FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8965

FusionGeneSummary for CUBN_ALDH16A1

check button Fusion gene summary
Fusion gene informationFusion gene name: CUBN_ALDH16A1
Fusion gene ID: 8965
HgeneTgene
Gene symbol

CUBN

ALDH16A1

Gene ID

8029

126133

Gene namecubilinaldehyde dehydrogenase 16 family member A1
SynonymsIFCR|MGA1|gp280-
Cytomap

10p13

19q13.33

Type of geneprotein-codingprotein-coding
Descriptioncubilin460 kDa receptorcubilin (intrinsic factor-cobalamin receptor)cubilin precursor variant 1cubilin precursor variant 2cubilin precursor variant 3intestinal intrinsic factor receptorintrinsic factor-vitamin B12 receptoraldehyde dehydrogenase family 16 member A1
Modification date2018051920180519
UniProtAcc

O60494

Q8IZ83

Ensembl transtripts involved in fusion geneENST00000377833, ENST00000377823, 
ENST00000293350, ENST00000540132, 
ENST00000455361, ENST00000433981, 
ENST00000598015, 
Fusion gene scores* DoF score2 X 2 X 2=87 X 4 X 6=168
# samples 27
** MAII scorelog2(2/8*10)=1.32192809488736log2(7/168*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CUBN [Title/Abstract] AND ALDH16A1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSKCMTCGA-ER-A3EV-06ACUBNchr10

17024483

-ALDH16A1chr19

49961743

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000377833ENST00000293350CUBNchr10

17024483

-ALDH16A1chr19

49961743

+
5CDS-intronENST00000377833ENST00000540132CUBNchr10

17024483

-ALDH16A1chr19

49961743

+
5CDS-intronENST00000377833ENST00000455361CUBNchr10

17024483

-ALDH16A1chr19

49961743

+
5CDS-intronENST00000377833ENST00000433981CUBNchr10

17024483

-ALDH16A1chr19

49961743

+
5CDS-3UTRENST00000377833ENST00000598015CUBNchr10

17024483

-ALDH16A1chr19

49961743

+
intron-3CDSENST00000377823ENST00000293350CUBNchr10

17024483

-ALDH16A1chr19

49961743

+
intron-intronENST00000377823ENST00000540132CUBNchr10

17024483

-ALDH16A1chr19

49961743

+
intron-intronENST00000377823ENST00000455361CUBNchr10

17024483

-ALDH16A1chr19

49961743

+
intron-intronENST00000377823ENST00000433981CUBNchr10

17024483

-ALDH16A1chr19

49961743

+
intron-3UTRENST00000377823ENST00000598015CUBNchr10

17024483

-ALDH16A1chr19

49961743

+

Top

FusionProtFeatures for CUBN_ALDH16A1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CUBN

O60494

ALDH16A1

Q8IZ83

Cotransporter which plays a role in lipoprotein, vitaminand iron metabolism, by facilitating their uptake. Binds to ALB,MB, Kappa and lambda-light chains, TF, hemoglobin, GC, SCGB1A1,APOA1, high density lipoprotein, and the GIF-cobalamin complex.The binding of all ligands requires calcium. Serves as importanttransporter in several absorptive epithelia, including intestine,renal proximal tubules and embryonic yolk sac. Interaction withLRP2 mediates its trafficking throughout vesicles and facilitatesthe uptake of specific ligands like GC, hemoglobin, ALB, TF andSCGB1A1. Interaction with AMN controls its trafficking to theplasma membrane and facilitates endocytosis of ligands. May playan important role in the development of the peri-implantationembryo through internalization of APOA1 and cholesterol. Binds toLGALS3 at the maternal-fetal interface.{ECO:0000269|PubMed:10371504, ECO:0000269|PubMed:11606717,ECO:0000269|PubMed:11717447, ECO:0000269|PubMed:14576052,ECO:0000269|PubMed:9572993}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31671048_116115653624DomainCUB 6
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31671165_127715653624DomainCUB 7
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31671278_138915653624DomainCUB 8
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167132_16815653624DomainEGF-like 1
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31671391_150615653624DomainCUB 9
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167170_21115653624DomainEGF-like 2%3B calcium-binding
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167263_30415653624DomainEGF-like 3%3B calcium-binding
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167305_34815653624DomainEGF-like 4%3B calcium-binding
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167349_38515653624DomainEGF-like 5
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167395_43015653624DomainEGF-like 6
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167432_46815653624DomainEGF-like 7%3B calcium-binding
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167474_58615653624DomainCUB 1
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167590_70215653624DomainCUB 2
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167708_81615653624DomainCUB 3
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167816_92815653624DomainCUB 4
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-3167932_104215653624DomainCUB 5

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31671510_161915653624DomainCUB 10
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31671620_173415653624DomainCUB 11
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31671738_185015653624DomainCUB 12
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31671852_196315653624DomainCUB 13
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31671978_209115653624DomainCUB 14
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31672092_221315653624DomainCUB 15
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31672217_233415653624DomainCUB 16
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31672336_244815653624DomainCUB 17
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31672452_256515653624DomainCUB 18
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31672570_268715653624DomainCUB 19
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31672689_280115653624DomainCUB 20
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31672805_291915653624DomainCUB 21
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31672920_303515653624DomainCUB 22
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31673037_315015653624DomainCUB 23
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31673157_327415653624DomainCUB 24
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31673278_339315653624DomainCUB 25
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31673395_350715653624DomainCUB 26
HgeneCUBNchr10:17024483chr19:49961743ENST00000377833-31673511_362315653624DomainCUB 27


