCGCTCCTGCTGTGCTTCGTGCTCCTGTGCGGAGTAGTGGATTTCGCCAGAAGTTTGAGTATCACTACTCCTGAAGAGATGATTGAA
AAAGCCAAAGGGGAAACTGCCTATCTGCCATGCAAATTTACGCTTAGTCCCGAAGACCAGGGACCGCTGGACATCGAGTGGCTGATATCA
CCAGCTGATAATCAGAAGGTGGATCAAGTGATTATTTTATATTCTGGAGACAAAATTTATGATGACTACTATCCAGATCTGAAAGGCCGA
GTACATTTTACGAGTAATGATCTCAAATCTGGTGATGCATCAATAAATGTAACGAATTTACAACTGTCAGATATTGGCACATATCAGTGC
AAAGTGAAAAAAGCTCCTGGTGTTGCAAATAAGAAGATTCATCTGGTAGTTCTTGGGAAGATGTGCCACCTCCAAAGAGCCGTACGTCCA
CTGCCAGAAGCTACATCGGCAGTAATCATTCATCCCTGGGGTCCATGTCTCCTTCCAACATGGAAGGATATTCCAAGACTCAGTATAACC
AAGTACCAAGTGAAGACTTTGAACGCACTCCTCAGAGTCCGACTCTCCCACCTGCTAAGGTAGGATCCATGCTTGAAGCTGGATGAAACT
TCGCCGAGAGGAGAGGAGTATCAAGATAAGTTAGCAGCTGAAGAAGGAACCAGCAGTGATGAAGAAGAAAGGACCAAAGTGCTTCTCAAG
GAGGGAAGTGACCCACAACCTCCACTGGGCTCTTTGTTGAAGGAGAAAACATCCAAAATCCAGCGTCTAGAGGAGGACTGGCAAAGCCAG
AAGGCCAAATTGCAAGCCCAGGTCTCACAGATGCAGCAGGCTCTGGAGCAGTGCACCAGCAACTACAGGGAGGACCTGCAGGCACTCAAG
CAGCTCTCGGACCTGGAGAGGGAGAAGCTGCAGCGTGAGCTCCAGGAGACCACTCAGCAGAACCACGCCATGAAAGCCCAGCTCGAGGCT
TCCCACCAGAGAGCCCTGCGCATGCTGGAGAAGGCCAGACATCAGGAACTCAAGGCCACAGAGGAACGCTTGAAGAAGGAATCCAGCCAC
AGCCTCCAGATCCAACACCAGACACACCGACTGGAGCTCCAGGCCTTGGAGGAAAAGGCCAGGCAAGAGCTGCAGGAGGAGCGTGAGAGG
ATGCAGGCACAGCAGGCCCTGCTGCTAGAGTCGCTCAGACAGGAGCTGTCGGAGCAGCAAGCTGCCTGTTCTGGGCACCAGAAGGACTTG
GAGGCACTGCAGGCCGAGCTGAGGGCTCTGGGCAGACAGCAAGCCAGCAGCCAGTGTCCAGGAGACAGCAAGGATCACATAATCGCCACA
GAGGAGCGGGGCGGCCCGGGCCAGGCCGGCTCCCCACCGGGCGCTGCTGGGCAGGGTTCCGGCGAGGGATGCGGGCTCTGGGAGGAGAAC
GCGCAGCTCCAGGACGCGGTGCGGCGGCTGCGCGCGGAGGTGGAGCAGCATCAGCAGGAGGCGCAGAAGCTCCGAGACCAGCGCAGGTTC
CTGGAGGAGACTCAGCAAGCCCAGCGGGCCAGGGAGGTGGAGACACTGCGCCAGGAACACCGGAAGGAGATGCAGGCCATGGTGGCAGAT
TTCAGTAGTGCCCAGGCCCAGCTCCAGGCCCGGCTGGCTGCCCTGGAAGCCGAACTGAAAGATTCCGGAGAGAAGCCAGGGAAGGGAGCG
TCCAGGCCCGAGGACCTTCAGCTCATTGGCCGCCTGCAGACCCGCCTGAAGGAGAGAGAGGACATCATCAAGCAGCTCACGGAAGAGAGA
AGATTTCACTACGCAGCATTCCCCAGTGCCATGTCCCACCGGAATCGGTCTTTCTCTTTCAATCCTCACCCGGGATATTTGACCCCTTCC
ATGAAGAAAAAGAAGGTGGAGGACGTGCCCAGCCGCGTGGTCAGCGTGCCGAACCTCGCCTCCTATGCAAAGAACTTTCTGAGTGGCGAT
CTGAGTTCCAGGATTAATGCCCCTCCAATAACTACATCACCCAGCTTGGACCCAAGCCCCAGCTGTGGCCGGACCTACAAACCCAACCAG
TCTACAGATGCAAAAACTGCCACAAGGACCCCAGATGGTGAAACGGCCCAAGCCAAAGAAGTCCAGCAGAAACAGGGCTCTCCGCACCAG

>In-frame_CXADR_ENST00000306618_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_2562nt
ATGGCGCTCCTGCTGTGCTTCGTGCTCCTGTGCGGAGTAGTGGATTTCGCCAGAAGTTTGAGTATCACTACTCCTGAAGAGATGATTGAA
AAAGCCAAAGGGGAAACTGCCTATCTGCCATGCAAATTTACGCTTAGTCCCGAAGACCAGGGACCGCTGGACATCGAGTGGCTGATATCA
CCAGCTGATAATCAGAAGGTGGATCAAGTGATTATTTTATATTCTGGAGACAAAATTTATGATGACTACTATCCAGATCTGAAAGGCCGA
GTACATTTTACGAGTAATGATCTCAAATCTGGTGATGCATCAATAAATGTAACGAATTTACAACTGTCAGATATTGGCACATATCAGTGC
AAAGTGAAAAAAGCTCCTGGTGTTGCAAATAAGAAGATTCATCTGGTAGTTCTTGTTAAGCCTTCAGGTGCGAGATGTTACGTTGATGGA
TCTGAAGAAATTGGAAGTGACTTTAAGATAAAATGTGAACCAAAAGAAGGTTCACTTCCATTACAGTATGAGTGGCAAAAATTGTCTGAC
TCACAGAAAATGCCCACTTCATGGTTAGCAGCTTCAAATAAAGCTGGACTAATTGCAGGAGCCATTATAGGAACTTTGCTTGCTCTAGCG
CTCATTGGTCTTATCATCTTTTGCTGTCGTAAAAAGCGCAGAGAAGAAAAATATGAAAAGGAAGTTCATCACGATATCAGGGAAGATGTG
CCACCTCCAAAGAGCCGTACGTCCACTGCCAGAAGCTACATCGGCAGTAATCATTCATCCCTGGGGTCCATGTCTCCTTCCAACATGGAA
GGATATTCCAAGACTCAGTATAACCAAGTACCAAGTGAAGACTTTGAACGCACTCCTCAGAGTCCGACTCTCCCACCTGCTAAGGTAGCT
GCCCCTAATCTAAGTCGAATGGGTGCGATTCCTGTGATGATTCCAGCACAGAGCAAGGATGGGTCTATAGTATAGGATCCATGCTTGAAG
CTGGATGAAACTTCGCCGAGAGGAGAGGAGTATCAAGATAAGTTAGCAGCTGAAGAAGGAACCAGCAGTGATGAAGAAGAAAGGACCAAA
GTGCTTCTCAAGGAGGGAAGTGACCCACAACCTCCACTGGGCTCTTTGTTGAAGGAGAAAACATCCAAAATCCAGCGTCTAGAGGAGGAC
TGGCAAAGCCAGAAGGCCAAATTGCAAGCCCAGGTCTCACAGATGCAGCAGGCTCTGGAGCAGTGCACCAGCAACTACAGGGAGGACCTG
CAGGCACTCAAGCAGCTCTCGGACCTGGAGAGGGAGAAGCTGCAGCGTGAGCTCCAGGAGACCACTCAGCAGAACCACGCCATGAAAGCC
CAGCTCGAGGCTTCCCACCAGAGAGCCCTGCGCATGCTGGAGAAGGCCAGACATCAGGAACTCAAGGCCACAGAGGAACGCTTGAAGAAG
GAATCCAGCCACAGCCTCCAGATCCAACACCAGACACACCGACTGGAGCTCCAGGCCTTGGAGGAAAAGGCCAGGCAAGAGCTGCAGGAG
GAGCGTGAGAGGATGCAGGCACAGCAGGCCCTGCTGCTAGAGTCGCTCAGACAGGAGCTGTCGGAGCAGCAAGCTGCCTGTTCTGGGCAC
