FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 889

FusionGeneSummary for ADIPOR1_RGS8

check button Fusion gene summary
Fusion gene informationFusion gene name: ADIPOR1_RGS8
Fusion gene ID: 889
HgeneTgene
Gene symbol

ADIPOR1

RGS8

Gene ID

51094

85397

Gene nameadiponectin receptor 1regulator of G protein signaling 8
SynonymsACDCR1|CGI-45|CGI45|PAQR1|TESBP1A-
Cytomap

1q32.1

1q25.3

Type of geneprotein-codingprotein-coding
Descriptionadiponectin receptor protein 1progestin and adipoQ receptor family member 1progestin and adipoQ receptor family member Iregulator of G-protein signaling 8regulator of G-protein signalling 8
Modification date2018052320180519
UniProtAcc

Q96A54

P57771

Ensembl transtripts involved in fusion geneENST00000340990, ENST00000436244, 
ENST00000367254, 
ENST00000483095, 
ENST00000258302, ENST00000367557, 
ENST00000367556, ENST00000491420, 
Fusion gene scores* DoF score3 X 3 X 2=181 X 1 X 1=1
# samples 31
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: ADIPOR1 [Title/Abstract] AND RGS8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneADIPOR1

GO:0009755

hormone-mediated signaling pathway

12802337

HgeneADIPOR1

GO:0019395

fatty acid oxidation

12802337

HgeneADIPOR1

GO:0033211

adiponectin-activated signaling pathway

12802337

TgeneRGS8

GO:0043547

positive regulation of GTPase activity

18434541


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E9-A243-01AADIPOR1chr1

202912886

-RGS8chr1

182617438

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000340990ENST00000483095ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
In-frameENST00000340990ENST00000258302ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
In-frameENST00000340990ENST00000367557ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
In-frameENST00000340990ENST00000367556ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
5CDS-intronENST00000340990ENST00000491420ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
Frame-shitENST00000436244ENST00000483095ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
Frame-shitENST00000436244ENST00000258302ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
Frame-shitENST00000436244ENST00000367557ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
Frame-shitENST00000436244ENST00000367556ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
5CDS-intronENST00000436244ENST00000491420ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
intron-3CDSENST00000367254ENST00000483095ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
intron-3CDSENST00000367254ENST00000258302ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
intron-3CDSENST00000367254ENST00000367557ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
intron-3CDSENST00000367254ENST00000367556ADIPOR1chr1

202912886

-RGS8chr1

182617438

-
intron-intronENST00000367254ENST00000491420ADIPOR1chr1

202912886

-RGS8chr1

182617438

-

Top

FusionProtFeatures for ADIPOR1_RGS8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ADIPOR1

Q96A54

RGS8

P57771

Receptor for ADIPOQ, an essential hormone secreted byadipocytes that regulates glucose and lipid metabolism(PubMed:25855295, PubMed:12802337). Required for normal glucoseand fat homeostasis and for maintaining a normal body weight.ADIPOQ-binding activates a signaling cascade that leads toincreased AMPK activity, and ultimately to increased fatty acidoxidation, increased glucose uptake and decreased gluconeogenesis.Has high affinity for globular adiponectin and low affinity forfull-length adiponectin (By similarity).{ECO:0000250|UniProtKB:Q91VH1, ECO:0000269|PubMed:12802337,ECO:0000269|PubMed:25855295}. Regulates G protein-coupled receptor signaling cascades,including signaling via muscarinic acetylcholine receptor CHRM2and dopamine receptor DRD2 (By similarity). Inhibits signaltransduction by increasing the GTPase activity of G protein alphasubunits, thereby driving them into their inactive GDP-bound form(PubMed:18434541). Modulates the activity of potassium channelsthat are activated in response to DRD2 and CHRM2 signaling (Bysimilarity). {ECO:0000250|UniProtKB:P49804,ECO:0000269|PubMed:18434541}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68158_170268376Topological domainExtracellular
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68192_203268376Topological domainCytoplasmic
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-681_136268376Topological domainCytoplasmic
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68225_234268376Topological domainExtracellular
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68256_264268376Topological domainCytoplasmic
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79158_170268376Topological domainExtracellular
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79192_203268376Topological domainCytoplasmic
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-791_136268376Topological domainCytoplasmic
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79225_234268376Topological domainExtracellular
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79256_264268376Topological domainCytoplasmic
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68137_157268376TransmembraneHelical%3B Name%3D1
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68171_191268376TransmembraneHelical%3B Name%3D2
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68204_224268376TransmembraneHelical%3B Name%3D3
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68235_255268376TransmembraneHelical%3B Name%3D4
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79137_157268376TransmembraneHelical%3B Name%3D1
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79171_191268376TransmembraneHelical%3B Name%3D2
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79204_224268376TransmembraneHelical%3B Name%3D3
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79235_255268376TransmembraneHelical%3B Name%3D4