Top

FusionGeneSequence for CUBN_ALDH16A1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CUBN_ENST00000377833_chr10_17024483_-_ALDH16A1_ENST00000293350_chr19_49961743_+_2338aa
MMNMSLPFLWSLLTLLIFAEVNGEAGELELQRQKRSINLQQPRMATERGNLVFLTGSAQNIEFRTGSLGKIKLNDEDLSECLHQIQKNKE
DIIELKGSAIGLPQNISSQITQLNSKLVDLERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGT
PLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKTDDCEGGSVARCVHGICEDLMREQAGEPKYSCVCDAGWMFSPNSPACTLDRDECSFQ
PGPCSTLVQCFNTQGSFYCGACPTGWQGNGTICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGC
HPDASCSSTLGSLPLCTCLPGTTGNGTGPNGCVQLSNICLSHPCLNGQCIDTVSGTFCKCDSGWTGVNCTENINECLSNPCLNGGTCVDG
VDSFSCECTRLWTGALCQVPQQVCGESLSGINGSFSYRSPDVGTVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVTDGDSS
SAFQLGRFCGSSLPHELLSSDNALTFHLTSEHLRNGRGFTVRWETQQPECGGILTGPYGSIKSPGTPGNTPPGRDCVWIVVTSPDLLVTF
TFGTLSLEHHDDCNKDYLEIRDGPLTQDPLLGKFCTTFSVPPLQTTGPFARIHFHSDSQISDQGFHITYLTSPSDLRCGGNYTDPEGELF
LPELSGPFTHTRQCVTMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCGNGTISHIKSITNSVWIRFKIDASVEKASFR
AVTQVACGDELTGEGVIRSPFFPNVTPGERTCRWTIHQPQSQVILLNFTVFEIGSSAHCETDTVEIGSSSILGSPENKKTCGTDIPSFIT
SVYNFLTVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTWHILVQPNHLIHLMFETFHLEFHYNCTNDYL
EVTDTDSETSLGRYCGKSIPPSLTSSGNSLMLVFVTDSDLATEGFLINTEAISAATACLQDYTDDLGTFTSPNFPNNTPNNWECITRITV
RTGQLIAVHFTNFSLEEAIGNTTTDFLEIRDGGTEKSPLLGIFTGSNLPPTIISHSNKLWLKFKSDQIDTRSGFSAYWDGSSTGCGGNLT
TSSGTFISPNYPMPTYHSSECYWWLKSSHGSAFELEFKDFHLEHHPNCTLDYLAVTDGPSSNSHLLTQLCGDEKPPLIRSSGDSMFIKLR
TDEGQQGRGFKAEYRQTCENVVIVNQTTGILESIGTPNPTSENQHCNWTIRATTGNTVNYTFLAFDLEHHINCSTDTLELTDGPRQMGRY
CGVDLPPPGSTTSSKLQVLLLTDGVGRREKGFQMQWFVYGCGGELSGATGSFSSPGFPNRTPPNKECIWYIRTDPGSSIQLTIHDFDVET
HSRCNFDVLEITGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFNASWQAVTGGCGGIFQAPSGEIHSPNYPSPT
RSNTDCSWVIRVDRNHRVLLNFTDFDLEPQDSCIMAWLDTQDRCLGHTVNGKWLKPEHRNSVPCQDPITGENLASCLQAQAEDVAAAVEA
ARMAFKGWSAHPGVVRAQHLTRLAEVIQKHQRLLWTLESLVTGRAVREVRDGDVQLAQQLLHYHAIQASTQEEALAGWEPMGVIGLILPP
TFSFLEMMWRICPALAVGCTVVALVPPASPAPLLLAQLAGELGPFPGILNVLSGPASLVPILASQPGIRKVAFCGAPEEGRALRRSLAGE
CAELGLALGTESLLLLTDTADVDSAVEGVVDAAWSDRGPGGLRLLIQESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQR
FVREAQSQGAQVFQAGDVPSERPFTPPTLVSNLPPASPCAQVEVPWPVVVASPFRTAKEALLVANGTPRGGSASVWSERLGQALELGTGL
QVGTVWINAHGLRDPSVPTGGCKESGCSWHGGPDGLTETLRPSGTPARLSCLSKNLNTDTFGLAVPSTLPAGPEIGPSPAPPTGLFVGGR
FQAPGARSSRPIRDSSGNLHGYVAEGGAKDIRGAVEAAHQAFPGWAGQSPGARAALLWALAAALERRKSTLASRLERQGAELKAAEAEVE
LSARRLRAWGARVQAQGHTLQVAGLRGPVLRLREPLGVLAVVCPDEWPLLAFVSLLAPALAYGNTVVMVPSAACPLLALEVCQDMATVFP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CUBN_ENST00000377833_chr10_17024483_-_ALDH16A1_ENST00000293350_chr19_49961743_+_7014nt