CAGAAGGACTTGGAGGCACTGCAGGCCGAGCTGAGGGCTCTGGGCAGACAGCAAGCCAGCAGCCAGTGTCCAGGAGACAGCAAGGATCAC
ATAATCGCCACAGAGGAGCGGGGCGGCCCGGGCCAGGCCGGCTCCCCACCGGGCGCTGCTGGGCAGGGTTCCGGCGAGGGATGCGGGCTC
TGGGAGGAGAACGCGCAGCTCCAGGACGCGGTGCGGCGGCTGCGCGCGGAGGTGGAGCAGCATCAGCAGGAGGCGCAGAAGCTCCGAGAC
CAGCGCAGGTTCCTGGAGGAGACTCAGCAAGCCCAGCGGGCCAGGGAGGTGGAGACACTGCGCCAGGAACACCGGAAGGAGATGCAGGCC
ATGGTGGCAGATTTCAGTAGTGCCCAGGCCCAGCTCCAGGCCCGGCTGGCTGCCCTGGAAGCCGAACTGAAAGATTCCGGAGAGAAGCCA
GGGAAGGGAGCGTCCAGGCCCGAGGACCTTCAGCTCATTGGCCGCCTGCAGACCCGCCTGAAGGAGAGAGAGGACATCATCAAGCAGCTC
ACGGAAGAGAGAAGATTTCACTACGCAGCATTCCCCAGTGCCATGTCCCACCGGAATCGGTCTTTCTCTTTCAATCCTCACCCGGGATAT
TTGACCCCTTCCATGAAGAAAAAGAAGGTGGAGGACGTGCCCAGCCGCGTGGTCAGCGTGCCGAACCTCGCCTCCTATGCAAAGAACTTT
CTGAGTGGCGATCTGAGTTCCAGGATTAATGCCCCTCCAATAACTACATCACCCAGCTTGGACCCAAGCCCCAGCTGTGGCCGGACCTAC
AAACCCAACCAGTCTACAGATGCAAAAACTGCCACAAGGACCCCAGATGGTGAAACGGCCCAAGCCAAAGAAGTCCAGCAGAAACAGGGC

>In-frame_CXADR_ENST00000400169_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_2604nt
ATGGCGCTCCTGCTGTGCTTCGTGCTCCTGTGCGGAGTAGTGGATTTCGCCAGAAGTTTGAGTATCACTACTCCTGAAGAGATGATTGAA
AAAGCCAAAGGGGAAACTGCCTATCTGCCATGCAAATTTACGCTTAGTCCCGAAGACCAGGGACCGCTGGACATCGAGTGGCTGATATCA
CCAGCTGATAATCAGAAGGTGGATCAAGTGATTATTTTATATTCTGGAGACAAAATTTATGATGACTACTATCCAGATCTGAAAGGCCGA
GTACATTTTACGAGTAATGATCTCAAATCTGGTGATGCATCAATAAATGTAACGAATTTACAACTGTCAGATATTGGCACATATCAGTGC
AAAGTGAAAAAAGCTCCTGGTGTTGCAAATAAGAAGATTCATCTGGTAGTTCTTGTTAAGCCTTCAGGTGCGAGATGTTACGTTGATGGA
TCTGAAGAAATTGGAAGTGACTTTAAGATAAAATGTGAACCAAAAGAAGGTTCACTTCCATTACAGTATGAGTGGCAAAAATTGTCTGAC
TCACAGAAAATGCCCACTTCATGGTTAGCAGAAATGACTTCATCTGTTATATCTGTAAAAAATGCCTCTTCTGAGTACTCTGGGACATAC
AGCTGTACAGTCAGAAACAGAGTGGGCTCTGATCAGTGCCTGTTGCGTCTAAACGTTGTCCCTCCTTCAAATAAAGCTGGACTAATTGCA
GGAGCCATTATAGGAACTTTGCTTGCTCTAGCGCTCATTGGTCTTATCATCTTTTGCTGTCGTAAAAAGCGCAGAGAAGAAAAATATGAA
AAGGAAGTTCATCACGATATCAGGGAAGATGTGCCACCTCCAAAGAGCCGTACGTCCACTGCCAGAAGCTACATCGGCAGTAATCATTCA
TCCCTGGGGTCCATGTCTCCTTCCAACATGGAAGGATATTCCAAGACTCAGTATAACCAAGTACCAAGTGAAGACTTTGAACGCACTCCT
CAGAGTCCGACTCTCCCACCTGCTAAGGATCCATGCTTGAAGCTGGATGAAACTTCGCCGAGAGGAGAGGAGTATCAAGATAAGTTAGCA
GCTGAAGAAGGAACCAGCAGTGATGAAGAAGAAAGGACCAAAGTGCTTCTCAAGGAGGGAAGTGACCCACAACCTCCACTGGGCTCTTTG
TTGAAGGAGAAAACATCCAAAATCCAGCGTCTAGAGGAGGACTGGCAAAGCCAGAAGGCCAAATTGCAAGCCCAGGTCTCACAGATGCAG
CAGGCTCTGGAGCAGTGCACCAGCAACTACAGGGAGGACCTGCAGGCACTCAAGCAGCTCTCGGACCTGGAGAGGGAGAAGCTGCAGCGT
GAGCTCCAGGAGACCACTCAGCAGAACCACGCCATGAAAGCCCAGCTCGAGGCTTCCCACCAGAGAGCCCTGCGCATGCTGGAGAAGGCC
AGACATCAGGAACTCAAGGCCACAGAGGAACGCTTGAAGAAGGAATCCAGCCACAGCCTCCAGATCCAACACCAGACACACCGACTGGAG
CTCCAGGCCTTGGAGGAAAAGGCCAGGCAAGAGCTGCAGGAGGAGCGTGAGAGGATGCAGGCACAGCAGGCCCTGCTGCTAGAGTCGCTC
AGACAGGAGCTGTCGGAGCAGCAAGCTGCCTGTTCTGGGCACCAGAAGGACTTGGAGGCACTGCAGGCCGAGCTGAGGGCTCTGGGCAGA
CAGCAAGCCAGCAGCCAGTGTCCAGGAGACAGCAAGGATCACATAATCGCCACAGAGGAGCGGGGCGGCCCGGGCCAGGCCGGCTCCCCA
CCGGGCGCTGCTGGGCAGGGTTCCGGCGAGGGATGCGGGCTCTGGGAGGAGAACGCGCAGCTCCAGGACGCGGTGCGGCGGCTGCGCGCG
GAGGTGGAGCAGCATCAGCAGGAGGCGCAGAAGCTCCGAGACCAGCGCAGGTTCCTGGAGGAGACTCAGCAAGCCCAGCGGGCCAGGGAG
GTGGAGACACTGCGCCAGGAACACCGGAAGGAGATGCAGGCCATGGTGGCAGATTTCAGTAGTGCCCAGGCCCAGCTCCAGGCCCGGCTG
GCTGCCCTGGAAGCCGAACTGAAAGATTCCGGAGAGAAGCCAGGGAAGGGAGCGTCCAGGCCCGAGGACCTTCAGCTCATTGGCCGCCTG
CAGACCCGCCTGAAGGAGAGAGAGGACATCATCAAGCAGCTCACGGAAGAGAGAAGATTTCACTACGCAGCATTCCCCAGTGCCATGTCC
CACCGGAATCGGTCTTTCTCTTTCAATCCTCACCCGGGATATTTGACCCCTTCCATGAAGAAAAAGAAGGTGGAGGACGTGCCCAGCCGC
GTGGTCAGCGTGCCGAACCTCGCCTCCTATGCAAAGAACTTTCTGAGTGGCGATCTGAGTTCCAGGATTAATGCCCCTCCAATAACTACA
TCACCCAGCTTGGACCCAAGCCCCAGCTGTGGCCGGACCTACAAACCCAACCAGTCTACAGATGCAAAAACTGCCACAAGGACCCCAGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CXADR_ENST00000400166_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_5899nt
GGACCGGGGATTGGTACCGTAACCATGGTCAGCTGGGGTCGTTTCATCTGCCTGGTCGTGGTCACCATGGCAACCTTGTCCCTGGCCCGG
CCCTCCTTCAGTTTAGTTGAGGATACCACATTAGAGCCAGAAGATTTCGCCAGAAGTTTGAGTATCACTACTCCTGAAGAGATGATTGAA
AAAGCCAAAGGGGAAACTGCCTATCTGCCATGCAAATTTACGCTTAGTCCCGAAGACCAGGGACCGCTGGACATCGAGTGGCTGATATCA
