FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 9038

FusionGeneSummary for CWC25_LASP1

check button Fusion gene summary
Fusion gene informationFusion gene name: CWC25_LASP1
Fusion gene ID: 9038
HgeneTgene
Gene symbol

CWC25

LASP1

Gene ID

54883

3927

Gene nameCWC25 spliceosome associated protein homologLIM and SH3 protein 1
SynonymsCCDC49Lasp-1|MLN50
Cytomap

17q12

17q12

Type of geneprotein-codingprotein-coding
Descriptionpre-mRNA-splicing factor CWC25 homologcoiled-coil domain-containing protein 49LIM and SH3 domain protein 1metastatic lymph node gene 50 protein
Modification date2018051920180522
UniProtAcc

Q9NXE8

Q14847

Ensembl transtripts involved in fusion geneENST00000225428, ENST00000536127, 
ENST00000318008, ENST00000433206, 
ENST00000435347, 
Fusion gene scores* DoF score11 X 6 X 6=39613 X 12 X 7=1092
# samples 1116
** MAII scorelog2(11/396*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(16/1092*10)=-2.77082904603249
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CWC25 [Title/Abstract] AND LASP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCOADTCGA-AA-A02K-01ACWC25chr17

36971114

-LASP1chr17

37074858

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000225428ENST00000318008CWC25chr17

36971114

-LASP1chr17

37074858

+
Frame-shitENST00000225428ENST00000433206CWC25chr17

36971114

-LASP1chr17

37074858

+
In-frameENST00000225428ENST00000435347CWC25chr17

36971114

-LASP1chr17

37074858

+
Frame-shitENST00000536127ENST00000318008CWC25chr17

36971114

-LASP1chr17

37074858

+
Frame-shitENST00000536127ENST00000433206CWC25chr17

36971114

-LASP1chr17

37074858

+
Frame-shitENST00000536127ENST00000435347CWC25chr17

36971114

-LASP1chr17

37074858

+

Top

FusionProtFeatures for CWC25_LASP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CWC25

Q9NXE8

LASP1

Q14847

Plays an important role in the regulation of dynamicactin-based, cytoskeletal activities. Agonist-dependent changes inLASP1 phosphorylation may also serve to regulate actin-associatedion transport activities, not only in the parietal cell but alsoin certain other F-actin-rich secretory epithelial cell types (Bysimilarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCWC25chr17:36971114chr17:37074858ENST00000225428-31020_70142426Coiled coilOntology_term=ECO:0000255
TgeneLASP1chr17:36971114chr17:37074858ENST00000318008+57201_204204262Compositional biasNote=Poly-Gly
TgeneLASP1chr17:36971114chr17:37074858ENST00000435347+58201_204204708Compositional biasNote=Poly-Gly
TgeneLASP1chr17:36971114chr17:37074858ENST00000318008+57202_261204262DomainSH3
TgeneLASP1chr17:36971114chr17:37074858ENST00000435347+58202_261204708DomainSH3

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCWC25chr17:36971114chr17:37074858ENST00000225428-310333_377142426Coiled coilOntology_term=ECO:0000255
HgeneCWC25chr17:36971114chr17:37074858ENST00000225428-310144_190142426Compositional biasNote=Lys-rich
TgeneLASP1chr17:36971114chr17:37074858ENST00000318008+575_56204262DomainLIM zinc-binding
TgeneLASP1chr17:36971114chr17:37074858ENST00000435347+585_56204708DomainLIM zinc-binding
TgeneLASP1chr17:36971114chr17:37074858ENST00000318008+5761_95204262RepeatNote=Nebulin 1
TgeneLASP1chr17:36971114chr17:37074858ENST00000318008+5797_131204262RepeatNote=Nebulin 2
TgeneLASP1chr17:36971114chr17:37074858ENST00000435347+5861_95204708RepeatNote=Nebulin 1
TgeneLASP1chr17:36971114chr17:37074858ENST00000435347+5897_131204708RepeatNote=Nebulin 2