ATGATGAACATGTCTTTACCTTTTCTTTGGAGTTTGCTTACCTTATTAATATTTGCTGAAGTAAATGGCGAAGCTGGAGAACTTGAGCTG
CAGAGACAAAAAAGAAGCATCAATCTCCAACAGCCTCGAATGGCTACAGAGAGAGGAAATTTGGTGTTTCTTACGGGGTCTGCTCAAAAC
ATTGAGTTTAGAACCGGATCCCTGGGAAAAATTAAATTAAATGATGAAGATCTCAGTGAGTGTTTACATCAGATCCAGAAAAACAAAGAA
GATATTATAGAGTTAAAAGGGAGTGCAATTGGTCTGCCTCAAAATATATCTAGTCAAATCTATCAGCTTAATTCCAAGCTGGTGGATCTT
GAGAGAAAATTCCAAGGCTTGCAGCAGACTGTTGACAAAAAGGTTTGCAGCAGCAATCCTTGCCAGAATGGTGGAACCTGCCTCAATCTG
CATGATTCCTTTTTTTGTATCTGTCCCCCACAGTGGAAGGGTCCTCTCTGCTCAGCTGATGTTAACGAATGTGAGATTTACTCAGGAACA
CCCTTGAGCTGCCAGAATGGAGGCACATGTGTTAATACAATGGGAAGTTACAGTTGTCACTGCCCACCTGAGACGTACGGACCCCAGTGT
GCATCCAAATATGACGACTGTGAAGGGGGTTCTGTGGCACGCTGTGTCCATGGCATCTGTGAGGATTTAATGCGAGAGCAAGCTGGAGAG
CCCAAGTACAGCTGCGTCTGTGATGCTGGGTGGATGTTTTCACCCAACAGCCCTGCCTGCACGCTGGACAGAGACGAGTGCAGCTTCCAG
CCCGGGCCTTGCTCCACACTTGTGCAGTGTTTCAACACTCAAGGCTCTTTCTACTGTGGGGCCTGTCCAACAGGCTGGCAAGGCAATGGA
TATATTTGCGAAGATATCAATGAATGTGAGATAAATAACGGCGGCTGTTCTGTGGCTCCACCCGTTGAGTGTGTGAATACACCTGGGTCT
TCCCACTGCCAGGCCTGTCCACCAGGGTACCAGGGTGACGGAAGAGTGTGCACACTCACAGACATCTGCTCAGTCAGTAATGGAGGCTGC
CACCCAGATGCCTCATGCTCCTCAACTCTAGGTTCCTTACCTCTCTGCACGTGTCTCCCGGGTTATACTGGAAATGGTTATGGGCCAAAT
GGATGTGTGCAGCTCAGTAATATTTGCCTAAGTCACCCCTGTCTAAATGGACAATGCATCGACACTGTCTCTGGTTATTTTTGTAAGTGT
GACTCAGGTTGGACAGGTGTCAACTGTACAGAAAACATCAATGAGTGTTTGAGCAACCCCTGTTTGAATGGAGGAACTTGTGTTGATGGC
GTTGATTCTTTCAGTTGTGAATGCACACGTCTCTGGACTGGAGCTCTCTGTCAGGTTCCTCAGCAAGTTTGTGGAGAGTCCCTCTCAGGA
ATAAATGGAAGCTTCAGCTACAGGAGCCCGGATGTTGGTTATGTTCATGATGTTAACTGCTTCTGGGTTATCAAAACTGAAATGGGAAAG
GTCCTGCGTATCACTTTCACTTTTTTCCGGTTAGAATCCATGGACAACTGTCCACACGAGTTTCTTCAGGTTTATGATGGAGATTCCTCT
TCTGCTTTTCAACTTGGAAGATTTTGTGGCTCCAGCCTCCCTCATGAACTCCTCAGCAGTGACAATGCTCTCTATTTTCATCTCTATTCT
GAACATTTAAGAAATGGGAGAGGCTTTACAGTAAGATGGGAAACACAGCAACCAGAGTGTGGAGGTATCCTGACTGGTCCTTACGGTTCT
ATTAAGTCTCCGGGGTATCCTGGAAACTATCCCCCAGGAAGAGATTGTGTCTGGATTGTTGTAACTAGTCCTGACCTCCTGGTAACATTT
ACTTTTGGGACCTTGAGCCTCGAGCACCATGATGACTGCAACAAAGATTACCTTGAGATTCGAGATGGTCCTTTGTATCAGGACCCCCTT
CTTGGGAAGTTCTGCACCACTTTCTCTGTCCCACCGCTCCAGACTACTGGCCCCTTTGCCAGAATTCACTTCCATTCAGACTCCCAGATT
AGTGACCAAGGCTTCCATATCACCTACTTAACATCACCTTCGGATCTGCGTTGTGGTGGGAACTACACGGACCCAGAGGGTGAACTCTTC
TTGCCTGAGTTGTCTGGGCCTTTCACTCACACCAGGCAATGCGTCTATATGATGAAGCAGCCCCAGGGAGAACAAATACAAATCAACTTC
ACCCACGTGGAGCTGCAATGCCAGAGTGACAGTTCTCAGAATTACATTGAGGTTCGAGATGGTGAAACCTTACTTGGAAAAGTCTGTGGC
AACGGAACCATCTCTCACATTAAATCCATTACTAATAGTGTCTGGATCAGGTTTAAAATAGATGCTTCTGTTGAAAAAGCTAGTTTCAGA
GCTGTTTATCAAGTCGCTTGCGGGGATGAATTAACTGGAGAAGGGGTCATTCGCTCGCCTTTTTTTCCTAACGTGTATCCTGGAGAAAGA
ACCTGTAGGTGGACCATCCACCAGCCCCAAAGCCAAGTCATTCTCCTCAACTTCACTGTCTTTGAAATTGGAAGTTCTGCCCACTGTGAA