CCAGCTGATAATCAGAAGGTGGATCAAGTGATTATTTTATATTCTGGAGACAAAATTTATGATGACTACTATCCAGATCTGAAAGGCCGA
GTACATTTTACGAGTAATGATCTCAAATCTGGTGATGCATCAATAAATGTAACGAATTTACAACTGTCAGATATTGGCACATATCAGTGC
AAAGTGAAAAAAGCTCCTGGTGTTGCAAATAAGAAGATTCATCTGGTAGTTCTTGTTAAGCCTTCAGGTGCGAGATGTTACGTTGATGGA
TCTGAAGAAATTGGAAGTGACTTTAAGATAAAATGTGAACCAAAAGAAGGTTCACTTCCATTACAGTATGAGTGGCAAAAATTGTCTGAC
TCACAGAAAATGCCCACTTCATGGTTAGCAGGGAAGATGTGCCACCTCCAAAGAGCCGTACGTCCACTGCCAGAAGCTACATCGGCAGTA
ATCATTCATCCCTGGGGTCCATGTCTCCTTCCAACATGGAAGGATATTCCAAGACTCAGTATAACCAAGTACCAAGTGAAGACTTTGAAC
GCACTCCTCAGAGTCCGACTCTCCCACCTGCTAAGGTAGCTGCCCCTAATCTAAGTCGAATGGGTGCGATTCCTGTGATGATTCCAGCAC
AGAGCAAGGATGGGTCTATAGTATAGAGCCTCCATATGTCTCATCTGTGCTCTCCGTGTTCCTTTCCTTTTTTTGATATATGAAAACCTA
TTCTGGTCTAAATTGTGTTACTAGCCTCAAAATACATCAAAAAATAAGTTAATCAGGAACTGTACGGAATATATTTTTAAAAATTTTTGT
TTGGTTGATCCATGCTTGAAGCTGGATGAAACTTCGCCGAGAGGAGAGGAGTATCAAGATAAGTTAGCAGCTGAAGAAGGAACCAGCAGT
GATGAAGAAGAAAGGACCAAAGTGCTTCTCAAGGAGGGAAGTGACCCACAACCTCCACTGGGCTCTTTGTTGAAGGAGAAAACATCCAAA
ATCCAGCGTCTAGAGGAGGACTGGCAAAGCCAGAAGGCCAAATTGCAAGCCCAGGTCTCACAGATGCAGCAGGCTCTGGAGCAGTGCACC
AGCAACTACAGGGAGGACCTGCAGGCACTCAAGCAGCTCTCGGACCTGGAGAGGGAGAAGCTGCAGCGTGAGCTCCAGGAGACCACTCAG
CAGAACCACGCCATGAAAGCCCAGCTCGAGGCTTCCCACCAGAGAGCCCTGCGCATGCTGGAGAAGGCCAGACATCAGGAACTCAAGGCC
ACAGAGGAACGCTTGAAGAAGGAATCCAGCCACAGCCTCCAGATCCAACACCAGACACACCGACTGGAGCTCCAGGCCTTGGAGGAAAAG
GCCAGGCAAGAGCTGCAGGAGGAGCGTGAGAGGATGCAGGCACAGCAGGCCCTGCTGCTAGAGTCGCTCAGACAGGAGCTGTCGGAGCAG
CAAGCTGCCTGTTCTGGGCACCAGAAGGACTTGGAGGCACTGCAGGCCGAGCTGAGGGCTCTGGGCAGACAGCAAGCCAGCAGCCAGTGT
CCAGGAGACAGCAAGGATCACATAATCGCCACAGAGGAGCGGGGCGGCCCGGGCCAGGCCGGCTCCCCACCGGGCGCTGCTGGGCAGGGT
TCCGGCGAGGGATGCGGGCTCTGGGAGGAGAACGCGCAGCTCCAGGACGCGGTGCGGCGGCTGCGCGCGGAGGTGGAGCAGCATCAGCAG
GAGGCGCAGAAGCTCCGAGACCAGCGCAGGTTCCTGGAGGAGACTCAGCAAGCCCAGCGGGCCAGGGAGGTGGAGACACTGCGCCAGGAA
CACCGGAAGGAGATGCAGGCCATGGTGGCAGATTTCAGTAGTGCCCAGGCCCAGCTCCAGGCCCGGCTGGCTGCCCTGGAAGCCGAACTG
AAAGATTCCGGAGAGAAGCCAGGGAAGGGAGCGTCCAGGCCCGAGGACCTTCAGCTCATTGGCCGCCTGCAGACCCGCCTGAAGGAGAGA
GAGGACATCATCAAGCAGCTCACGGAAGAGAGAAGATTTCACTACGCAGCATTCCCCAGTGCCATGTCCCACCGGAATCGGTCTTTCTCT
TTCAATCCTCACCCGGGATATTTGACCCCTTCCATGAAGAAAAAGAAGGTGGAGGACGTGCCCAGCCGCGTGGTCAGCGTGCCGAACCTC
GCCTCCTATGCAAAGAACTTTCTGAGTGGCGATCTGAGTTCCAGGATTAATGCCCCTCCAATAACTACATCACCCAGCTTGGACCCAAGC
CCCAGCTGTGGCCGGACCTACAAACCCAACCAGTCTACAGATGCAAAAACTGCCACAAGGACCCCAGATGGTGAAACGGCCCAAGCCAAA
GAAGTCCAGCAGAAACAGGGCTCTCCGCACCAGGAATGGTTCACCAAGTACTTTTCTTTCTAAGCTAACCTTTGGGATACATCACAGAGG
ATACTTGAAAAACATTTATTTTAAATCATCCGATTGAAGGAATGAACTAACACCAACCAACCAAATAATATGCTTATGATTTATATATGA
TAGCTAAAACAAATTTTGGCGTTAACACTTCATACTGTTCTGCCAGGCACAGCAGCTCACGCCTGTAATCCCATCACTTTGGGAGGCTGA
GGCAGATGGACTGCTTGAGTCCAGGAATTTGAGACCAGCCTGGCCAATATGGTGAAACCCCATCTCTACAAAATATACAAAAATTAGCCA
GGCATGGTGGCGTGTGCCTGTGGTCCCAGGTACTTGGGGGACTGAGGCGGGAGGATCACTTGAACCTAGGAGGCAGAGGTTGCAGTGAGC
CAAGTTCGAACTCCTGCATTCCAACCAGCCTGGGTGACAGAGGGAGACCCTGTCTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAATTGACATTAAACCAGTGTTATTAAAAGTCATCTATAGGAAAATGTTATTAGCGTTACTAATGACCCATACCTTGTATTT
CTAGTGTCCATAACATCATACTCCATTTTGTGGAACATCAGACTTTGTGATTTCCATGATCTATTTCAAAAGTGGTTGTACTTGTCCTTA
GGATGCTAGTCAACTCCACTGGAAAGCTGTTTCTATGTAAAATGATGCAATTCCAAAATGCACATCTAACCTCAATAGGAAGACAAATAA
CAGTTAAACAGGAAAGCCAACTAAAAACAAACCAAACCTACCAGAAATGGATGGTAGCATGCTTGGACTGAATACTTTCACTTCCTTGGT
CTAAGACAAGCAGCAGATTATAGATGGGATAACACCCACCTCTAAAAGGGCTTTGCAAGGATTAAGCAAGATAACATAAATTAACATGAA
TTGGAATTAAGTACCACAAGGTTTTTCTGTAAATAACCAATCCTAGCCCAGTTATAGGTCTCAGTGTAATGACCATAGTGCCAACATGAT
CACTTGTGAAGGTCTCTAGATTATCTGTTCTTTGAAGTCAAAGATCTTCTAGACTGGGCACATGGCTCATGCCTGTAATCCCAACACTTT
GGGAGGCTGAGATGGGAGGAGAGCTTGAGGCCAGGAATTTGAGACCAGCCTGGGCAACACAGCGAGACCTCCATCTCTACAAAAAAATAA
TTAGCCCAAAGAAAACCCAGCTACTTGGAAGTCTGAGGTAGGACAGCATGAGCCCAAGAGTTCGAGACCAGCCTGGGCAAGATAGTGAGA
TCCCATCTCTACAGATTAAAAAAATATATATATATATCCCCTGAACCTCTGGTCTTTGGGTTTGAGCCATTTGCCTCATGGTGTGTTGCT
TCTTCACTGCATGAATTCCCAGTGGGTTAAAGGAACCGCAATGGCTGTTCACGGTGCTGACCTTGCTCTCAGTCCACACTGATTTGTCTT