Top

FusionGeneSequence for CWC25_LASP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CWC25_ENST00000225428_chr17_36971114_-_LASP1_ENST00000318008_chr17_37074858_+_200aa
MGGGDLNLKKSWHPQTLRNVEKVWKAEQKHEAERKKIEELQRELREERAREEMQRTAEDVGAVKKKEEKLDWMYQGPGGMVNRDEYLLGR
PIDKTVFEKMEEKEAGCSSETGLLPGSIFAPSGANSLLDMASKIREDPLFIIRSGTARCMTTAPPTRTRSPSRTGTPSSTCSRSTTAGCT

>In-frame_CWC25_ENST00000225428_chr17_36971114_-_LASP1_ENST00000435347_chr17_37074858_+_200aa
MGGGDLNLKKSWHPQTLRNVEKVWKAEQKHEAERKKIEELQRELREERAREEMQRTAEDVGAVKKKEEKLDWMYQGPGGMVNRDEYLLGR
PIDKTVFEKMEEKEAGCSSETGLLPGSIFAPSGANSLLDMASKIREDPLFIIRSGTARCMTTAPPTRTRSPSRTGTPSSTCSRSTTAGCT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CWC25_ENST00000225428_chr17_36971114_-_LASP1_ENST00000318008_chr17_37074858_+_602nt
ATGGGGGGCGGAGACCTGAATCTGAAGAAGAGCTGGCACCCGCAGACCCTCAGGAATGTGGAGAAAGTGTGGAAGGCCGAGCAGAAGCAT
GAGGCTGAGCGGAAGAAGATTGAGGAGCTTCAGCGGGAGCTGCGAGAAGAGAGAGCCCGGGAAGAGATGCAGCGCTATGCGGAGGATGTT
GGGGCCGTCAAGAAAAAAGAAGAAAAGTTGGACTGGATGTACCAGGGTCCTGGTGGGATGGTGAACCGTGACGAGTACCTGCTGGGGCGC
CCCATTGACAAATATGTTTTTGAGAAGATGGAGGAGAAGGAGGCAGGCTGCTCTTCTGAAACAGGACTTCTCCCAGGCTCTATCTTTGCC
CCATCAGGTGCCAATTCCCTTCTTGACATGGCCAGCAAGATCCGGGAGGACCCACTCTTCATCATCAGAAGCGGTACCGCGCGGTGTATG
ACTACAGCGCCGCCGACGAGGACGAGGTCTCCTTCCAGGACGGGGACACCATCGTCAACGTGCAGCAGATCGACGACGGCTGGATGTACG