ACAGATTATGTTGAGATTGGTAGCAGTTCCATTTTGGGTTCTCCTGAAAATAAAAAGTATTGCGGTACAGACATACCTTCATTTATAACA
TCTGTGTACAATTTTCTTTATGTCACATTCGTGAAAAGTTCTTCTACTGAAAACCATGGTTTCATGGCTAAGTTCAGTGCTGAGGATTTG
GCATGTGGAGAAATTCTTACAGAATCAACAGGGACCATTCAAAGTCCTGGCCATCCAAATGTCTACCCCCACGGTATCAACTGTACTTGG
CATATATTAGTCCAACCTAATCACCTGATTCATTTAATGTTCGAAACATTTCATCTGGAGTTTCATTACAATTGCACAAACGACTACTTG
GAAGTTTATGACACCGACTCTGAGACATCCCTTGGAAGATACTGTGGAAAGTCGATCCCGCCATCTCTCACAAGCAGTGGTAACTCATTG
ATGCTGGTGTTTGTGACTGACTCCGACCTCGCTTATGAAGGCTTCTTAATAAACTATGAAGCAATCAGTGCAGCAACAGCATGTTTGCAA
GACTACACAGATGATTTGGGGACATTCACTTCTCCAAACTTCCCCAATAATTATCCCAACAACTGGGAATGCATTTATCGGATCACAGTG
AGAACTGGCCAACTGATTGCAGTGCACTTCACAAACTTCTCCTTGGAGGAAGCCATTGGAAACTATTATACAGATTTTCTGGAAATCAGA
GATGGAGGCTATGAAAAATCACCATTGCTGGGAATATTCTATGGCTCAAATCTACCCCCAACAATCATCTCTCATAGTAACAAACTATGG
TTAAAATTTAAGAGTGACCAAATAGACACAAGGTCTGGATTCTCAGCTTACTGGGATGGGTCATCAACAGGTTGCGGGGGTAATCTCACC
ACTTCAAGCGGCACGTTCATATCTCCCAACTACCCGATGCCCTATTACCACAGCTCTGAATGCTACTGGTGGTTGAAATCTAGCCACGGC
AGCGCATTTGAACTGGAATTCAAAGACTTTCACTTGGAGCATCATCCAAACTGCACTTTAGATTACCTGGCTGTATATGATGGCCCAAGT
AGCAACTCTCATCTGCTAACTCAGCTTTGTGGGGATGAGAAACCCCCTCTTATTCGTTCTAGTGGAGACAGCATGTTTATAAAACTGAGG
ACAGATGAAGGTCAGCAAGGACGTGGCTTCAAGGCTGAATACCGGCAGACATGTGAGAATGTGGTAATAGTCAATCAAACCTATGGCATC
TTAGAGAGTATAGGGTATCCGAATCCTTATTCTGAAAATCAGCATTGCAACTGGACCATCCGGGCAACAACAGGCAACACTGTGAACTAC
ACATTTTTAGCATTTGACTTGGAACATCACATAAACTGCTCCACAGATTATTTAGAGCTCTATGATGGACCACGGCAGATGGGACGCTAC
TGTGGAGTAGACCTGCCCCCTCCAGGGAGTACTACAAGCTCCAAGCTTCAAGTGCTGCTCCTTACAGATGGGGTTGGCCGCCGTGAGAAA
GGATTTCAGATGCAGTGGTTTGTTTACGGTTGTGGTGGAGAGCTGTCTGGGGCCACAGGCTCCTTCAGCAGCCCCGGGTTCCCCAACAGG
TATCCACCAAACAAGGAGTGTATCTGGTACATTAGGACGGACCCCGGGAGTAGCATTCAGCTCACCATCCATGACTTCGATGTGGAGTAT
CATTCAAGGTGCAACTTTGATGTCTTGGAGATCTATGGAGGCCCCGATTTCCACTCTCCCAGAATAGCCCAACTGTGTACCCAGAGATCA
CCTGAGAACCCCATGCAGGTCTCCAGCACTGGAAATGAGCTAGCAATTCGATTCAAGACCGACTTGTCCATAAATGGGAGAGGCTTCAAT
GCGTCATGGCAAGCAGTCACTGGAGGTTGTGGTGGGATTTTCCAGGCTCCCAGTGGAGAGATTCATTCTCCAAATTACCCCAGTCCTTAT
AGGAGCAACACAGACTGTTCTTGGGTCATTCGGGTTGACAGAAATCATCGTGTTCTCTTGAACTTCACTGACTTTGATCTTGAACCACAA
GACTCTTGTATTATGGCCTGGCTGGACACCCAGGACCGGTGCTTGGGCCACTATGTGAATGGGAAGTGGTTAAAGCCTGAACACAGAAAT
TCAGTGCCTTGCCAGGATCCCATCACAGGAGAGAACTTGGCCAGTTGCCTGCAGGCACAGGCCGAGGATGTGGCTGCAGCCGTGGAGGCA
GCCAGGATGGCATTTAAGGGCTGGAGTGCGCACCCCGGCGTCGTCCGGGCCCAGCACCTGACCAGGCTGGCCGAGGTGATCCAGAAGCAC
CAGCGGCTGCTGTGGACCCTGGAATCCCTGGTGACTGGGCGGGCTGTTCGAGAGGTTCGAGACGGGGACGTCCAGCTGGCCCAGCAGCTG
CTCCACTACCATGCAATCCAGGCATCCACCCAGGAGGAGGCACTGGCAGGCTGGGAGCCCATGGGAGTAATTGGCCTCATCCTGCCACCC
