FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8748

FusionGeneSummary for CTDP1_NFATC1

check button Fusion gene summary
Fusion gene informationFusion gene name: CTDP1_NFATC1
Fusion gene ID: 8748
HgeneTgene
Gene symbol

CTDP1

NFATC1

Gene ID

9150

4772

Gene nameCTD phosphatase subunit 1nuclear factor of activated T cells 1
SynonymsCCFDN|FCP1NF-ATC|NF-ATc1.2|NFAT2|NFATc
Cytomap

18q23

18q23

Type of geneprotein-codingprotein-coding
DescriptionRNA polymerase II subunit A C-terminal domain phosphataseCTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1CTD of POLR2A, phosphatase of, subunit 1TFIIF-associating CTD phosphatase 1serine phosphatase FCP1atranscrinuclear factor of activated T-cells, cytoplasmic 1NFAT transcription complex cytosolic componentnuclear factor of activated T-cells 'c'nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
Modification date2018052320180527
UniProtAcc

Q9Y5B0

O95644

Ensembl transtripts involved in fusion geneENST00000299543, ENST00000075430, 
ENST00000587623, 
ENST00000253506, 
ENST00000591814, ENST00000397790, 
ENST00000587635, ENST00000427363, 
ENST00000542384, ENST00000318065, 
ENST00000545796, ENST00000592223, 
ENST00000329101, ENST00000586434, 
ENST00000590172, 
Fusion gene scores* DoF score3 X 4 X 3=366 X 6 X 5=180
# samples 38
** MAII scorelog2(3/36*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/180*10)=-1.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CTDP1 [Title/Abstract] AND NFATC1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCTDP1

GO:0006470

protein dephosphorylation

9765293|22692537

HgeneCTDP1

GO:0043923

positive regulation by host of viral transcription

15723517

TgeneNFATC1

GO:0033173

calcineurin-NFAT signaling cascade

14979875

TgeneNFATC1

GO:0035556

intracellular signal transduction

14749367

TgeneNFATC1

GO:0045893

positive regulation of transcription, DNA-templated

14749367|14979875

TgeneNFATC1

GO:0045944

positive regulation of transcription by RNA polymerase II

14979875

TgeneNFATC1

GO:1905064

negative regulation of vascular smooth muscle cell differentiation

23853098


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLAMLTCGA-AB-2811-03BCTDP1chr18

77478016

+NFATC1chr18

77227450

+
TCGARVSARCTCGA-X6-A7WA-01ACTDP1chr18

77475528

+NFATC1chr18

77287528

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000299543ENST00000253506CTDP1chr18

77478016

+NFATC1chr18

77227450

+
In-frameENST00000299543ENST00000591814CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000299543ENST00000397790CTDP1chr18

77478016

+NFATC1chr18

77227450

+
In-frameENST00000299543ENST00000587635CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000299543ENST00000427363CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000299543ENST00000542384CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000299543ENST00000318065CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000299543ENST00000545796CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000299543ENST00000592223CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000299543ENST00000329101CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000299543ENST00000586434CTDP1chr18

77478016

+NFATC1chr18

77227450

+
5CDS-intronENST00000299543ENST00000590172CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000075430ENST00000253506CTDP1chr18

77478016

+NFATC1chr18

77227450

+
In-frameENST00000075430ENST00000591814CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000075430ENST00000397790CTDP1chr18

77478016

+NFATC1chr18

77227450

+
In-frameENST00000075430ENST00000587635CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000075430ENST00000427363CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000075430ENST00000542384CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000075430ENST00000318065CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000075430ENST00000545796CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000075430ENST00000592223CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000075430ENST00000329101CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000075430ENST00000586434CTDP1chr18

77478016

+NFATC1chr18

77227450

+
5CDS-intronENST00000075430ENST00000590172CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000253506CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000591814CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000397790CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000587635CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000427363CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000542384CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000318065CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000545796CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000592223CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000329101CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-3CDSENST00000587623ENST00000586434CTDP1chr18

77478016

+NFATC1chr18

77227450

+
intron-intronENST00000587623ENST00000590172CTDP1chr18

77478016

+NFATC1chr18

77227450

+
Frame-shitENST00000299543ENST00000253506CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000299543ENST00000591814CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000299543ENST00000397790CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000299543ENST00000587635CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000299543ENST00000427363CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000299543ENST00000542384CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000299543ENST00000318065CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000299543ENST00000545796CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000299543ENST00000592223CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000299543ENST00000329101CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000299543ENST00000586434CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-3UTRENST00000299543ENST00000590172CTDP1chr18

77475528

+NFATC1chr18

77287528

+
Frame-shitENST00000075430ENST00000253506CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000075430ENST00000591814CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000075430ENST00000397790CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000075430ENST00000587635CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000075430ENST00000427363CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000075430ENST00000542384CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000075430ENST00000318065CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000075430ENST00000545796CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000075430ENST00000592223CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000075430ENST00000329101CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-intronENST00000075430ENST00000586434CTDP1chr18