>In-frame_CWC25_ENST00000225428_chr17_36971114_-_LASP1_ENST00000435347_chr17_37074858_+_602nt
ATGGGGGGCGGAGACCTGAATCTGAAGAAGAGCTGGCACCCGCAGACCCTCAGGAATGTGGAGAAAGTGTGGAAGGCCGAGCAGAAGCAT
GAGGCTGAGCGGAAGAAGATTGAGGAGCTTCAGCGGGAGCTGCGAGAAGAGAGAGCCCGGGAAGAGATGCAGCGCTATGCGGAGGATGTT
GGGGCCGTCAAGAAAAAAGAAGAAAAGTTGGACTGGATGTACCAGGGTCCTGGTGGGATGGTGAACCGTGACGAGTACCTGCTGGGGCGC
CCCATTGACAAATATGTTTTTGAGAAGATGGAGGAGAAGGAGGCAGGCTGCTCTTCTGAAACAGGACTTCTCCCAGGCTCTATCTTTGCC
CCATCAGGTGCCAATTCCCTTCTTGACATGGCCAGCAAGATCCGGGAGGACCCACTCTTCATCATCAGAAGCGGTACCGCGCGGTGTATG
ACTACAGCGCCGCCGACGAGGACGAGGTCTCCTTCCAGGACGGGGACACCATCGTCAACGTGCAGCAGATCGACGACGGCTGGATGTACG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CWC25_ENST00000225428_chr17_36971114_-_LASP1_ENST00000318008_chr17_37074858_+_3892nt
AGCCAAAATGAGACCTCGACAGCAAAGGCCTCGACAGCGGAGCCCGGACCTTTGCAAAATCTGCAAGTAACGCCAACGTCACAAAGCGCG
ACCGAGCCCTGTACGTCATCGTTCCGCGACGCCGACGCGGTGAGATGACGCCCTCCCGGAAGTGACCTCTAGAGCGGTGGTGAAACTGGC
AGTTGACGGCTCCTGGGACTAGATCCCGCGAGGTAGCCCCCGAACTATTTCTCTACGTTTTCTCTTGATCCTCCCGAAATCTTCCAGATC
CGCGTAGTGAGGAATCGTCTCCACCGTCATGGGGGGCGGAGACCTGAATCTGAAGAAGAGCTGGCACCCGCAGACCCTCAGGAATGTGGA
GAAAGTGTGGAAGGCCGAGCAGAAGCATGAGGCTGAGCGGAAGAAGATTGAGGAGCTTCAGCGGGAGCTGCGAGAAGAGAGAGCCCGGGA
AGAGATGCAGCGCTATGCGGAGGATGTTGGGGCCGTCAAGAAAAAAGAAGAAAAGTTGGACTGGATGTACCAGGGTCCTGGTGGGATGGT
GAACCGTGACGAGTACCTGCTGGGGCGCCCCATTGACAAATATGTTTTTGAGAAGATGGAGGAGAAGGAGGCAGGCTGCTCTTCTGAAAC
AGGACTTCTCCCAGGCTCTATCTTTGCCCCATCAGGTGCCAATTCCCTTCTTGACATGGCCAGCAAGATCCGGGAGGACCCACTCTTCAT
CATCAGAAGCGGTACCGCGCGGTGTATGACTACAGCGCCGCCGACGAGGACGAGGTCTCCTTCCAGGACGGGGACACCATCGTCAACGTG
CAGCAGATCGACGACGGCTGGATGTACGGGACGGTGGAGCGCACCGGCGACACGGGGATGCTGCCGGCCAACTACGTGGAGGCCATCTGA
ACCCGCAGCGCCCCCATCTGTCTTCAGCACATTCCACGGCATCGCATCCGTCCTGGGCGTGACCCGTCCATTCTTCAGTGTCTCTGTTTT
TTAAAACCTGCGACAGCTTGTGATTCCTACCCCTCTTCCAGCTTCTTTTGCCAACTGAAGCCTTCTTCTGCCACTTCTGCGGGCTCCCTC
CTCTGGCAGGCTTCCCCCTTGATCGACTTCTTGGTTTTCTCTCTGGATGGAACGGGCATGGGCCTCTCTGGGGGAGGCAGGGCTGGAATG
GGAGACCTGTTGGCCTGTGGGCCTCACCTGCCCCTCTGTTCTCTCCCCTCACATCCTCCTGCCCAGCTCCTCACATACCCACACATTCCA
GGGCTGGGGTGAGCCTGACTGCCAGGACCCCAGGTCAGGGGCTCCCTACATTCCCCAGAGTGGGATCCACTTCTTGGTTCCTGGGATGGC
GATGGGGACTCTGCCGCTGTGTAGGGACCAGTGGGATGGGCTCTACCTCTCTTTCTCAAAGAGGGGGCTCTGCCCACCTGGGGTCTCTCT
CCCTACCTCCCTCCTCAGGGGCAACAACAGGAGAATGGGGTTCCTGCTGTGGGGCGAATTCATCCCCTCCCCGCGCGTTCCTTCGCACAC