ACCTTCTGACAGAGCAATGTGATTTGACAAGACTCAATAACAACTTTTAGGGGGCAAAATATTTTTTCAGTCTTTGGTGCTGGCCCAGAA
GGTGGCCCACAAACCAATGTTAATTCTATGCATTGTCAAATCTTTGCTCTTTGAATAAAACTTTGAATAACTGGGCAATAAAAATGGTTG
ACTTGTATTGATTTTCCACAGAAAGGTAAAATTAGATGAAGACAGCTTAGAAATAGAAAGTTCAGTTCACATTAACCTCAATCACACCAT
CTTAAAAAAAAAAAAGCTGATTACATATAACTGTCAAACTTACGTATTAAAGGTAAATTTACTGCCTAATCAAAACGAGGCTCCAATGCA
TTTTTAAATGCAAACAAACACTTGTCACCATACATTAACACACCATACTGTTTTTCACTACCAAATATTTTTTGTGAGTTTCCCGCTTAG
AGTGTCTTAGTTCGTTCAGGCTGCTCTAACAAAATATCTTACTTATACTGGATAATTTATAAACAATAGAAATATGTCACTCACAGTCCT
AGAGGCTAAGTCCAAGATCAAGGCACCAGCAGATATGGAGTCTGGGGAGGGCCCATTCTTCAGAAATGGGTGCCTGCTACGTGTCCTTAC
ATGGTGGAAGAGGCAAGAGCGCCTCCCTGAGCCTCTTTTGTAAGGGTACTTATCCTACTCATGAGGGTGAAGCCCTCATGACTCCATTGC
TTCCCAAAAGCCCCACCTCTTAATACTATTACATTGACATTAGGTTCCAACATATGAATTTTGGAAGGGACATCAACATTCAGGACATAG
CAGTGAACCCTGTAGGACTGCTCTTTATTTTGTGCTTTCAAAAAGACTACATACAGGTGGTTCTATTTTTGTGTGTTGAAACACTTTCCC
AGGCTGCACTTTGCATTTCTGTCCTTAAACTCAGCATGATCCCTGGGCAAGGAGAAAATTTTACTAGTTGAGATCGTACATAGGTTTTGA
CTCCTTTCTTGCTGCAGGTGACTGAAAAGATCTTTCAGTCTTAAATTTCTAAATTCTACCCTGCAATGATTATATCTTTGTTAACAAAAT
CTTTGCATGCTTCCATAATTTTTTATTGAGGCCATATGCCTTGGGTATTGAAGTAAGGCATTTAAGGACACAAACTTAAGCTTTTTGTTT
GTTATTACCAAACTGCCATTCAGAAAGTTTCTAACAATTTACACCCTTACCAGCAGTAAATGAACCTACTGTGCCCTAACACTATTGACA
AAGAAATACAATTTGATAGATAAAACATTCTATTTTAGTTTGCATAATGATTCCATCAATCTCTCAACAGCAGAGCGGTCTAGAGATGAC
AGTGATGGCGTAGAGGTGACAGTGAAGATGAAGAGAAATTATCCAATTCGGGATTAAGTTAAGAGAGAGAAAAAAACAGTATTTAATGGT
AAATCTCTTCAGGCTGTATTATGACAGGGGTGGAAGAGTTAATATGTTCCTGCAGCAAAACTGAAAGGAATACTATCTGTTCCACATGAA
AGCAAACTGTTTTGTAATTGGGGTAGGTAAAAATGGATTCACCCAGTCAATGGCTGCACACCACATACCTGAGCCCTTAACTGCTCTAAC
ACTGATGTAATATCCAACCCAACATTTGTGATTGAGGCTACTTGGTTAATTTTTCTCCAGGATCCATCTGGATTCTGCAGATGAGGCTGG

>In-frame_CXADR_ENST00000400165_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_5416nt
ATGGCGCTCCTGCTGTGCTTCGTGCTCCTGTGCGGAGTAGTGGATTTCGCCAGAAGTTTGAGTATCACTACTCCTGAAGAGATGATTGAA
AAAGCCAAAGGGGAAACTGCCTATCTGCCATGCAAATTTACGCTTAGTCCCGAAGACCAGGGACCGCTGGACATCGAGTGGCTGATATCA
CCAGCTGATAATCAGAAGGTGGATCAAGTGATTATTTTATATTCTGGAGACAAAATTTATGATGACTACTATCCAGATCTGAAAGGCCGA
GTACATTTTACGAGTAATGATCTCAAATCTGGTGATGCATCAATAAATGTAACGAATTTACAACTGTCAGATATTGGCACATATCAGTGC
AAAGTGAAAAAAGCTCCTGGTGTTGCAAATAAGAAGATTCATCTGGTAGTTCTTGGGAAGATGTGCCACCTCCAAAGAGCCGTACGTCCA
CTGCCAGAAGCTACATCGGCAGTAATCATTCATCCCTGGGGTCCATGTCTCCTTCCAACATGGAAGGATATTCCAAGACTCAGTATAACC
AAGTACCAAGTGAAGACTTTGAACGCACTCCTCAGAGTCCGACTCTCCCACCTGCTAAGGTAGGATCCATGCTTGAAGCTGGATGAAACT
TCGCCGAGAGGAGAGGAGTATCAAGATAAGTTAGCAGCTGAAGAAGGAACCAGCAGTGATGAAGAAGAAAGGACCAAAGTGCTTCTCAAG
GAGGGAAGTGACCCACAACCTCCACTGGGCTCTTTGTTGAAGGAGAAAACATCCAAAATCCAGCGTCTAGAGGAGGACTGGCAAAGCCAG
AAGGCCAAATTGCAAGCCCAGGTCTCACAGATGCAGCAGGCTCTGGAGCAGTGCACCAGCAACTACAGGGAGGACCTGCAGGCACTCAAG
CAGCTCTCGGACCTGGAGAGGGAGAAGCTGCAGCGTGAGCTCCAGGAGACCACTCAGCAGAACCACGCCATGAAAGCCCAGCTCGAGGCT
TCCCACCAGAGAGCCCTGCGCATGCTGGAGAAGGCCAGACATCAGGAACTCAAGGCCACAGAGGAACGCTTGAAGAAGGAATCCAGCCAC
AGCCTCCAGATCCAACACCAGACACACCGACTGGAGCTCCAGGCCTTGGAGGAAAAGGCCAGGCAAGAGCTGCAGGAGGAGCGTGAGAGG
ATGCAGGCACAGCAGGCCCTGCTGCTAGAGTCGCTCAGACAGGAGCTGTCGGAGCAGCAAGCTGCCTGTTCTGGGCACCAGAAGGACTTG
GAGGCACTGCAGGCCGAGCTGAGGGCTCTGGGCAGACAGCAAGCCAGCAGCCAGTGTCCAGGAGACAGCAAGGATCACATAATCGCCACA
GAGGAGCGGGGCGGCCCGGGCCAGGCCGGCTCCCCACCGGGCGCTGCTGGGCAGGGTTCCGGCGAGGGATGCGGGCTCTGGGAGGAGAAC
GCGCAGCTCCAGGACGCGGTGCGGCGGCTGCGCGCGGAGGTGGAGCAGCATCAGCAGGAGGCGCAGAAGCTCCGAGACCAGCGCAGGTTC
CTGGAGGAGACTCAGCAAGCCCAGCGGGCCAGGGAGGTGGAGACACTGCGCCAGGAACACCGGAAGGAGATGCAGGCCATGGTGGCAGAT
TTCAGTAGTGCCCAGGCCCAGCTCCAGGCCCGGCTGGCTGCCCTGGAAGCCGAACTGAAAGATTCCGGAGAGAAGCCAGGGAAGGGAGCG
TCCAGGCCCGAGGACCTTCAGCTCATTGGCCGCCTGCAGACCCGCCTGAAGGAGAGAGAGGACATCATCAAGCAGCTCACGGAAGAGAGA
AGATTTCACTACGCAGCATTCCCCAGTGCCATGTCCCACCGGAATCGGTCTTTCTCTTTCAATCCTCACCCGGGATATTTGACCCCTTCC
ATGAAGAAAAAGAAGGTGGAGGACGTGCCCAGCCGCGTGGTCAGCGTGCCGAACCTCGCCTCCTATGCAAAGAACTTTCTGAGTGGCGAT
CTGAGTTCCAGGATTAATGCCCCTCCAATAACTACATCACCCAGCTTGGACCCAAGCCCCAGCTGTGGCCGGACCTACAAACCCAACCAG