77475528

+NFATC1chr18

77287528

+
5CDS-3UTRENST00000075430ENST00000590172CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-3CDSENST00000587623ENST00000253506CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-intronENST00000587623ENST00000591814CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-intronENST00000587623ENST00000397790CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-intronENST00000587623ENST00000587635CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-intronENST00000587623ENST00000427363CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-intronENST00000587623ENST00000542384CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-intronENST00000587623ENST00000318065CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-intronENST00000587623ENST00000545796CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-intronENST00000587623ENST00000592223CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-intronENST00000587623ENST00000329101CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-intronENST00000587623ENST00000586434CTDP1chr18

77475528

+NFATC1chr18

77287528

+
intron-3UTRENST00000587623ENST00000590172CTDP1chr18

77475528

+NFATC1chr18

77287528

+

Top

FusionProtFeatures for CTDP1_NFATC1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CTDP1

Q9Y5B0

NFATC1

O95644

Processively dephosphorylates 'Ser-2' and 'Ser-5' of theheptad repeats YSPTSPS in the C-terminal domain of the largest RNApolymerase II subunit. This promotes the activity of RNApolymerase II. Plays a role in the exit from mitosis bydephosphorylating crucial mitotic substrates (USP44, CDC20 andWEE1) that are required for M-phase-promoting factor (MPF)/CDK1inactivation. {ECO:0000269|PubMed:22692537}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CTDP1_NFATC1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CTDP1_ENST00000299543_chr18_77478016_+_NFATC1_ENST00000591814_chr18_77227450_+_869aa
MEVPAAGRVPAEGAPTAAVAEVRCPGPAPLRLLEWRVAAGAAVRIGSVLAVFEAAASAQSSGASQSRVASGGCVRPARPERRLRSERAGV
VRELCAQPGQVVAPGAVLVRLEGCSHPVVMKGLCAECGQDLTQLQSKNGKQQVPLSTATVSMVHSVPELMVSSEQAEQLGREDQQRLHRN
RKLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHR
ILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKTVYFQGTGDMNAPPGSRESQTRKKVNHSRGTEVSEPSPPVR
DPEGVTQAPGVEPSNGLEKPARELNGSEAATPRDSPRPGKPDERDIWPPAQAPTSSQELAGAPEPQGSCAQGGRVAPGQRPAQGATGTDL
DFDLSSDSESSSESEGTKSSSSASDGESEGKRGRQKPKAAPEGAGALAQGSSLEPGRPAAPSLPGEAEPGAHAPDKEPELGGQEEGERDG
LCGLGNGCADRKEAETESQNSELSGVTAGESLDQSMEEEEEEDTDEDDHLIYLEEILVRVHTDYTAKTDRYLNKEIEEAPDIRKIVPELK
SKVLADVAIIFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDK
VEEQLFPLRDDHTKAQRENSPAAFPDREGVPPTALFHPMPVLPKAQPGPEVRIYDSNTGKLIRTGARGPPAPSSSLPIRQEPSSFRILWW

>In-frame_CTDP1_ENST00000299543_chr18_77478016_+_NFATC1_ENST00000587635_chr18_77227450_+_821aa
MEVPAAGRVPAEGAPTAAVAEVRCPGPAPLRLLEWRVAAGAAVRIGSVLAVFEAAASAQSSGASQSRVASGGCVRPARPERRLRSERAGV
VRELCAQPGQVVAPGAVLVRLEGCSHPVVMKGLCAECGQDLTQLQSKNGKQQVPLSTATVSMVHSVPELMVSSEQAEQLGREDQQRLHRN
RKLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHR
ILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKTVYFQGTGDMNAPPGSRESQTRKKVNHSRGTEVSEPSPPVR
DPEGVTQAPGVEPSNGLEKPARELNGSEAATPRDSPRPGKPDERDIWPPAQAPTSSQELAGAPEPQGSCAQGGRVAPGQRPAQGATGTDL
DFDLSSDSESSSESEGTKSSSSASDGESEGKRGRQKPKAAPEGAGALAQGSSLEPGRPAAPSLPGEAEPGAHAPDKEPELGGQEEGERDG
LCGLGNGCADRKEAETESQNSELSGVTAGESLDQSMEEEEEEDTDEDDHLIYLEEILVRVHTDYTAKTDRYLNKEIEEAPDIRKIVPELK
SKVLADVAIIFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDK
VEEQLFPLRDDHTKAQRENSPAAFPDREGVPPTALFHPMPVLPKAQPGPEVRIYDSNTGKLIRTGARGPPAPSSSLPIRQEPSSFRILWW