TGTGATTTTGCCCTCCTGCCCACGCAGACCTGCAGCGGGCAAAGAGCTCCCGAGGAAGCACAGCTTGGGTCAGGTTCTTGCCTTTCTTAA
TTTTAGGGACAGCTACCGGAAGGAGGGGAACAAGGAGTTCTCTTCCGCAGCCCCTTTCCCCACGCCCACCCCCAGTCTCCAGGGACCCTT
GCCTGCCTCCTAGGCTGGAAGCCATGGTCCCGAAGTGTAGGGCAAGGGTGCCTCAGGACCTTTTGGTCTTCAGCCTCCCTCAGCCCCCAG
GATCTGGGTTAGGTGGCCGCTCCTCCCTGCTCCTCATGGGAAGATGTCTCAGAGCCTTCCATGACCTCCCCTCCCCAGCCCAATGCCAAG
TGGACTTGGAGCTGCACAAAGTCAGCAGGGACCACTAAATCTCCAAGACCTGGTGTGCGGAGGCAGGAGCATGTATGTCTGCAGGTGTCT
GACACGCAAGTGTGTGAGTGTGAGTGTGAGAGATGGGGCGGGGGTGTGTCTGTAGGTGTCTCTGGGCCTGTGTGTGGGTGGGGTTATGTG
AGGGTATGAAGAGCTGTCTTCCCCTGAGAGTTTCCTCAGAACCCACAGTGAGAGGGGAGGGCTCCTGGGGCAGAGAAGTTCCTTAGGTTT
TCTTTGGAATGAAATTCCTCCTTCCCCCCATCTCTGAGTGGAGGAAGCCCACCAATCTGCCCTTTGCAGTGTGCAGGGTGGAAGGTAAGA
GGTTGGTGTGGAGTTGGGGCTGCCATAGGGTCTGCAGCCTGCTGGGGCTAAGCGGTGGAGGAAGGCTCTGTCACTCCAGGCATATGTTTC
CCCATCTCTGTCTGGGGCTACAGAATAGGGTGGCAGAAGTGTCACCCTGTGGGTGTCTCCCTCGGGGGCTCTTCCCCTAGACCTCCCCCT
CACTTACATAAAGCTCCCTTGAAGCAAGAAAGAGGGTCCCAGGGCTGCAAAACTGGAAGCACAGCCTCGGGGATGGGGAGGGAAAGACGG
TGCTATATCCAGTTCCTGCTCTCTGCTCATGGGTGGCTGTGACAACCCTGGCCTCACTTGATTCATCTCTGGTTTTCTTGCCACCCTCTG
GGAGTCCCCATCCCATTTTCATCCTGAGCCCAACCAGGCCCTGCCATTGGCCTCTTGTCCCTTGGCACACTTGTACCCACAGGTGAGGGG
CAGGACCTGAAGGTATTGGCCTGTTCAACAATCAGTCATCATGGGTGTTTTTGTCAACTGCTTGTTAATTGATTTGGGGATGTTTGCCCC
GAATGAGAGGTTGAGGAAAAGACTGTGGGTGGGGAGGCCCTGCCTGACCCATCCCTTTTCCTTTCTGGCCCCAGCCTAGGTGGAGGCAAG
TGGAATATCTTATATTGGGCGATTTGGGGGCTCGGGGAGGCAGAGAATCTCTTGGGAGTCTTGGGTGGCGCTGGTGCATTCTGTTTCCTC
TTGATCTCAAAGCACAATGTGGATTTGGGGACCAAAGGTCAGGGACACATCCCCTTAGAGGACCTGAGTTTGGGAGAGTGGTGAGTGGAA
GGGAGGAGCAGCAAGAAGCAGCCTGTTTTCACTCAGCTTAATTCTCCTTCCCAGATAAGGCAAGCCAGTCATGGAATCTTGCTGCAGGCC
CTCCCTCTACTCTTCCTGTCCTAAAAATAGGGGCCGTTTTCTTACACACCCCCAGAGAGAGGAGGGACTGTCACACTGGTGCTGAGTGAC
CGGGGGCTGCTGGGCGTCTGTTCTTTACCAAAACCATCCATCCCTAGAAGAGCACAGAGCCCTGAGGGGCTGGGCTGGGCTGGGCTGAGC
CCCTGGTCTTCTCTACAGTTCACAGAGGTCTTTCAGCTCATTTAATCCCAGGAAAGAGGCATCAAAGCTAGAATGTGAATATAACTTTTG
TGGACCAATACTAAGAATAACAAGAAGCCCAGTGGTGAGGAAAGTGCGTTCTCCCAGCACTGCCTCCTGTTTTCTCCCTCTCATGTCCCT
CCAGGGAAAATGACTTTATTGCTTAATTTCTGCCTTTCCCCCCTCACACATGCACTTTTGGGCCTTTTTTTATAGCTGGAAAAAACAAAA
TACCACCCTACAAACCTGTATTTAAAAAGAAACAGAAATGACCACGTGAAATTTGCCTCTGTCCAAACATTTCATCCGTGTGTATGTGTA
TGTGTGTGAGTGTGTGAAGCCGCCAGTTCATCTTTTTATATGGGGTTGTTGTCTCATTTTGGTCTGTTTTGGTCCCCTCCCTCGTGGGCT
TGTGCTCGGGATCAAACCTTTCTGGCCTGTTATGATTCTGAACATTTGACTTGAACCACAAGTGAATCTTTCTCCTGGTGACTCAAATAA