ACATTCTCCTTCCTTGAGATGATGTGGAGGATTTGCCCTGCCCTGGCTGTGGGCTGCACCGTGGTGGCCCTCGTGCCCCCGGCCTCCCCG
GCGCCCCTCCTCCTGGCCCAGCTGGCGGGGGAGCTGGGCCCCTTCCCGGGAATCCTGAATGTCCTCAGTGGCCCTGCGTCCCTGGTGCCC
ATCCTGGCCTCCCAGCCTGGAATCCGGAAGGTGGCCTTCTGCGGAGCCCCGGAGGAAGGGCGTGCCCTTCGACGGAGCCTGGCGGGAGAG
TGTGCGGAGCTGGGCCTGGCGCTGGGGACGGAGTCGCTGCTGCTGCTGACGGACACGGCGGACGTAGACTCGGCCGTGGAGGGTGTCGTG
GACGCCGCCTGGTCCGACCGCGGCCCGGGTGGCCTCAGGCTCCTCATCCAGGAGTCTGTGTGGGATGAAGCCATGAGACGGCTGCAGGAG
CGGATGGGGCGGCTTCGGAGTGGCCGAGGGCTGGATGGGGCCGTGGACATGGGGGCCCGGGGGGCTGCCGCATGTGACCTGGTCCAGCGC
TTTGTGCGTGAGGCCCAGAGCCAGGGTGCACAGGTGTTCCAGGCTGGTGATGTGCCTTCGGAACGCCCATTCTATCCCCCAACCTTGGTC
TCCAACCTGCCCCCAGCCTCCCCATGTGCCCAGGTGGAGGTGCCGTGGCCTGTGGTCGTGGCCTCCCCCTTCCGCACAGCCAAGGAGGCA
CTGTTGGTGGCCAACGGGACGCCCCGCGGGGGCAGCGCCAGTGTGTGGAGCGAGAGGCTGGGGCAGGCGCTGGAGCTGGGCTATGGGCTC
CAGGTGGGCACTGTCTGGATCAACGCCCACGGCCTCAGAGACCCTTCGGTGCCCACAGGCGGCTGCAAGGAGAGTGGGTGTTCCTGGCAC
GGGGGCCCAGACGGGCTGTATGAGTATCTGCGGCCCTCAGGGACCCCTGCCCGGCTGTCCTGCCTCTCCAAGAACCTGAACTATGACACC
TTTGGCCTCGCTGTTCCCTCAACCCTGCCGGCTGGGCCTGAAATAGGGCCCAGCCCAGCACCCCCCTATGGGCTCTTCGTTGGGGGCCGT
TTCCAGGCTCCTGGGGCCCGAAGCTCCAGGCCCATCCGGGATTCGTCTGGCAACCTCCATGGCTACGTGGCTGAGGGTGGAGCCAAGGAC
ATCCGAGGTGCTGTGGAGGCCGCTCACCAGGCTTTCCCTGGCTGGGCGGGCCAGTCCCCAGGAGCCCGGGCAGCCCTGCTGTGGGCCCTG
GCGGCTGCACTGGAGCGCCGGAAGTCTACCCTGGCCTCGAGGCTGGAGAGGCAGGGAGCGGAGCTCAAGGCTGCGGAGGCGGAGGTGGAG
CTGAGCGCAAGACGACTTCGGGCGTGGGGGGCCCGGGTGCAGGCCCAAGGCCACACCCTGCAGGTAGCCGGGCTGAGAGGCCCTGTGCTG
CGCCTGCGGGAGCCGCTGGGTGTGCTGGCTGTGGTGTGTCCGGACGAGTGGCCCCTGCTTGCCTTCGTGTCCCTGCTGGCTCCCGCCCTG
GCCTACGGCAACACTGTGGTCATGGTGCCCAGTGCGGCCTGTCCTCTGCTGGCCCTGGAGGTCTGCCAGGACATGGCCACCGTGTTCCCA
GCAGGCCTGGCCAACGTGGTGACAGGAGACCGGGACCATCTGACCCGCTGCCTGGCCTTGCACCAAGACGTCCAGGCCATGTGGTATTTC
GGATCAGCCCAGGGTTCCCAGTTTGTCGAGTGGGCCTCGGCAGGAAACCTCAAACCGGTGTGGGCGAGCAGGGGCTGCCCGCGGGCCTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CUBN_ENST00000377833_chr10_17024483_-_ALDH16A1_ENST00000293350_chr19_49961743_+_7661nt
TTCTCCAAAATCCCATGCTCAGTTGGTTGGAGTGGCCTCACTCTTACCTGCCAACCTGGGAGGTTGATGATGAACATGTCTTTACCTTTT
CTTTGGAGTTTGCTTACCTTATTAATATTTGCTGAAGTAAATGGCGAAGCTGGAGAACTTGAGCTGCAGAGACAAAAAAGAAGCATCAAT
CTCCAACAGCCTCGAATGGCTACAGAGAGAGGAAATTTGGTGTTTCTTACGGGGTCTGCTCAAAACATTGAGTTTAGAACCGGATCCCTG
GGAAAAATTAAATTAAATGATGAAGATCTCAGTGAGTGTTTACATCAGATCCAGAAAAACAAAGAAGATATTATAGAGTTAAAAGGGAGT
GCAATTGGTCTGCCTCAAAATATATCTAGTCAAATCTATCAGCTTAATTCCAAGCTGGTGGATCTTGAGAGAAAATTCCAAGGCTTGCAG
CAGACTGTTGACAAAAAGGTTTGCAGCAGCAATCCTTGCCAGAATGGTGGAACCTGCCTCAATCTGCATGATTCCTTTTTTTGTATCTGT
CCCCCACAGTGGAAGGGTCCTCTCTGCTCAGCTGATGTTAACGAATGTGAGATTTACTCAGGAACACCCTTGAGCTGCCAGAATGGAGGC
ACATGTGTTAATACAATGGGAAGTTACAGTTGTCACTGCCCACCTGAGACGTACGGACCCCAGTGTGCATCCAAATATGACGACTGTGAA