TCTACAGATGCAAAAACTGCCACAAGGACCCCAGATGGTGAAACGGCCCAAGCCAAAGAAGTCCAGCAGAAACAGGGCTCTCCGCACCAG
GAATGGTTCACCAAGTACTTTTCTTTCTAAGCTAACCTTTGGGATACATCACAGAGGATACTTGAAAAACATTTATTTTAAATCATCCGA
TTGAAGGAATGAACTAACACCAACCAACCAAATAATATGCTTATGATTTATATATGATAGCTAAAACAAATTTTGGCGTTAACACTTCAT
ACTGTTCTGCCAGGCACAGCAGCTCACGCCTGTAATCCCATCACTTTGGGAGGCTGAGGCAGATGGACTGCTTGAGTCCAGGAATTTGAG
ACCAGCCTGGCCAATATGGTGAAACCCCATCTCTACAAAATATACAAAAATTAGCCAGGCATGGTGGCGTGTGCCTGTGGTCCCAGGTAC
TTGGGGGACTGAGGCGGGAGGATCACTTGAACCTAGGAGGCAGAGGTTGCAGTGAGCCAAGTTCGAACTCCTGCATTCCAACCAGCCTGG
GTGACAGAGGGAGACCCTGTCTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATTGACATTAAACCAGTGTTATT
AAAAGTCATCTATAGGAAAATGTTATTAGCGTTACTAATGACCCATACCTTGTATTTCTAGTGTCCATAACATCATACTCCATTTTGTGG
AACATCAGACTTTGTGATTTCCATGATCTATTTCAAAAGTGGTTGTACTTGTCCTTAGGATGCTAGTCAACTCCACTGGAAAGCTGTTTC
TATGTAAAATGATGCAATTCCAAAATGCACATCTAACCTCAATAGGAAGACAAATAACAGTTAAACAGGAAAGCCAACTAAAAACAAACC
AAACCTACCAGAAATGGATGGTAGCATGCTTGGACTGAATACTTTCACTTCCTTGGTCTAAGACAAGCAGCAGATTATAGATGGGATAAC
ACCCACCTCTAAAAGGGCTTTGCAAGGATTAAGCAAGATAACATAAATTAACATGAATTGGAATTAAGTACCACAAGGTTTTTCTGTAAA
TAACCAATCCTAGCCCAGTTATAGGTCTCAGTGTAATGACCATAGTGCCAACATGATCACTTGTGAAGGTCTCTAGATTATCTGTTCTTT
GAAGTCAAAGATCTTCTAGACTGGGCACATGGCTCATGCCTGTAATCCCAACACTTTGGGAGGCTGAGATGGGAGGAGAGCTTGAGGCCA
GGAATTTGAGACCAGCCTGGGCAACACAGCGAGACCTCCATCTCTACAAAAAAATAATTAGCCCAAAGAAAACCCAGCTACTTGGAAGTC
TGAGGTAGGACAGCATGAGCCCAAGAGTTCGAGACCAGCCTGGGCAAGATAGTGAGATCCCATCTCTACAGATTAAAAAAATATATATAT
ATATCCCCTGAACCTCTGGTCTTTGGGTTTGAGCCATTTGCCTCATGGTGTGTTGCTTCTTCACTGCATGAATTCCCAGTGGGTTAAAGG
AACCGCAATGGCTGTTCACGGTGCTGACCTTGCTCTCAGTCCACACTGATTTGTCTTACCTTCTGACAGAGCAATGTGATTTGACAAGAC
TCAATAACAACTTTTAGGGGGCAAAATATTTTTTCAGTCTTTGGTGCTGGCCCAGAAGGTGGCCCACAAACCAATGTTAATTCTATGCAT
TGTCAAATCTTTGCTCTTTGAATAAAACTTTGAATAACTGGGCAATAAAAATGGTTGACTTGTATTGATTTTCCACAGAAAGGTAAAATT
AGATGAAGACAGCTTAGAAATAGAAAGTTCAGTTCACATTAACCTCAATCACACCATCTTAAAAAAAAAAAAGCTGATTACATATAACTG
TCAAACTTACGTATTAAAGGTAAATTTACTGCCTAATCAAAACGAGGCTCCAATGCATTTTTAAATGCAAACAAACACTTGTCACCATAC
ATTAACACACCATACTGTTTTTCACTACCAAATATTTTTTGTGAGTTTCCCGCTTAGAGTGTCTTAGTTCGTTCAGGCTGCTCTAACAAA
ATATCTTACTTATACTGGATAATTTATAAACAATAGAAATATGTCACTCACAGTCCTAGAGGCTAAGTCCAAGATCAAGGCACCAGCAGA
TATGGAGTCTGGGGAGGGCCCATTCTTCAGAAATGGGTGCCTGCTACGTGTCCTTACATGGTGGAAGAGGCAAGAGCGCCTCCCTGAGCC
TCTTTTGTAAGGGTACTTATCCTACTCATGAGGGTGAAGCCCTCATGACTCCATTGCTTCCCAAAAGCCCCACCTCTTAATACTATTACA
TTGACATTAGGTTCCAACATATGAATTTTGGAAGGGACATCAACATTCAGGACATAGCAGTGAACCCTGTAGGACTGCTCTTTATTTTGT
GCTTTCAAAAAGACTACATACAGGTGGTTCTATTTTTGTGTGTTGAAACACTTTCCCAGGCTGCACTTTGCATTTCTGTCCTTAAACTCA
GCATGATCCCTGGGCAAGGAGAAAATTTTACTAGTTGAGATCGTACATAGGTTTTGACTCCTTTCTTGCTGCAGGTGACTGAAAAGATCT
TTCAGTCTTAAATTTCTAAATTCTACCCTGCAATGATTATATCTTTGTTAACAAAATCTTTGCATGCTTCCATAATTTTTTATTGAGGCC
ATATGCCTTGGGTATTGAAGTAAGGCATTTAAGGACACAAACTTAAGCTTTTTGTTTGTTATTACCAAACTGCCATTCAGAAAGTTTCTA
ACAATTTACACCCTTACCAGCAGTAAATGAACCTACTGTGCCCTAACACTATTGACAAAGAAATACAATTTGATAGATAAAACATTCTAT
TTTAGTTTGCATAATGATTCCATCAATCTCTCAACAGCAGAGCGGTCTAGAGATGACAGTGATGGCGTAGAGGTGACAGTGAAGATGAAG
AGAAATTATCCAATTCGGGATTAAGTTAAGAGAGAGAAAAAAACAGTATTTAATGGTAAATCTCTTCAGGCTGTATTATGACAGGGGTGG
AAGAGTTAATATGTTCCTGCAGCAAAACTGAAAGGAATACTATCTGTTCCACATGAAAGCAAACTGTTTTGTAATTGGGGTAGGTAAAAA
TGGATTCACCCAGTCAATGGCTGCACACCACATACCTGAGCCCTTAACTGCTCTAACACTGATGTAATATCCAACCCAACATTTGTGATT
GAGGCTACTTGGTTAATTTTTCTCCAGGATCCATCTGGATTCTGCAGATGAGGCTGGCAAATTAAATGGAACTATGATAGGGACCATCTT

>In-frame_CXADR_ENST00000306618_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_5788nt
ATGGCGCTCCTGCTGTGCTTCGTGCTCCTGTGCGGAGTAGTGGATTTCGCCAGAAGTTTGAGTATCACTACTCCTGAAGAGATGATTGAA
AAAGCCAAAGGGGAAACTGCCTATCTGCCATGCAAATTTACGCTTAGTCCCGAAGACCAGGGACCGCTGGACATCGAGTGGCTGATATCA
CCAGCTGATAATCAGAAGGTGGATCAAGTGATTATTTTATATTCTGGAGACAAAATTTATGATGACTACTATCCAGATCTGAAAGGCCGA
GTACATTTTACGAGTAATGATCTCAAATCTGGTGATGCATCAATAAATGTAACGAATTTACAACTGTCAGATATTGGCACATATCAGTGC
AAAGTGAAAAAAGCTCCTGGTGTTGCAAATAAGAAGATTCATCTGGTAGTTCTTGTTAAGCCTTCAGGTGCGAGATGTTACGTTGATGGA