>In-frame_CWC25_ENST00000225428_chr17_36971114_-_LASP1_ENST00000435347_chr17_37074858_+_3559nt
AGCCAAAATGAGACCTCGACAGCAAAGGCCTCGACAGCGGAGCCCGGACCTTTGCAAAATCTGCAAGTAACGCCAACGTCACAAAGCGCG
ACCGAGCCCTGTACGTCATCGTTCCGCGACGCCGACGCGGTGAGATGACGCCCTCCCGGAAGTGACCTCTAGAGCGGTGGTGAAACTGGC
AGTTGACGGCTCCTGGGACTAGATCCCGCGAGGTAGCCCCCGAACTATTTCTCTACGTTTTCTCTTGATCCTCCCGAAATCTTCCAGATC
CGCGTAGTGAGGAATCGTCTCCACCGTCATGGGGGGCGGAGACCTGAATCTGAAGAAGAGCTGGCACCCGCAGACCCTCAGGAATGTGGA
GAAAGTGTGGAAGGCCGAGCAGAAGCATGAGGCTGAGCGGAAGAAGATTGAGGAGCTTCAGCGGGAGCTGCGAGAAGAGAGAGCCCGGGA
AGAGATGCAGCGCTATGCGGAGGATGTTGGGGCCGTCAAGAAAAAAGAAGAAAAGTTGGACTGGATGTACCAGGGTCCTGGTGGGATGGT
GAACCGTGACGAGTACCTGCTGGGGCGCCCCATTGACAAATATGTTTTTGAGAAGATGGAGGAGAAGGAGGCAGGCTGCTCTTCTGAAAC
AGGACTTCTCCCAGGCTCTATCTTTGCCCCATCAGGTGCCAATTCCCTTCTTGACATGGCCAGCAAGATCCGGGAGGACCCACTCTTCAT
CATCAGAAGCGGTACCGCGCGGTGTATGACTACAGCGCCGCCGACGAGGACGAGGTCTCCTTCCAGGACGGGGACACCATCGTCAACGTG
CAGCAGATCGACGACGGCTGGATGTACGGGACGGTGGAGCGCACCGGCGACACGGGGATGCTGCCGGCCAACTACGTGGAGGCCATCTGA
ACCCGCAGCGCCCCCATCTGTCTTCAGCACATTCCACGGCATCGCATCCGTCCTGGGCGTGACCCGTCCATTCTTCAGTGTCTCTGTTTT
TTAAAACCTGCGACAGCTTGTGATTCCTACCCCTCTTCCAGCTTCTTTTGCCAACTGAAGCCTTCTTCTGCCACTTCTGCGGGCTCCCTC
CTCTGGCAGGCTTCCCCCTTGATCGACTTCTTGGTTTTCTCTCTGGATGGAACGGGCATGGGCCTCTCTGGGGGAGGCAGGGCTGGAATG
GGAGACCTGTTGGCCTGTGGGCCTCACCTGCCCCTCTGTTCTCTCCCCTCACATCCTCCTGCCCAGCTCCTCACATACCCACACATTCCA
GGGCTGGGGTGAGCCTGACTGCCAGGACCCCAGGTCAGGGGCTCCCTACATTCCCCAGAGTGGGATCCACTTCTTGGTTCCTGGGATGGC
GATGGGGACTCTGCCGCTGTGTAGGGACCAGTGGGATGGGCTCTACCTCTCTTTCTCAAAGAGGGGGCTCTGCCCACCTGGGGTCTCTCT
CCCTACCTCCCTCCTCAGGGGCAACAACAGGAGAATGGGGTTCCTGCTGTGGGGCGAATTCATCCCCTCCCCGCGCGTTCCTTCGCACAC
TGTGATTTTGCCCTCCTGCCCACGCAGACCTGCAGCGGGCAAAGAGCTCCCGAGGAAGCACAGCTTGGGTCAGGTTCTTGCCTTTCTTAA
TTTTAGGGACAGCTACCGGAAGGAGGGGAACAAGGAGTTCTCTTCCGCAGCCCCTTTCCCCACGCCCACCCCCAGTCTCCAGGGACCCTT