GGGGGTTCTGTGGCACGCTGTGTCCATGGCATCTGTGAGGATTTAATGCGAGAGCAAGCTGGAGAGCCCAAGTACAGCTGCGTCTGTGAT
GCTGGGTGGATGTTTTCACCCAACAGCCCTGCCTGCACGCTGGACAGAGACGAGTGCAGCTTCCAGCCCGGGCCTTGCTCCACACTTGTG
CAGTGTTTCAACACTCAAGGCTCTTTCTACTGTGGGGCCTGTCCAACAGGCTGGCAAGGCAATGGATATATTTGCGAAGATATCAATGAA
TGTGAGATAAATAACGGCGGCTGTTCTGTGGCTCCACCCGTTGAGTGTGTGAATACACCTGGGTCTTCCCACTGCCAGGCCTGTCCACCA
GGGTACCAGGGTGACGGAAGAGTGTGCACACTCACAGACATCTGCTCAGTCAGTAATGGAGGCTGCCACCCAGATGCCTCATGCTCCTCA
ACTCTAGGTTCCTTACCTCTCTGCACGTGTCTCCCGGGTTATACTGGAAATGGTTATGGGCCAAATGGATGTGTGCAGCTCAGTAATATT
TGCCTAAGTCACCCCTGTCTAAATGGACAATGCATCGACACTGTCTCTGGTTATTTTTGTAAGTGTGACTCAGGTTGGACAGGTGTCAAC
TGTACAGAAAACATCAATGAGTGTTTGAGCAACCCCTGTTTGAATGGAGGAACTTGTGTTGATGGCGTTGATTCTTTCAGTTGTGAATGC
ACACGTCTCTGGACTGGAGCTCTCTGTCAGGTTCCTCAGCAAGTTTGTGGAGAGTCCCTCTCAGGAATAAATGGAAGCTTCAGCTACAGG
AGCCCGGATGTTGGTTATGTTCATGATGTTAACTGCTTCTGGGTTATCAAAACTGAAATGGGAAAGGTCCTGCGTATCACTTTCACTTTT
TTCCGGTTAGAATCCATGGACAACTGTCCACACGAGTTTCTTCAGGTTTATGATGGAGATTCCTCTTCTGCTTTTCAACTTGGAAGATTT
TGTGGCTCCAGCCTCCCTCATGAACTCCTCAGCAGTGACAATGCTCTCTATTTTCATCTCTATTCTGAACATTTAAGAAATGGGAGAGGC
TTTACAGTAAGATGGGAAACACAGCAACCAGAGTGTGGAGGTATCCTGACTGGTCCTTACGGTTCTATTAAGTCTCCGGGGTATCCTGGA
AACTATCCCCCAGGAAGAGATTGTGTCTGGATTGTTGTAACTAGTCCTGACCTCCTGGTAACATTTACTTTTGGGACCTTGAGCCTCGAG
CACCATGATGACTGCAACAAAGATTACCTTGAGATTCGAGATGGTCCTTTGTATCAGGACCCCCTTCTTGGGAAGTTCTGCACCACTTTC
TCTGTCCCACCGCTCCAGACTACTGGCCCCTTTGCCAGAATTCACTTCCATTCAGACTCCCAGATTAGTGACCAAGGCTTCCATATCACC
TACTTAACATCACCTTCGGATCTGCGTTGTGGTGGGAACTACACGGACCCAGAGGGTGAACTCTTCTTGCCTGAGTTGTCTGGGCCTTTC
ACTCACACCAGGCAATGCGTCTATATGATGAAGCAGCCCCAGGGAGAACAAATACAAATCAACTTCACCCACGTGGAGCTGCAATGCCAG
AGTGACAGTTCTCAGAATTACATTGAGGTTCGAGATGGTGAAACCTTACTTGGAAAAGTCTGTGGCAACGGAACCATCTCTCACATTAAA
TCCATTACTAATAGTGTCTGGATCAGGTTTAAAATAGATGCTTCTGTTGAAAAAGCTAGTTTCAGAGCTGTTTATCAAGTCGCTTGCGGG
GATGAATTAACTGGAGAAGGGGTCATTCGCTCGCCTTTTTTTCCTAACGTGTATCCTGGAGAAAGAACCTGTAGGTGGACCATCCACCAG
CCCCAAAGCCAAGTCATTCTCCTCAACTTCACTGTCTTTGAAATTGGAAGTTCTGCCCACTGTGAAACAGATTATGTTGAGATTGGTAGC
AGTTCCATTTTGGGTTCTCCTGAAAATAAAAAGTATTGCGGTACAGACATACCTTCATTTATAACATCTGTGTACAATTTTCTTTATGTC
ACATTCGTGAAAAGTTCTTCTACTGAAAACCATGGTTTCATGGCTAAGTTCAGTGCTGAGGATTTGGCATGTGGAGAAATTCTTACAGAA
TCAACAGGGACCATTCAAAGTCCTGGCCATCCAAATGTCTACCCCCACGGTATCAACTGTACTTGGCATATATTAGTCCAACCTAATCAC
CTGATTCATTTAATGTTCGAAACATTTCATCTGGAGTTTCATTACAATTGCACAAACGACTACTTGGAAGTTTATGACACCGACTCTGAG
ACATCCCTTGGAAGATACTGTGGAAAGTCGATCCCGCCATCTCTCACAAGCAGTGGTAACTCATTGATGCTGGTGTTTGTGACTGACTCC
GACCTCGCTTATGAAGGCTTCTTAATAAACTATGAAGCAATCAGTGCAGCAACAGCATGTTTGCAAGACTACACAGATGATTTGGGGACA
TTCACTTCTCCAAACTTCCCCAATAATTATCCCAACAACTGGGAATGCATTTATCGGATCACAGTGAGAACTGGCCAACTGATTGCAGTG