TCTGAAGAAATTGGAAGTGACTTTAAGATAAAATGTGAACCAAAAGAAGGTTCACTTCCATTACAGTATGAGTGGCAAAAATTGTCTGAC
TCACAGAAAATGCCCACTTCATGGTTAGCAGCTTCAAATAAAGCTGGACTAATTGCAGGAGCCATTATAGGAACTTTGCTTGCTCTAGCG
CTCATTGGTCTTATCATCTTTTGCTGTCGTAAAAAGCGCAGAGAAGAAAAATATGAAAAGGAAGTTCATCACGATATCAGGGAAGATGTG
CCACCTCCAAAGAGCCGTACGTCCACTGCCAGAAGCTACATCGGCAGTAATCATTCATCCCTGGGGTCCATGTCTCCTTCCAACATGGAA
GGATATTCCAAGACTCAGTATAACCAAGTACCAAGTGAAGACTTTGAACGCACTCCTCAGAGTCCGACTCTCCCACCTGCTAAGGTAGCT
GCCCCTAATCTAAGTCGAATGGGTGCGATTCCTGTGATGATTCCAGCACAGAGCAAGGATGGGTCTATAGTATAGGATCCATGCTTGAAG
CTGGATGAAACTTCGCCGAGAGGAGAGGAGTATCAAGATAAGTTAGCAGCTGAAGAAGGAACCAGCAGTGATGAAGAAGAAAGGACCAAA
GTGCTTCTCAAGGAGGGAAGTGACCCACAACCTCCACTGGGCTCTTTGTTGAAGGAGAAAACATCCAAAATCCAGCGTCTAGAGGAGGAC
TGGCAAAGCCAGAAGGCCAAATTGCAAGCCCAGGTCTCACAGATGCAGCAGGCTCTGGAGCAGTGCACCAGCAACTACAGGGAGGACCTG
CAGGCACTCAAGCAGCTCTCGGACCTGGAGAGGGAGAAGCTGCAGCGTGAGCTCCAGGAGACCACTCAGCAGAACCACGCCATGAAAGCC
CAGCTCGAGGCTTCCCACCAGAGAGCCCTGCGCATGCTGGAGAAGGCCAGACATCAGGAACTCAAGGCCACAGAGGAACGCTTGAAGAAG
GAATCCAGCCACAGCCTCCAGATCCAACACCAGACACACCGACTGGAGCTCCAGGCCTTGGAGGAAAAGGCCAGGCAAGAGCTGCAGGAG
GAGCGTGAGAGGATGCAGGCACAGCAGGCCCTGCTGCTAGAGTCGCTCAGACAGGAGCTGTCGGAGCAGCAAGCTGCCTGTTCTGGGCAC
CAGAAGGACTTGGAGGCACTGCAGGCCGAGCTGAGGGCTCTGGGCAGACAGCAAGCCAGCAGCCAGTGTCCAGGAGACAGCAAGGATCAC
ATAATCGCCACAGAGGAGCGGGGCGGCCCGGGCCAGGCCGGCTCCCCACCGGGCGCTGCTGGGCAGGGTTCCGGCGAGGGATGCGGGCTC
TGGGAGGAGAACGCGCAGCTCCAGGACGCGGTGCGGCGGCTGCGCGCGGAGGTGGAGCAGCATCAGCAGGAGGCGCAGAAGCTCCGAGAC
CAGCGCAGGTTCCTGGAGGAGACTCAGCAAGCCCAGCGGGCCAGGGAGGTGGAGACACTGCGCCAGGAACACCGGAAGGAGATGCAGGCC
ATGGTGGCAGATTTCAGTAGTGCCCAGGCCCAGCTCCAGGCCCGGCTGGCTGCCCTGGAAGCCGAACTGAAAGATTCCGGAGAGAAGCCA
GGGAAGGGAGCGTCCAGGCCCGAGGACCTTCAGCTCATTGGCCGCCTGCAGACCCGCCTGAAGGAGAGAGAGGACATCATCAAGCAGCTC
ACGGAAGAGAGAAGATTTCACTACGCAGCATTCCCCAGTGCCATGTCCCACCGGAATCGGTCTTTCTCTTTCAATCCTCACCCGGGATAT
TTGACCCCTTCCATGAAGAAAAAGAAGGTGGAGGACGTGCCCAGCCGCGTGGTCAGCGTGCCGAACCTCGCCTCCTATGCAAAGAACTTT
CTGAGTGGCGATCTGAGTTCCAGGATTAATGCCCCTCCAATAACTACATCACCCAGCTTGGACCCAAGCCCCAGCTGTGGCCGGACCTAC
AAACCCAACCAGTCTACAGATGCAAAAACTGCCACAAGGACCCCAGATGGTGAAACGGCCCAAGCCAAAGAAGTCCAGCAGAAACAGGGC
TCTCCGCACCAGGAATGGTTCACCAAGTACTTTTCTTTCTAAGCTAACCTTTGGGATACATCACAGAGGATACTTGAAAAACATTTATTT
TAAATCATCCGATTGAAGGAATGAACTAACACCAACCAACCAAATAATATGCTTATGATTTATATATGATAGCTAAAACAAATTTTGGCG
TTAACACTTCATACTGTTCTGCCAGGCACAGCAGCTCACGCCTGTAATCCCATCACTTTGGGAGGCTGAGGCAGATGGACTGCTTGAGTC
CAGGAATTTGAGACCAGCCTGGCCAATATGGTGAAACCCCATCTCTACAAAATATACAAAAATTAGCCAGGCATGGTGGCGTGTGCCTGT
GGTCCCAGGTACTTGGGGGACTGAGGCGGGAGGATCACTTGAACCTAGGAGGCAGAGGTTGCAGTGAGCCAAGTTCGAACTCCTGCATTC
CAACCAGCCTGGGTGACAGAGGGAGACCCTGTCTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATTGACATTAA
ACCAGTGTTATTAAAAGTCATCTATAGGAAAATGTTATTAGCGTTACTAATGACCCATACCTTGTATTTCTAGTGTCCATAACATCATAC
TCCATTTTGTGGAACATCAGACTTTGTGATTTCCATGATCTATTTCAAAAGTGGTTGTACTTGTCCTTAGGATGCTAGTCAACTCCACTG
GAAAGCTGTTTCTATGTAAAATGATGCAATTCCAAAATGCACATCTAACCTCAATAGGAAGACAAATAACAGTTAAACAGGAAAGCCAAC
TAAAAACAAACCAAACCTACCAGAAATGGATGGTAGCATGCTTGGACTGAATACTTTCACTTCCTTGGTCTAAGACAAGCAGCAGATTAT
AGATGGGATAACACCCACCTCTAAAAGGGCTTTGCAAGGATTAAGCAAGATAACATAAATTAACATGAATTGGAATTAAGTACCACAAGG
TTTTTCTGTAAATAACCAATCCTAGCCCAGTTATAGGTCTCAGTGTAATGACCATAGTGCCAACATGATCACTTGTGAAGGTCTCTAGAT
TATCTGTTCTTTGAAGTCAAAGATCTTCTAGACTGGGCACATGGCTCATGCCTGTAATCCCAACACTTTGGGAGGCTGAGATGGGAGGAG
AGCTTGAGGCCAGGAATTTGAGACCAGCCTGGGCAACACAGCGAGACCTCCATCTCTACAAAAAAATAATTAGCCCAAAGAAAACCCAGC
TACTTGGAAGTCTGAGGTAGGACAGCATGAGCCCAAGAGTTCGAGACCAGCCTGGGCAAGATAGTGAGATCCCATCTCTACAGATTAAAA
AAATATATATATATATCCCCTGAACCTCTGGTCTTTGGGTTTGAGCCATTTGCCTCATGGTGTGTTGCTTCTTCACTGCATGAATTCCCA
GTGGGTTAAAGGAACCGCAATGGCTGTTCACGGTGCTGACCTTGCTCTCAGTCCACACTGATTTGTCTTACCTTCTGACAGAGCAATGTG
ATTTGACAAGACTCAATAACAACTTTTAGGGGGCAAAATATTTTTTCAGTCTTTGGTGCTGGCCCAGAAGGTGGCCCACAAACCAATGTT
AATTCTATGCATTGTCAAATCTTTGCTCTTTGAATAAAACTTTGAATAACTGGGCAATAAAAATGGTTGACTTGTATTGATTTTCCACAG
AAAGGTAAAATTAGATGAAGACAGCTTAGAAATAGAAAGTTCAGTTCACATTAACCTCAATCACACCATCTTAAAAAAAAAAAAGCTGAT
TACATATAACTGTCAAACTTACGTATTAAAGGTAAATTTACTGCCTAATCAAAACGAGGCTCCAATGCATTTTTAAATGCAAACAAACAC