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68286_298268376Topological domainExtracellular
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68320_337268376Topological domainCytoplasmic
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68359_375268376Topological domainExtracellular
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79286_298268376Topological domainExtracellular
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79320_337268376Topological domainCytoplasmic
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79359_375268376Topological domainExtracellular
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68265_285268376TransmembraneHelical%3B Name%3D5
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68299_319268376TransmembraneHelical%3B Name%3D6
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000340990-68338_358268376TransmembraneHelical%3B Name%3D7
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79265_285268376TransmembraneHelical%3B Name%3D5
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79299_319268376TransmembraneHelical%3B Name%3D6
HgeneADIPOR1chr1:202912886chr1:182617438ENST00000436244-79338_358268376TransmembraneHelical%3B Name%3D7
TgeneRGS8chr1:202912886chr1:182617438ENST00000258302-3656_17182199DomainRGS
TgeneRGS8chr1:202912886chr1:182617438ENST00000367556-3656_17164181DomainRGS
TgeneRGS8chr1:202912886chr1:182617438ENST00000367557-4756_17164181DomainRGS
TgeneRGS8chr1:202912886chr1:182617438ENST00000483095-4756_17164181DomainRGS


Top

FusionGeneSequence for ADIPOR1_RGS8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000483095_chr1_182617438_-_385aa
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEG
RWRVIPTDVLPDWLKDNDTLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVTCHSEKVSRTFSKLDTSGIALLIMGSFVPWLTTSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRADG
VAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEK

>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000258302_chr1_182617438_-_385aa
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEG
RWRVIPTDVLPDWLKDNDTLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVTCHSEKVSRTFSKLDTSGIALLIMGSFVPWLTTSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRADG
VAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEK

>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000367557_chr1_182617438_-_385aa
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEG
RWRVIPTDVLPDWLKDNDTLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVTCHSEKVSRTFSKLDTSGIALLIMGSFVPWLTTSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRADG
VAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEK

>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000367556_chr1_182617438_-_385aa
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEG
RWRVIPTDVLPDWLKDNDTLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
VLCLSFSWLFHTVTCHSEKVSRTFSKLDTSGIALLIMGSFVPWLTTSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRADG
VAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPREVNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000483095_chr1_182617438_-_1155nt
ATGTCTTCCCACAAAGGATCTGTGGTGGCACAGGGGAATGGGGCTCCTGCCAGTAACAGGGAAGCTGACACGGTGGAACTGGCTGAACTG
GGACCCCTGCTAGAAGAGAAGGGCAAACGGGTAATCGCCAACCCACCCAAAGCTGAAGAAGAGCAAACATGCCCAGTGCCCCAGGAAGAA
GAGGAGGAGGTGCGGGTACTGACACTTCCCCTGCAAGCCCACCACGCCATGGAGAAGATGGAAGAGTTTGTGTACAAGGTCTGGGAGGGA
CGTTGGAGGGTCATCCCATATGATGTGCTCCCTGACTGGCTAAAGGACAACGACTATCTGCTACATGGTCATAGACCTCCCATGCCCTCC
TTTCGGGCTTGCTTCAAGAGCATCTTCCGCATTCATACAGAAACTGGCAACATCTGGACCCATCTGCTTGGTTTCGTGCTGTTTCTCTTT
TTGGGAATCTTGACCATGCTCAGACCAAATATGTACTTCATGGCCCCTCTACAGGAGAAGGTGGTTTTTGGGATGTTCTTTTTGGGTGCA
GTGCTCTGCCTCAGCTTCTCCTGGCTCTTTCACACCGTCTATTGTCATTCAGAGAAAGTCTCTCGGACTTTTTCCAAACTGGACTATTCA
GGGATTGCTCTTCTAATTATGGGGAGCTTTGTCCCCTGGCTCTATTATTCCTTCTACTGCTCCCCACAGCCACGGCTCATCTACCTCTCC
ATCGTCTGTGTCCTGGGCATTTCTGCCATCATTGTGGCGCAGTGGGACCGGTTTGCCACTCCTAAGCACCGGCAGACAAGAGCAGATGGG
GTGGCTGCATTCCGTGCCTTCTTGAAGACGGAGTTCAGTGAGGAGAACCTGGAATTCTGGTTGGCCTGTGAGGAGTTCAAGAAGACCAGG
TCAACTGCAAAACTGGTCTCTAAGGCCCATAGGATCTTTGAGGAGTTTGTGGATGTGCAGGCTCCACGGGAGGTAAACATTGACTTCCAG
ACCCGAGAAGCCACGAGGAAGAACCTGCAGGAGCCATCCCTGACTTGCTTTGACCAAGCCCAAGGAAAAGTACACAGCCTCATGGAGAAA