GCCTGCCTCCTAGGCTGGAAGCCATGGTCCCGAAGTGTAGGGCAAGGGTGCCTCAGGACCTTTTGGTCTTCAGCCTCCCTCAGCCCCCAG
GATCTGGGTTAGGTGGCCGCTCCTCCCTGCTCCTCATGGGAAGATGTCTCAGAGCCTTCCATGACCTCCCCTCCCCAGCCCAATGCCAAG
TGGACTTGGAGCTGCACAAAGTCAGCAGGGACCACTAAATCTCCAAGACCTGGTGTGCGGAGGCAGGAGCATGTATGTCTGCAGGTGTCT
GACACGCAAGTGTGTGAGTGTGAGTGTGAGAGATGGGGCGGGGGTGTGTCTGTAGGTGTCTCTGGGCCTGTGTGTGGGTGGGGTTATGTG
AGGGTATGAAGAGCTGTCTTCCCCTGAGAGTTTCCTCACTTACATAAAGCTCCCTTGAAGCAAGAAAGAGGGTCCCAGGGCTGCAAAACT
GGAAGCACAGCCTCGGGGATGGGGAGGGAAAGACGGTGCTATATCCAGTTCCTGCTCTCTGCTCATGGGTGGCTGTGACAACCCTGGCCT
CACTTGATTCATCTCTGGTTTTCTTGCCACCCTCTGGGAGTCCCCATCCCATTTTCATCCTGAGCCCAACCAGGCCCTGCCATTGGCCTC
TTGTCCCTTGGCACACTTGTACCCACAGGTGAGGGGCAGGACCTGAAGGTATTGGCCTGTTCAACAATCAGTCATCATGGGTGTTTTTGT
CAACTGCTTGTTAATTGATTTGGGGATGTTTGCCCCGAATGAGAGGTTGAGGAAAAGACTGTGGGTGGGGAGGCCCTGCCTGACCCATCC
CTTTTCCTTTCTGGCCCCAGCCTAGGTGGAGGCAAGTGGAATATCTTATATTGGGCGATTTGGGGGCTCGGGGAGGCAGAGAATCTCTTG
GGAGTCTTGGGTGGCGCTGGTGCATTCTGTTTCCTCTTGATCTCAAAGCACAATGTGGATTTGGGGACCAAAGGTCAGGGACACATCCCC
TTAGAGGACCTGAGTTTGGGAGAGTGGTGAGTGGAAGGGAGGAGCAGCAAGAAGCAGCCTGTTTTCACTCAGCTTAATTCTCCTTCCCAG
ATAAGGCAAGCCAGTCATGGAATCTTGCTGCAGGCCCTCCCTCTACTCTTCCTGTCCTAAAAATAGGGGCCGTTTTCTTACACACCCCCA
GAGAGAGGAGGGACTGTCACACTGGTGCTGAGTGACCGGGGGCTGCTGGGCGTCTGTTCTTTACCAAAACCATCCATCCCTAGAAGAGCA
CAGAGCCCTGAGGGGCTGGGCTGGGCTGGGCTGAGCCCCTGGTCTTCTCTACAGTTCACAGAGGTCTTTCAGCTCATTTAATCCCAGGAA
AGAGGCATCAAAGCTAGAATGTGAATATAACTTTTGTGGACCAATACTAAGAATAACAAGAAGCCCAGTGGTGAGGAAAGTGCGTTCTCC
CAGCACTGCCTCCTGTTTTCTCCCTCTCATGTCCCTCCAGGGAAAATGACTTTATTGCTTAATTTCTGCCTTTCCCCCCTCACACATGCA
CTTTTGGGCCTTTTTTTATAGCTGGAAAAAACAAAATACCACCCTACAAACCTGTATTTAAAAAGAAACAGAAATGACCACGTGAAATTT
GCCTCTGTCCAAACATTTCATCCGTGTGTATGTGTATGTGTGTGAGTGTGTGAAGCCGCCAGTTCATCTTTTTATATGGGGTTGTTGTCT
CATTTTGGTCTGTTTTGGTCCCCTCCCTCGTGGGCTTGTGCTCGGGATCAAACCTTTCTGGCCTGTTATGATTCTGAACATTTGACTTGA