TTGTCACCATACATTAACACACCATACTGTTTTTCACTACCAAATATTTTTTGTGAGTTTCCCGCTTAGAGTGTCTTAGTTCGTTCAGGC
TGCTCTAACAAAATATCTTACTTATACTGGATAATTTATAAACAATAGAAATATGTCACTCACAGTCCTAGAGGCTAAGTCCAAGATCAA
GGCACCAGCAGATATGGAGTCTGGGGAGGGCCCATTCTTCAGAAATGGGTGCCTGCTACGTGTCCTTACATGGTGGAAGAGGCAAGAGCG
CCTCCCTGAGCCTCTTTTGTAAGGGTACTTATCCTACTCATGAGGGTGAAGCCCTCATGACTCCATTGCTTCCCAAAAGCCCCACCTCTT
AATACTATTACATTGACATTAGGTTCCAACATATGAATTTTGGAAGGGACATCAACATTCAGGACATAGCAGTGAACCCTGTAGGACTGC
TCTTTATTTTGTGCTTTCAAAAAGACTACATACAGGTGGTTCTATTTTTGTGTGTTGAAACACTTTCCCAGGCTGCACTTTGCATTTCTG
TCCTTAAACTCAGCATGATCCCTGGGCAAGGAGAAAATTTTACTAGTTGAGATCGTACATAGGTTTTGACTCCTTTCTTGCTGCAGGTGA
CTGAAAAGATCTTTCAGTCTTAAATTTCTAAATTCTACCCTGCAATGATTATATCTTTGTTAACAAAATCTTTGCATGCTTCCATAATTT
TTTATTGAGGCCATATGCCTTGGGTATTGAAGTAAGGCATTTAAGGACACAAACTTAAGCTTTTTGTTTGTTATTACCAAACTGCCATTC
AGAAAGTTTCTAACAATTTACACCCTTACCAGCAGTAAATGAACCTACTGTGCCCTAACACTATTGACAAAGAAATACAATTTGATAGAT
AAAACATTCTATTTTAGTTTGCATAATGATTCCATCAATCTCTCAACAGCAGAGCGGTCTAGAGATGACAGTGATGGCGTAGAGGTGACA
GTGAAGATGAAGAGAAATTATCCAATTCGGGATTAAGTTAAGAGAGAGAAAAAAACAGTATTTAATGGTAAATCTCTTCAGGCTGTATTA
TGACAGGGGTGGAAGAGTTAATATGTTCCTGCAGCAAAACTGAAAGGAATACTATCTGTTCCACATGAAAGCAAACTGTTTTGTAATTGG
GGTAGGTAAAAATGGATTCACCCAGTCAATGGCTGCACACCACATACCTGAGCCCTTAACTGCTCTAACACTGATGTAATATCCAACCCA
ACATTTGTGATTGAGGCTACTTGGTTAATTTTTCTCCAGGATCCATCTGGATTCTGCAGATGAGGCTGGCAAATTAAATGGAACTATGAT

>In-frame_CXADR_ENST00000400169_chr21_18937929_+_FAM184B_ENST00000265018_chr4_17666282_-_5830nt
ATGGCGCTCCTGCTGTGCTTCGTGCTCCTGTGCGGAGTAGTGGATTTCGCCAGAAGTTTGAGTATCACTACTCCTGAAGAGATGATTGAA
AAAGCCAAAGGGGAAACTGCCTATCTGCCATGCAAATTTACGCTTAGTCCCGAAGACCAGGGACCGCTGGACATCGAGTGGCTGATATCA
CCAGCTGATAATCAGAAGGTGGATCAAGTGATTATTTTATATTCTGGAGACAAAATTTATGATGACTACTATCCAGATCTGAAAGGCCGA
GTACATTTTACGAGTAATGATCTCAAATCTGGTGATGCATCAATAAATGTAACGAATTTACAACTGTCAGATATTGGCACATATCAGTGC
AAAGTGAAAAAAGCTCCTGGTGTTGCAAATAAGAAGATTCATCTGGTAGTTCTTGTTAAGCCTTCAGGTGCGAGATGTTACGTTGATGGA
TCTGAAGAAATTGGAAGTGACTTTAAGATAAAATGTGAACCAAAAGAAGGTTCACTTCCATTACAGTATGAGTGGCAAAAATTGTCTGAC
TCACAGAAAATGCCCACTTCATGGTTAGCAGAAATGACTTCATCTGTTATATCTGTAAAAAATGCCTCTTCTGAGTACTCTGGGACATAC
AGCTGTACAGTCAGAAACAGAGTGGGCTCTGATCAGTGCCTGTTGCGTCTAAACGTTGTCCCTCCTTCAAATAAAGCTGGACTAATTGCA
GGAGCCATTATAGGAACTTTGCTTGCTCTAGCGCTCATTGGTCTTATCATCTTTTGCTGTCGTAAAAAGCGCAGAGAAGAAAAATATGAA
AAGGAAGTTCATCACGATATCAGGGAAGATGTGCCACCTCCAAAGAGCCGTACGTCCACTGCCAGAAGCTACATCGGCAGTAATCATTCA
TCCCTGGGGTCCATGTCTCCTTCCAACATGGAAGGATATTCCAAGACTCAGTATAACCAAGTACCAAGTGAAGACTTTGAACGCACTCCT
CAGAGTCCGACTCTCCCACCTGCTAAGGATCCATGCTTGAAGCTGGATGAAACTTCGCCGAGAGGAGAGGAGTATCAAGATAAGTTAGCA
GCTGAAGAAGGAACCAGCAGTGATGAAGAAGAAAGGACCAAAGTGCTTCTCAAGGAGGGAAGTGACCCACAACCTCCACTGGGCTCTTTG
TTGAAGGAGAAAACATCCAAAATCCAGCGTCTAGAGGAGGACTGGCAAAGCCAGAAGGCCAAATTGCAAGCCCAGGTCTCACAGATGCAG
CAGGCTCTGGAGCAGTGCACCAGCAACTACAGGGAGGACCTGCAGGCACTCAAGCAGCTCTCGGACCTGGAGAGGGAGAAGCTGCAGCGT
GAGCTCCAGGAGACCACTCAGCAGAACCACGCCATGAAAGCCCAGCTCGAGGCTTCCCACCAGAGAGCCCTGCGCATGCTGGAGAAGGCC
AGACATCAGGAACTCAAGGCCACAGAGGAACGCTTGAAGAAGGAATCCAGCCACAGCCTCCAGATCCAACACCAGACACACCGACTGGAG
CTCCAGGCCTTGGAGGAAAAGGCCAGGCAAGAGCTGCAGGAGGAGCGTGAGAGGATGCAGGCACAGCAGGCCCTGCTGCTAGAGTCGCTC
AGACAGGAGCTGTCGGAGCAGCAAGCTGCCTGTTCTGGGCACCAGAAGGACTTGGAGGCACTGCAGGCCGAGCTGAGGGCTCTGGGCAGA
CAGCAAGCCAGCAGCCAGTGTCCAGGAGACAGCAAGGATCACATAATCGCCACAGAGGAGCGGGGCGGCCCGGGCCAGGCCGGCTCCCCA
CCGGGCGCTGCTGGGCAGGGTTCCGGCGAGGGATGCGGGCTCTGGGAGGAGAACGCGCAGCTCCAGGACGCGGTGCGGCGGCTGCGCGCG
GAGGTGGAGCAGCATCAGCAGGAGGCGCAGAAGCTCCGAGACCAGCGCAGGTTCCTGGAGGAGACTCAGCAAGCCCAGCGGGCCAGGGAG
GTGGAGACACTGCGCCAGGAACACCGGAAGGAGATGCAGGCCATGGTGGCAGATTTCAGTAGTGCCCAGGCCCAGCTCCAGGCCCGGCTG
GCTGCCCTGGAAGCCGAACTGAAAGATTCCGGAGAGAAGCCAGGGAAGGGAGCGTCCAGGCCCGAGGACCTTCAGCTCATTGGCCGCCTG
CAGACCCGCCTGAAGGAGAGAGAGGACATCATCAAGCAGCTCACGGAAGAGAGAAGATTTCACTACGCAGCATTCCCCAGTGCCATGTCC
CACCGGAATCGGTCTTTCTCTTTCAATCCTCACCCGGGATATTTGACCCCTTCCATGAAGAAAAAGAAGGTGGAGGACGTGCCCAGCCGC
GTGGTCAGCGTGCCGAACCTCGCCTCCTATGCAAAGAACTTTCTGAGTGGCGATCTGAGTTCCAGGATTAATGCCCCTCCAATAACTACA