>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000258302_chr1_182617438_-_1155nt
ATGTCTTCCCACAAAGGATCTGTGGTGGCACAGGGGAATGGGGCTCCTGCCAGTAACAGGGAAGCTGACACGGTGGAACTGGCTGAACTG
GGACCCCTGCTAGAAGAGAAGGGCAAACGGGTAATCGCCAACCCACCCAAAGCTGAAGAAGAGCAAACATGCCCAGTGCCCCAGGAAGAA
GAGGAGGAGGTGCGGGTACTGACACTTCCCCTGCAAGCCCACCACGCCATGGAGAAGATGGAAGAGTTTGTGTACAAGGTCTGGGAGGGA
CGTTGGAGGGTCATCCCATATGATGTGCTCCCTGACTGGCTAAAGGACAACGACTATCTGCTACATGGTCATAGACCTCCCATGCCCTCC
TTTCGGGCTTGCTTCAAGAGCATCTTCCGCATTCATACAGAAACTGGCAACATCTGGACCCATCTGCTTGGTTTCGTGCTGTTTCTCTTT
TTGGGAATCTTGACCATGCTCAGACCAAATATGTACTTCATGGCCCCTCTACAGGAGAAGGTGGTTTTTGGGATGTTCTTTTTGGGTGCA
GTGCTCTGCCTCAGCTTCTCCTGGCTCTTTCACACCGTCTATTGTCATTCAGAGAAAGTCTCTCGGACTTTTTCCAAACTGGACTATTCA
GGGATTGCTCTTCTAATTATGGGGAGCTTTGTCCCCTGGCTCTATTATTCCTTCTACTGCTCCCCACAGCCACGGCTCATCTACCTCTCC
ATCGTCTGTGTCCTGGGCATTTCTGCCATCATTGTGGCGCAGTGGGACCGGTTTGCCACTCCTAAGCACCGGCAGACAAGAGCAGATGGG
GTGGCTGCATTCCGTGCCTTCTTGAAGACGGAGTTCAGTGAGGAGAACCTGGAATTCTGGTTGGCCTGTGAGGAGTTCAAGAAGACCAGG
TCAACTGCAAAACTGGTCTCTAAGGCCCATAGGATCTTTGAGGAGTTTGTGGATGTGCAGGCTCCACGGGAGGTAAACATTGACTTCCAG
ACCCGAGAAGCCACGAGGAAGAACCTGCAGGAGCCATCCCTGACTTGCTTTGACCAAGCCCAAGGAAAAGTACACAGCCTCATGGAGAAA