Top

FusionGenePPI for CWC25_LASP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CWC25CCDC85B, COPS6, LAMC3, MDM2, DVL2, KCTD3, KIF13B, CGN, ZBTB21, KSR1, GIGYF1, LPIN3, CBY1, INPP5ELASP1TRIP13, PLSCR1, FHL3, MDFI, ZYX, TERF1, TINF2, ACD, POT1, ATXN1, FN1, DAZAP2, CD81, GOLGA2, PSMA3, REL, TRIM27, TCF4, FXR2, SPRY2, ARHGEF15, ZC2HC1A, THAP1, SEPT3, LZTS2, RHOXF2, KRTAP4-2, ZBTB9, ZDHHC17, CCDC8, ILK, HAX1, DNAAF2, THAP8, FYTTD1, NFYA, OR10H3, RDH12, SLC25A32, SLC25A44, C11orf65, TAS2R41, AHNAK, ARFGAP1, DDB1, EIF4B, HSPB1, HSPE1, LGALS1, MAP4, NXF1, CRK, STAT3, SH2D2A, CEP170, FBF1, SCLT1, DCTN1, U2AF2, CDH1, ZNF764, SNRNP27, PGK1, EZR, SPTAN1, NCL, UHRF1, NAT10, PDIA5, API5, KRT18, KRT2, G3BP2, AP3M1, NCOR2, CDK12, MYO1C, ACTR3, CLTC, DNMT1, EHMT2, SNAI1, HIST1H3A, TRIM25, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CWC25_LASP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CWC25_LASP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneLASP1C0004352Autistic Disorder1CTD_human
TgeneLASP1C0036341Schizophrenia1PSYGENET