TCACCCAGCTTGGACCCAAGCCCCAGCTGTGGCCGGACCTACAAACCCAACCAGTCTACAGATGCAAAAACTGCCACAAGGACCCCAGAT
GGTGAAACGGCCCAAGCCAAAGAAGTCCAGCAGAAACAGGGCTCTCCGCACCAGGAATGGTTCACCAAGTACTTTTCTTTCTAAGCTAAC
CTTTGGGATACATCACAGAGGATACTTGAAAAACATTTATTTTAAATCATCCGATTGAAGGAATGAACTAACACCAACCAACCAAATAAT
ATGCTTATGATTTATATATGATAGCTAAAACAAATTTTGGCGTTAACACTTCATACTGTTCTGCCAGGCACAGCAGCTCACGCCTGTAAT
CCCATCACTTTGGGAGGCTGAGGCAGATGGACTGCTTGAGTCCAGGAATTTGAGACCAGCCTGGCCAATATGGTGAAACCCCATCTCTAC
AAAATATACAAAAATTAGCCAGGCATGGTGGCGTGTGCCTGTGGTCCCAGGTACTTGGGGGACTGAGGCGGGAGGATCACTTGAACCTAG
GAGGCAGAGGTTGCAGTGAGCCAAGTTCGAACTCCTGCATTCCAACCAGCCTGGGTGACAGAGGGAGACCCTGTCTCCAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATTGACATTAAACCAGTGTTATTAAAAGTCATCTATAGGAAAATGTTATTAGCGTTACT
AATGACCCATACCTTGTATTTCTAGTGTCCATAACATCATACTCCATTTTGTGGAACATCAGACTTTGTGATTTCCATGATCTATTTCAA
AAGTGGTTGTACTTGTCCTTAGGATGCTAGTCAACTCCACTGGAAAGCTGTTTCTATGTAAAATGATGCAATTCCAAAATGCACATCTAA
CCTCAATAGGAAGACAAATAACAGTTAAACAGGAAAGCCAACTAAAAACAAACCAAACCTACCAGAAATGGATGGTAGCATGCTTGGACT
GAATACTTTCACTTCCTTGGTCTAAGACAAGCAGCAGATTATAGATGGGATAACACCCACCTCTAAAAGGGCTTTGCAAGGATTAAGCAA
GATAACATAAATTAACATGAATTGGAATTAAGTACCACAAGGTTTTTCTGTAAATAACCAATCCTAGCCCAGTTATAGGTCTCAGTGTAA
TGACCATAGTGCCAACATGATCACTTGTGAAGGTCTCTAGATTATCTGTTCTTTGAAGTCAAAGATCTTCTAGACTGGGCACATGGCTCA
TGCCTGTAATCCCAACACTTTGGGAGGCTGAGATGGGAGGAGAGCTTGAGGCCAGGAATTTGAGACCAGCCTGGGCAACACAGCGAGACC
TCCATCTCTACAAAAAAATAATTAGCCCAAAGAAAACCCAGCTACTTGGAAGTCTGAGGTAGGACAGCATGAGCCCAAGAGTTCGAGACC
AGCCTGGGCAAGATAGTGAGATCCCATCTCTACAGATTAAAAAAATATATATATATATCCCCTGAACCTCTGGTCTTTGGGTTTGAGCCA
TTTGCCTCATGGTGTGTTGCTTCTTCACTGCATGAATTCCCAGTGGGTTAAAGGAACCGCAATGGCTGTTCACGGTGCTGACCTTGCTCT
CAGTCCACACTGATTTGTCTTACCTTCTGACAGAGCAATGTGATTTGACAAGACTCAATAACAACTTTTAGGGGGCAAAATATTTTTTCA
GTCTTTGGTGCTGGCCCAGAAGGTGGCCCACAAACCAATGTTAATTCTATGCATTGTCAAATCTTTGCTCTTTGAATAAAACTTTGAATA
ACTGGGCAATAAAAATGGTTGACTTGTATTGATTTTCCACAGAAAGGTAAAATTAGATGAAGACAGCTTAGAAATAGAAAGTTCAGTTCA
CATTAACCTCAATCACACCATCTTAAAAAAAAAAAAGCTGATTACATATAACTGTCAAACTTACGTATTAAAGGTAAATTTACTGCCTAA
TCAAAACGAGGCTCCAATGCATTTTTAAATGCAAACAAACACTTGTCACCATACATTAACACACCATACTGTTTTTCACTACCAAATATT
TTTTGTGAGTTTCCCGCTTAGAGTGTCTTAGTTCGTTCAGGCTGCTCTAACAAAATATCTTACTTATACTGGATAATTTATAAACAATAG
AAATATGTCACTCACAGTCCTAGAGGCTAAGTCCAAGATCAAGGCACCAGCAGATATGGAGTCTGGGGAGGGCCCATTCTTCAGAAATGG
GTGCCTGCTACGTGTCCTTACATGGTGGAAGAGGCAAGAGCGCCTCCCTGAGCCTCTTTTGTAAGGGTACTTATCCTACTCATGAGGGTG
AAGCCCTCATGACTCCATTGCTTCCCAAAAGCCCCACCTCTTAATACTATTACATTGACATTAGGTTCCAACATATGAATTTTGGAAGGG
ACATCAACATTCAGGACATAGCAGTGAACCCTGTAGGACTGCTCTTTATTTTGTGCTTTCAAAAAGACTACATACAGGTGGTTCTATTTT
TGTGTGTTGAAACACTTTCCCAGGCTGCACTTTGCATTTCTGTCCTTAAACTCAGCATGATCCCTGGGCAAGGAGAAAATTTTACTAGTT
GAGATCGTACATAGGTTTTGACTCCTTTCTTGCTGCAGGTGACTGAAAAGATCTTTCAGTCTTAAATTTCTAAATTCTACCCTGCAATGA
TTATATCTTTGTTAACAAAATCTTTGCATGCTTCCATAATTTTTTATTGAGGCCATATGCCTTGGGTATTGAAGTAAGGCATTTAAGGAC
ACAAACTTAAGCTTTTTGTTTGTTATTACCAAACTGCCATTCAGAAAGTTTCTAACAATTTACACCCTTACCAGCAGTAAATGAACCTAC
TGTGCCCTAACACTATTGACAAAGAAATACAATTTGATAGATAAAACATTCTATTTTAGTTTGCATAATGATTCCATCAATCTCTCAACA
GCAGAGCGGTCTAGAGATGACAGTGATGGCGTAGAGGTGACAGTGAAGATGAAGAGAAATTATCCAATTCGGGATTAAGTTAAGAGAGAG
AAAAAAACAGTATTTAATGGTAAATCTCTTCAGGCTGTATTATGACAGGGGTGGAAGAGTTAATATGTTCCTGCAGCAAAACTGAAAGGA
ATACTATCTGTTCCACATGAAAGCAAACTGTTTTGTAATTGGGGTAGGTAAAAATGGATTCACCCAGTCAATGGCTGCACACCACATACC
TGAGCCCTTAACTGCTCTAACACTGATGTAATATCCAACCCAACATTTGTGATTGAGGCTACTTGGTTAATTTTTCTCCAGGATCCATCT


Top

FusionGenePPI for CXADR_FAM184B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CXADREWSR1, ELAVL1, LNX1, LNX2, ACOT1, GRHPR, VKORC1, NCOA1, NCOR1, AMICA1, CXADR, CCDC8, TMEM185A, TMEM17, TMEM216, CDH1, CTDSPL, CYP2S1FAM184BUBE2A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CXADR_FAM184B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CXADR_FAM184B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCXADRC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneFAM184BC0236969Substance-Related Disorders1CTD_human