>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000367557_chr1_182617438_-_1155nt
ATGTCTTCCCACAAAGGATCTGTGGTGGCACAGGGGAATGGGGCTCCTGCCAGTAACAGGGAAGCTGACACGGTGGAACTGGCTGAACTG
GGACCCCTGCTAGAAGAGAAGGGCAAACGGGTAATCGCCAACCCACCCAAAGCTGAAGAAGAGCAAACATGCCCAGTGCCCCAGGAAGAA
GAGGAGGAGGTGCGGGTACTGACACTTCCCCTGCAAGCCCACCACGCCATGGAGAAGATGGAAGAGTTTGTGTACAAGGTCTGGGAGGGA
CGTTGGAGGGTCATCCCATATGATGTGCTCCCTGACTGGCTAAAGGACAACGACTATCTGCTACATGGTCATAGACCTCCCATGCCCTCC
TTTCGGGCTTGCTTCAAGAGCATCTTCCGCATTCATACAGAAACTGGCAACATCTGGACCCATCTGCTTGGTTTCGTGCTGTTTCTCTTT
TTGGGAATCTTGACCATGCTCAGACCAAATATGTACTTCATGGCCCCTCTACAGGAGAAGGTGGTTTTTGGGATGTTCTTTTTGGGTGCA
GTGCTCTGCCTCAGCTTCTCCTGGCTCTTTCACACCGTCTATTGTCATTCAGAGAAAGTCTCTCGGACTTTTTCCAAACTGGACTATTCA
GGGATTGCTCTTCTAATTATGGGGAGCTTTGTCCCCTGGCTCTATTATTCCTTCTACTGCTCCCCACAGCCACGGCTCATCTACCTCTCC
ATCGTCTGTGTCCTGGGCATTTCTGCCATCATTGTGGCGCAGTGGGACCGGTTTGCCACTCCTAAGCACCGGCAGACAAGAGCAGATGGG
GTGGCTGCATTCCGTGCCTTCTTGAAGACGGAGTTCAGTGAGGAGAACCTGGAATTCTGGTTGGCCTGTGAGGAGTTCAAGAAGACCAGG
TCAACTGCAAAACTGGTCTCTAAGGCCCATAGGATCTTTGAGGAGTTTGTGGATGTGCAGGCTCCACGGGAGGTAAACATTGACTTCCAG
ACCCGAGAAGCCACGAGGAAGAACCTGCAGGAGCCATCCCTGACTTGCTTTGACCAAGCCCAAGGAAAAGTACACAGCCTCATGGAGAAA