CACTTCACAAACTTCTCCTTGGAGGAAGCCATTGGAAACTATTATACAGATTTTCTGGAAATCAGAGATGGAGGCTATGAAAAATCACCA
TTGCTGGGAATATTCTATGGCTCAAATCTACCCCCAACAATCATCTCTCATAGTAACAAACTATGGTTAAAATTTAAGAGTGACCAAATA
GACACAAGGTCTGGATTCTCAGCTTACTGGGATGGGTCATCAACAGGTTGCGGGGGTAATCTCACCACTTCAAGCGGCACGTTCATATCT
CCCAACTACCCGATGCCCTATTACCACAGCTCTGAATGCTACTGGTGGTTGAAATCTAGCCACGGCAGCGCATTTGAACTGGAATTCAAA
GACTTTCACTTGGAGCATCATCCAAACTGCACTTTAGATTACCTGGCTGTATATGATGGCCCAAGTAGCAACTCTCATCTGCTAACTCAG
CTTTGTGGGGATGAGAAACCCCCTCTTATTCGTTCTAGTGGAGACAGCATGTTTATAAAACTGAGGACAGATGAAGGTCAGCAAGGACGT
GGCTTCAAGGCTGAATACCGGCAGACATGTGAGAATGTGGTAATAGTCAATCAAACCTATGGCATCTTAGAGAGTATAGGGTATCCGAAT
CCTTATTCTGAAAATCAGCATTGCAACTGGACCATCCGGGCAACAACAGGCAACACTGTGAACTACACATTTTTAGCATTTGACTTGGAA
CATCACATAAACTGCTCCACAGATTATTTAGAGCTCTATGATGGACCACGGCAGATGGGACGCTACTGTGGAGTAGACCTGCCCCCTCCA
GGGAGTACTACAAGCTCCAAGCTTCAAGTGCTGCTCCTTACAGATGGGGTTGGCCGCCGTGAGAAAGGATTTCAGATGCAGTGGTTTGTT
TACGGTTGTGGTGGAGAGCTGTCTGGGGCCACAGGCTCCTTCAGCAGCCCCGGGTTCCCCAACAGGTATCCACCAAACAAGGAGTGTATC
TGGTACATTAGGACGGACCCCGGGAGTAGCATTCAGCTCACCATCCATGACTTCGATGTGGAGTATCATTCAAGGTGCAACTTTGATGTC
TTGGAGATCTATGGAGGCCCCGATTTCCACTCTCCCAGAATAGCCCAACTGTGTACCCAGAGATCACCTGAGAACCCCATGCAGGTCTCC
AGCACTGGAAATGAGCTAGCAATTCGATTCAAGACCGACTTGTCCATAAATGGGAGAGGCTTCAATGCGTCATGGCAAGCAGTCACTGGA
GGTTGTGGTGGGATTTTCCAGGCTCCCAGTGGAGAGATTCATTCTCCAAATTACCCCAGTCCTTATAGGAGCAACACAGACTGTTCTTGG
GTCATTCGGGTTGACAGAAATCATCGTGTTCTCTTGAACTTCACTGACTTTGATCTTGAACCACAAGACTCTTGTATTATGGCCTGGCTG
GACACCCAGGACCGGTGCTTGGGCCACTATGTGAATGGGAAGTGGTTAAAGCCTGAACACAGAAATTCAGTGCCTTGCCAGGATCCCATC
ACAGGAGAGAACTTGGCCAGTTGCCTGCAGGCACAGGCCGAGGATGTGGCTGCAGCCGTGGAGGCAGCCAGGATGGCATTTAAGGGCTGG
AGTGCGCACCCCGGCGTCGTCCGGGCCCAGCACCTGACCAGGCTGGCCGAGGTGATCCAGAAGCACCAGCGGCTGCTGTGGACCCTGGAA
TCCCTGGTGACTGGGCGGGCTGTTCGAGAGGTTCGAGACGGGGACGTCCAGCTGGCCCAGCAGCTGCTCCACTACCATGCAATCCAGGCA
TCCACCCAGGAGGAGGCACTGGCAGGCTGGGAGCCCATGGGAGTAATTGGCCTCATCCTGCCACCCACATTCTCCTTCCTTGAGATGATG
TGGAGGATTTGCCCTGCCCTGGCTGTGGGCTGCACCGTGGTGGCCCTCGTGCCCCCGGCCTCCCCGGCGCCCCTCCTCCTGGCCCAGCTG
GCGGGGGAGCTGGGCCCCTTCCCGGGAATCCTGAATGTCCTCAGTGGCCCTGCGTCCCTGGTGCCCATCCTGGCCTCCCAGCCTGGAATC
CGGAAGGTGGCCTTCTGCGGAGCCCCGGAGGAAGGGCGTGCCCTTCGACGGAGCCTGGCGGGAGAGTGTGCGGAGCTGGGCCTGGCGCTG
GGGACGGAGTCGCTGCTGCTGCTGACGGACACGGCGGACGTAGACTCGGCCGTGGAGGGTGTCGTGGACGCCGCCTGGTCCGACCGCGGC
CCGGGTGGCCTCAGGCTCCTCATCCAGGAGTCTGTGTGGGATGAAGCCATGAGACGGCTGCAGGAGCGGATGGGGCGGCTTCGGAGTGGC
CGAGGGCTGGATGGGGCCGTGGACATGGGGGCCCGGGGGGCTGCCGCATGTGACCTGGTCCAGCGCTTTGTGCGTGAGGCCCAGAGCCAG
GGTGCACAGGTGTTCCAGGCTGGTGATGTGCCTTCGGAACGCCCATTCTATCCCCCAACCTTGGTCTCCAACCTGCCCCCAGCCTCCCCA
TGTGCCCAGGTGGAGGTGCCGTGGCCTGTGGTCGTGGCCTCCCCCTTCCGCACAGCCAAGGAGGCACTGTTGGTGGCCAACGGGACGCCC