>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000367556_chr1_182617438_-_1155nt
ATGTCTTCCCACAAAGGATCTGTGGTGGCACAGGGGAATGGGGCTCCTGCCAGTAACAGGGAAGCTGACACGGTGGAACTGGCTGAACTG
GGACCCCTGCTAGAAGAGAAGGGCAAACGGGTAATCGCCAACCCACCCAAAGCTGAAGAAGAGCAAACATGCCCAGTGCCCCAGGAAGAA
GAGGAGGAGGTGCGGGTACTGACACTTCCCCTGCAAGCCCACCACGCCATGGAGAAGATGGAAGAGTTTGTGTACAAGGTCTGGGAGGGA
CGTTGGAGGGTCATCCCATATGATGTGCTCCCTGACTGGCTAAAGGACAACGACTATCTGCTACATGGTCATAGACCTCCCATGCCCTCC
TTTCGGGCTTGCTTCAAGAGCATCTTCCGCATTCATACAGAAACTGGCAACATCTGGACCCATCTGCTTGGTTTCGTGCTGTTTCTCTTT
TTGGGAATCTTGACCATGCTCAGACCAAATATGTACTTCATGGCCCCTCTACAGGAGAAGGTGGTTTTTGGGATGTTCTTTTTGGGTGCA
GTGCTCTGCCTCAGCTTCTCCTGGCTCTTTCACACCGTCTATTGTCATTCAGAGAAAGTCTCTCGGACTTTTTCCAAACTGGACTATTCA
GGGATTGCTCTTCTAATTATGGGGAGCTTTGTCCCCTGGCTCTATTATTCCTTCTACTGCTCCCCACAGCCACGGCTCATCTACCTCTCC
ATCGTCTGTGTCCTGGGCATTTCTGCCATCATTGTGGCGCAGTGGGACCGGTTTGCCACTCCTAAGCACCGGCAGACAAGAGCAGATGGG
GTGGCTGCATTCCGTGCCTTCTTGAAGACGGAGTTCAGTGAGGAGAACCTGGAATTCTGGTTGGCCTGTGAGGAGTTCAAGAAGACCAGG
TCAACTGCAAAACTGGTCTCTAAGGCCCATAGGATCTTTGAGGAGTTTGTGGATGTGCAGGCTCCACGGGAGGTAAACATTGACTTCCAG
ACCCGAGAAGCCACGAGGAAGAACCTGCAGGAGCCATCCCTGACTTGCTTTGACCAAGCCCAAGGAAAAGTACACAGCCTCATGGAGAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000483095_chr1_182617438_-_2085nt
CTCCGCGAGAGGGCCTAGGATTGGAGGGCCCAGGCAGAGCCCGCGAGGAGGTGACGCGGCTGCGGAGGTGACGCGGGAGGTCGCGCGCCC
CTTCCGGCGCGGGGAGGGCGCTGAAGATCGGGGCCGCTCGGCCGCAGGCCGCCTCCAGCGCCGCGGGATGTAGCGCGGGGGACCGCGGCC
CCCAGCAGAGCCCGCCTGCCCGGCTTGTCTACCATCAGAGGGAGATCTCTGCCCCCTGGGGCTGAGAGACCCCAACCTTTCCCCAAGCTG
AAGCTGCAGGGTATTGAGGTACCAGCCAGATGTCTTCCCACAAAGGATCTGTGGTGGCACAGGGGAATGGGGCTCCTGCCAGTAACAGGG
AAGCTGACACGGTGGAACTGGCTGAACTGGGACCCCTGCTAGAAGAGAAGGGCAAACGGGTAATCGCCAACCCACCCAAAGCTGAAGAAG
AGCAAACATGCCCAGTGCCCCAGGAAGAAGAGGAGGAGGTGCGGGTACTGACACTTCCCCTGCAAGCCCACCACGCCATGGAGAAGATGG
AAGAGTTTGTGTACAAGGTCTGGGAGGGACGTTGGAGGGTCATCCCATATGATGTGCTCCCTGACTGGCTAAAGGACAACGACTATCTGC
TACATGGTCATAGACCTCCCATGCCCTCCTTTCGGGCTTGCTTCAAGAGCATCTTCCGCATTCATACAGAAACTGGCAACATCTGGACCC
ATCTGCTTGGTTTCGTGCTGTTTCTCTTTTTGGGAATCTTGACCATGCTCAGACCAAATATGTACTTCATGGCCCCTCTACAGGAGAAGG
TGGTTTTTGGGATGTTCTTTTTGGGTGCAGTGCTCTGCCTCAGCTTCTCCTGGCTCTTTCACACCGTCTATTGTCATTCAGAGAAAGTCT
CTCGGACTTTTTCCAAACTGGACTATTCAGGGATTGCTCTTCTAATTATGGGGAGCTTTGTCCCCTGGCTCTATTATTCCTTCTACTGCT
CCCCACAGCCACGGCTCATCTACCTCTCCATCGTCTGTGTCCTGGGCATTTCTGCCATCATTGTGGCGCAGTGGGACCGGTTTGCCACTC
CTAAGCACCGGCAGACAAGAGCAGATGGGGTGGCTGCATTCCGTGCCTTCTTGAAGACGGAGTTCAGTGAGGAGAACCTGGAATTCTGGT
TGGCCTGTGAGGAGTTCAAGAAGACCAGGTCAACTGCAAAACTGGTCTCTAAGGCCCATAGGATCTTTGAGGAGTTTGTGGATGTGCAGG
CTCCACGGGAGGTAAACATTGACTTCCAGACCCGAGAAGCCACGAGGAAGAACCTGCAGGAGCCATCCCTGACTTGCTTTGACCAAGCCC
AAGGAAAAGTACACAGCCTCATGGAGAAAGACTCTTACCCCAGGTTCCTGAGGTCCAAAATGTACTTAGATCTGCTGTCCCAAAGCCAGA
GGAGGCTCAGTTAGACCTCAGAAGGGAACTCCTGGAAATCACCGGCTTTCCCCTCCACTTGCTGCCAAGATCATATTCTAATGTGAAATG
TCATAGGTGTTCAAAAGCGGTGGCATTGGGGGTGGGAGGCTGGGGGTGAGGAGGGAATGAAGGGCCATTCCAAAGTATGACCCAGCTGCC
GGAGCTTGGACTCTATTCCATTTACCCATGTTTGTGTTTTGGTTAGTGGTAGCGCCTTGCCGCTGTCACCCTTTTCTGGGTCAGCAACTT
GCCCTTCATATAATGCCTTGGGTCACCTCTGCTGAGAGGGCAGATTTGCTGTGCTAGGCTAATCTGTAAATAATGCAAATGCAATTCCCA
CCACCTCCACACCCTCCTCGGTTAGGATTCCTGACTCTCCACTTGTTGTAAATCCCTGGGAGGAATAGCTGAAAGACTTGGGCTCAACTC
TGTGATTTGTAGTGGCCAGCTCTGCTCACTGGGATCTCACAGCTTAGGAGAGAGGTTTCTGTGGAATTCCAGGTTTCTAGTTCTGTCATT
GACAGGTGACCTCTCAGAGAAGGAGTGAAATCCATGGAGTTGTTTGTTTCTTCCATTTCCATTGGACCAGTGTGAAAAACTGTGATTACT

>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000258302_chr1_182617438_-_1532nt
CTCCGCGAGAGGGCCTAGGATTGGAGGGCCCAGGCAGAGCCCGCGAGGAGGTGACGCGGCTGCGGAGGTGACGCGGGAGGTCGCGCGCCC
CTTCCGGCGCGGGGAGGGCGCTGAAGATCGGGGCCGCTCGGCCGCAGGCCGCCTCCAGCGCCGCGGGATGTAGCGCGGGGGACCGCGGCC
CCCAGCAGAGCCCGCCTGCCCGGCTTGTCTACCATCAGAGGGAGATCTCTGCCCCCTGGGGCTGAGAGACCCCAACCTTTCCCCAAGCTG
AAGCTGCAGGGTATTGAGGTACCAGCCAGATGTCTTCCCACAAAGGATCTGTGGTGGCACAGGGGAATGGGGCTCCTGCCAGTAACAGGG
AAGCTGACACGGTGGAACTGGCTGAACTGGGACCCCTGCTAGAAGAGAAGGGCAAACGGGTAATCGCCAACCCACCCAAAGCTGAAGAAG
AGCAAACATGCCCAGTGCCCCAGGAAGAAGAGGAGGAGGTGCGGGTACTGACACTTCCCCTGCAAGCCCACCACGCCATGGAGAAGATGG
AAGAGTTTGTGTACAAGGTCTGGGAGGGACGTTGGAGGGTCATCCCATATGATGTGCTCCCTGACTGGCTAAAGGACAACGACTATCTGC
TACATGGTCATAGACCTCCCATGCCCTCCTTTCGGGCTTGCTTCAAGAGCATCTTCCGCATTCATACAGAAACTGGCAACATCTGGACCC
ATCTGCTTGGTTTCGTGCTGTTTCTCTTTTTGGGAATCTTGACCATGCTCAGACCAAATATGTACTTCATGGCCCCTCTACAGGAGAAGG
TGGTTTTTGGGATGTTCTTTTTGGGTGCAGTGCTCTGCCTCAGCTTCTCCTGGCTCTTTCACACCGTCTATTGTCATTCAGAGAAAGTCT
CTCGGACTTTTTCCAAACTGGACTATTCAGGGATTGCTCTTCTAATTATGGGGAGCTTTGTCCCCTGGCTCTATTATTCCTTCTACTGCT
CCCCACAGCCACGGCTCATCTACCTCTCCATCGTCTGTGTCCTGGGCATTTCTGCCATCATTGTGGCGCAGTGGGACCGGTTTGCCACTC
CTAAGCACCGGCAGACAAGAGCAGATGGGGTGGCTGCATTCCGTGCCTTCTTGAAGACGGAGTTCAGTGAGGAGAACCTGGAATTCTGGT
TGGCCTGTGAGGAGTTCAAGAAGACCAGGTCAACTGCAAAACTGGTCTCTAAGGCCCATAGGATCTTTGAGGAGTTTGTGGATGTGCAGG
CTCCACGGGAGGTAAACATTGACTTCCAGACCCGAGAAGCCACGAGGAAGAACCTGCAGGAGCCATCCCTGACTTGCTTTGACCAAGCCC
AAGGAAAAGTACACAGCCTCATGGAGAAAGACTCTTACCCCAGGTTCCTGAGGTCCAAAATGTACTTAGATCTGCTGTCCCAAAGCCAGA
GGAGGCTCAGTTAGACCTCAGAAGGGAACTCCTGGAAATCACCGGCTTTCCCCTCCACTTGCTGCCAAGATCATATTCTAATGTGAAATG