CGCGGGGGCAGCGCCAGTGTGTGGAGCGAGAGGCTGGGGCAGGCGCTGGAGCTGGGCTATGGGCTCCAGGTGGGCACTGTCTGGATCAAC
GCCCACGGCCTCAGAGACCCTTCGGTGCCCACAGGCGGCTGCAAGGAGAGTGGGTGTTCCTGGCACGGGGGCCCAGACGGGCTGTATGAG
TATCTGCGGCCCTCAGGGACCCCTGCCCGGCTGTCCTGCCTCTCCAAGAACCTGAACTATGACACCTTTGGCCTCGCTGTTCCCTCAACC
CTGCCGGCTGGGCCTGAAATAGGGCCCAGCCCAGCACCCCCCTATGGGCTCTTCGTTGGGGGCCGTTTCCAGGCTCCTGGGGCCCGAAGC
TCCAGGCCCATCCGGGATTCGTCTGGCAACCTCCATGGCTACGTGGCTGAGGGTGGAGCCAAGGACATCCGAGGTGCTGTGGAGGCCGCT
CACCAGGCTTTCCCTGGCTGGGCGGGCCAGTCCCCAGGAGCCCGGGCAGCCCTGCTGTGGGCCCTGGCGGCTGCACTGGAGCGCCGGAAG
TCTACCCTGGCCTCGAGGCTGGAGAGGCAGGGAGCGGAGCTCAAGGCTGCGGAGGCGGAGGTGGAGCTGAGCGCAAGACGACTTCGGGCG
TGGGGGGCCCGGGTGCAGGCCCAAGGCCACACCCTGCAGGTAGCCGGGCTGAGAGGCCCTGTGCTGCGCCTGCGGGAGCCGCTGGGTGTG
CTGGCTGTGGTGTGTCCGGACGAGTGGCCCCTGCTTGCCTTCGTGTCCCTGCTGGCTCCCGCCCTGGCCTACGGCAACACTGTGGTCATG
GTGCCCAGTGCGGCCTGTCCTCTGCTGGCCCTGGAGGTCTGCCAGGACATGGCCACCGTGTTCCCAGCAGGCCTGGCCAACGTGGTGACA
GGAGACCGGGACCATCTGACCCGCTGCCTGGCCTTGCACCAAGACGTCCAGGCCATGTGGTATTTCGGATCAGCCCAGGGTTCCCAGTTT
GTCGAGTGGGCCTCGGCAGGAAACCTCAAACCGGTGTGGGCGAGCAGGGGCTGCCCGCGGGCCTGGGACCAGGAGGCCGAGGGGGCAGGC
CCAGAGCTGGGGCTGCGAGTGGCGCGGACCAAGGCCCTGTGGCTGCCTATGGGGGACTGATGCCTGAGCGCCACCTACTGCATTTTGGAC
ACCTCACACCAAGGGGAGATGCACCCCACAGACACCTGGGACTTTCCCCTTCTGGTTCCTGTGTCTCCCAATAAACTCTCTGACCAACCC
TAGCTGTGCTTCTGCGAGAAGAAAGGGTGTAGCAACTTCTGGCAGATATGAGGCTTTTTTCTTTTTTTTTTTTTTTTTTGAGACAACGTC
TGGCTCTGTCACCCAGGCTGGAGCGCAGTGGCACAATCTCGGCCCACTGCAGCCTCGACCTCTGGGGCTCAAGGGATCCTCATGCCTCAG
CCTCATATGTAGCTGGGGCCACAGACATGCACCACCACACCTGGCTCGAGGCCATTTTAGTTCTGAGGTTGAGCAGCTCAGGAGCCGGCT
CCAGCACGGTGCTGTGTTTGTGAAACAGAGAAAGGGGACCCCCGAGGACCCCAGACAGGGCCTTAGGACTCTCATATCTTCTTGTCTTCT
CCATCTGGTGGCTCTTGCTCTCTGGTTTTCTCTACCTTTTCATGGCCCCAGAATCCATATGCAGTAAAGGAACTCTCTGGAATAAAATTA


Top

FusionGenePPI for CUBN_ALDH16A1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CUBNGC, GIF, SCGB1A1, RRP1B, CUBN, CBL, LRP1, PID1, BRCA1ALDH16A1PAAF1, USP1, DERA, KHSRP, MEA1, PURB, MDM2, FAS, LANCL1, PCMT1, OLFM4, NTRK1, ATIC, PFKP, UGP2, UMPS, TLR1, ERP29, FAM117B, ADD2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CUBN_ALDH16A1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneCUBNO60494DB00200HydroxocobalaminCubilinsmall moleculeapproved

Top

RelatedDiseases for CUBN_ALDH16A1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCUBNC0025202melanoma1CTD_human
HgeneCUBNC0236733Amphetamine-Related Disorders1CTD_human
HgeneCUBNC1306856Megaloblastic anemia due to inborn errors of metabolism1CTD_human;ORPHANET;UNIPROT
TgeneALDH16A1C0018099Gout1CTD_human
TgeneALDH16A1C0268117Gout, HPRT-Related1CTD_human
TgeneALDH16A1C0740394Hyperuricemia1CTD_human