>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000367557_chr1_182617438_-_1503nt
CTCCGCGAGAGGGCCTAGGATTGGAGGGCCCAGGCAGAGCCCGCGAGGAGGTGACGCGGCTGCGGAGGTGACGCGGGAGGTCGCGCGCCC
CTTCCGGCGCGGGGAGGGCGCTGAAGATCGGGGCCGCTCGGCCGCAGGCCGCCTCCAGCGCCGCGGGATGTAGCGCGGGGGACCGCGGCC
CCCAGCAGAGCCCGCCTGCCCGGCTTGTCTACCATCAGAGGGAGATCTCTGCCCCCTGGGGCTGAGAGACCCCAACCTTTCCCCAAGCTG
AAGCTGCAGGGTATTGAGGTACCAGCCAGATGTCTTCCCACAAAGGATCTGTGGTGGCACAGGGGAATGGGGCTCCTGCCAGTAACAGGG
AAGCTGACACGGTGGAACTGGCTGAACTGGGACCCCTGCTAGAAGAGAAGGGCAAACGGGTAATCGCCAACCCACCCAAAGCTGAAGAAG
AGCAAACATGCCCAGTGCCCCAGGAAGAAGAGGAGGAGGTGCGGGTACTGACACTTCCCCTGCAAGCCCACCACGCCATGGAGAAGATGG
AAGAGTTTGTGTACAAGGTCTGGGAGGGACGTTGGAGGGTCATCCCATATGATGTGCTCCCTGACTGGCTAAAGGACAACGACTATCTGC
TACATGGTCATAGACCTCCCATGCCCTCCTTTCGGGCTTGCTTCAAGAGCATCTTCCGCATTCATACAGAAACTGGCAACATCTGGACCC
ATCTGCTTGGTTTCGTGCTGTTTCTCTTTTTGGGAATCTTGACCATGCTCAGACCAAATATGTACTTCATGGCCCCTCTACAGGAGAAGG
TGGTTTTTGGGATGTTCTTTTTGGGTGCAGTGCTCTGCCTCAGCTTCTCCTGGCTCTTTCACACCGTCTATTGTCATTCAGAGAAAGTCT
CTCGGACTTTTTCCAAACTGGACTATTCAGGGATTGCTCTTCTAATTATGGGGAGCTTTGTCCCCTGGCTCTATTATTCCTTCTACTGCT
CCCCACAGCCACGGCTCATCTACCTCTCCATCGTCTGTGTCCTGGGCATTTCTGCCATCATTGTGGCGCAGTGGGACCGGTTTGCCACTC
CTAAGCACCGGCAGACAAGAGCAGATGGGGTGGCTGCATTCCGTGCCTTCTTGAAGACGGAGTTCAGTGAGGAGAACCTGGAATTCTGGT
TGGCCTGTGAGGAGTTCAAGAAGACCAGGTCAACTGCAAAACTGGTCTCTAAGGCCCATAGGATCTTTGAGGAGTTTGTGGATGTGCAGG
CTCCACGGGAGGTAAACATTGACTTCCAGACCCGAGAAGCCACGAGGAAGAACCTGCAGGAGCCATCCCTGACTTGCTTTGACCAAGCCC
AAGGAAAAGTACACAGCCTCATGGAGAAAGACTCTTACCCCAGGTTCCTGAGGTCCAAAATGTACTTAGATCTGCTGTCCCAAAGCCAGA

>In-frame_ADIPOR1_ENST00000340990_chr1_202912886_-_RGS8_ENST00000367556_chr1_182617438_-_1454nt
CTCCGCGAGAGGGCCTAGGATTGGAGGGCCCAGGCAGAGCCCGCGAGGAGGTGACGCGGCTGCGGAGGTGACGCGGGAGGTCGCGCGCCC
CTTCCGGCGCGGGGAGGGCGCTGAAGATCGGGGCCGCTCGGCCGCAGGCCGCCTCCAGCGCCGCGGGATGTAGCGCGGGGGACCGCGGCC
CCCAGCAGAGCCCGCCTGCCCGGCTTGTCTACCATCAGAGGGAGATCTCTGCCCCCTGGGGCTGAGAGACCCCAACCTTTCCCCAAGCTG
AAGCTGCAGGGTATTGAGGTACCAGCCAGATGTCTTCCCACAAAGGATCTGTGGTGGCACAGGGGAATGGGGCTCCTGCCAGTAACAGGG
AAGCTGACACGGTGGAACTGGCTGAACTGGGACCCCTGCTAGAAGAGAAGGGCAAACGGGTAATCGCCAACCCACCCAAAGCTGAAGAAG
AGCAAACATGCCCAGTGCCCCAGGAAGAAGAGGAGGAGGTGCGGGTACTGACACTTCCCCTGCAAGCCCACCACGCCATGGAGAAGATGG
AAGAGTTTGTGTACAAGGTCTGGGAGGGACGTTGGAGGGTCATCCCATATGATGTGCTCCCTGACTGGCTAAAGGACAACGACTATCTGC
TACATGGTCATAGACCTCCCATGCCCTCCTTTCGGGCTTGCTTCAAGAGCATCTTCCGCATTCATACAGAAACTGGCAACATCTGGACCC
ATCTGCTTGGTTTCGTGCTGTTTCTCTTTTTGGGAATCTTGACCATGCTCAGACCAAATATGTACTTCATGGCCCCTCTACAGGAGAAGG
TGGTTTTTGGGATGTTCTTTTTGGGTGCAGTGCTCTGCCTCAGCTTCTCCTGGCTCTTTCACACCGTCTATTGTCATTCAGAGAAAGTCT
CTCGGACTTTTTCCAAACTGGACTATTCAGGGATTGCTCTTCTAATTATGGGGAGCTTTGTCCCCTGGCTCTATTATTCCTTCTACTGCT
CCCCACAGCCACGGCTCATCTACCTCTCCATCGTCTGTGTCCTGGGCATTTCTGCCATCATTGTGGCGCAGTGGGACCGGTTTGCCACTC
CTAAGCACCGGCAGACAAGAGCAGATGGGGTGGCTGCATTCCGTGCCTTCTTGAAGACGGAGTTCAGTGAGGAGAACCTGGAATTCTGGT
TGGCCTGTGAGGAGTTCAAGAAGACCAGGTCAACTGCAAAACTGGTCTCTAAGGCCCATAGGATCTTTGAGGAGTTTGTGGATGTGCAGG
CTCCACGGGAGGTAAACATTGACTTCCAGACCCGAGAAGCCACGAGGAAGAACCTGCAGGAGCCATCCCTGACTTGCTTTGACCAAGCCC
AAGGAAAAGTACACAGCCTCATGGAGAAAGACTCTTACCCCAGGTTCCTGAGGTCCAAAATGTACTTAGATCTGCTGTCCCAAAGCCAGA


Top

FusionGenePPI for ADIPOR1_RGS8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ADIPOR1ELAVL1, APPL1, MYC, NAA20, NFKBIL1, DPH3, MOV10, TMEM171, GNAI2, NT5E, STK11, TCTN2, TMEM17, FAM45A, SPPL2B, MRAP2, TACR1, SLC18A1, WFS1, TMEM231, GINM1, C16orf58, SLC22A16, TSPAN3, TRIM25RGS8ADRB2, GOLGA2, NXT2, UBR2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ADIPOR1_RGS8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ADIPOR1_RGS8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneADIPOR1C0021361Female infertility1CTD_human
HgeneADIPOR1C0022661Kidney Failure, Chronic1CTD_human