>In-frame_CTDP1_ENST00000075430_chr18_77478016_+_NFATC1_ENST00000591814_chr18_77227450_+_869aa
MEVPAAGRVPAEGAPTAAVAEVRCPGPAPLRLLEWRVAAGAAVRIGSVLAVFEAAASAQSSGASQSRVASGGCVRPARPERRLRSERAGV
VRELCAQPGQVVAPGAVLVRLEGCSHPVVMKGLCAECGQDLTQLQSKNGKQQVPLSTATVSMVHSVPELMVSSEQAEQLGREDQQRLHRN
RKLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHR
ILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKTVYFQGTGDMNAPPGSRESQTRKKVNHSRGTEVSEPSPPVR
DPEGVTQAPGVEPSNGLEKPARELNGSEAATPRDSPRPGKPDERDIWPPAQAPTSSQELAGAPEPQGSCAQGGRVAPGQRPAQGATGTDL
DFDLSSDSESSSESEGTKSSSSASDGESEGKRGRQKPKAAPEGAGALAQGSSLEPGRPAAPSLPGEAEPGAHAPDKEPELGGQEEGERDG
LCGLGNGCADRKEAETESQNSELSGVTAGESLDQSMEEEEEEDTDEDDHLIYLEEILVRVHTDYTAKTDRYLNKEIEEAPDIRKIVPELK
SKVLADVAIIFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDK
VEEQLFPLRDDHTKAQRENSPAAFPDREGVPPTALFHPMPVLPKAQPGPEVRIYDSNTGKLIRTGARGPPAPSSSLPIRQEPSSFRILWW

>In-frame_CTDP1_ENST00000075430_chr18_77478016_+_NFATC1_ENST00000587635_chr18_77227450_+_821aa
MEVPAAGRVPAEGAPTAAVAEVRCPGPAPLRLLEWRVAAGAAVRIGSVLAVFEAAASAQSSGASQSRVASGGCVRPARPERRLRSERAGV
VRELCAQPGQVVAPGAVLVRLEGCSHPVVMKGLCAECGQDLTQLQSKNGKQQVPLSTATVSMVHSVPELMVSSEQAEQLGREDQQRLHRN
RKLVLMVDLDQTLIHTTEQHCQQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHR
ILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKTVYFQGTGDMNAPPGSRESQTRKKVNHSRGTEVSEPSPPVR
DPEGVTQAPGVEPSNGLEKPARELNGSEAATPRDSPRPGKPDERDIWPPAQAPTSSQELAGAPEPQGSCAQGGRVAPGQRPAQGATGTDL
DFDLSSDSESSSESEGTKSSSSASDGESEGKRGRQKPKAAPEGAGALAQGSSLEPGRPAAPSLPGEAEPGAHAPDKEPELGGQEEGERDG
LCGLGNGCADRKEAETESQNSELSGVTAGESLDQSMEEEEEEDTDEDDHLIYLEEILVRVHTDYTAKTDRYLNKEIEEAPDIRKIVPELK
SKVLADVAIIFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDK
VEEQLFPLRDDHTKAQRENSPAAFPDREGVPPTALFHPMPVLPKAQPGPEVRIYDSNTGKLIRTGARGPPAPSSSLPIRQEPSSFRILWW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CTDP1_ENST00000299543_chr18_77478016_+_NFATC1_ENST00000591814_chr18_77227450_+_2609nt
ATGGAGGTGCCGGCCGCGGGTCGCGTTCCTGCCGAGGGCGCCCCGACGGCGGCTGTGGCCGAGGTGCGCTGCCCGGGGCCCGCGCCGCTG
CGCCTGCTGGAGTGGAGGGTGGCGGCGGGCGCGGCCGTGCGCATCGGCTCGGTGCTGGCCGTGTTCGAGGCCGCCGCCTCCGCGCAGTCC
TCCGGGGCCTCTCAGTCCCGTGTAGCCTCCGGGGGCTGCGTGCGCCCCGCGCGGCCGGAACGCAGGCTGAGGTCGGAGCGCGCGGGCGTG
GTGCGGGAGCTGTGCGCGCAGCCGGGCCAGGTGGTCGCCCCAGGAGCGGTTCTGGTGAGGTTGGAAGGATGCAGCCACCCGGTTGTCATG
AAAGGCCTGTGTGCTGAATGTGGCCAAGACCTCACCCAGTTGCAGAGTAAGAACGGGAAGCAGCAGGTGCCGCTGTCCACGGCGACCGTG
TCCATGGTGCACAGCGTGCCGGAGTTGATGGTGAGCTCCGAGCAAGCTGAACAGCTGGGAAGAGAAGACCAGCAGCGACTGCACCGAAAC
CGGAAGCTGGTGCTCATGGTGGACTTGGACCAGACGTTGATTCACACAACCGAGCAGCACTGTCAGCAGATGTCGAATAAAGGCATCTTT
CACTTCCAGCTGGGCCGGGGTGAGCCCATGCTGCACACGCGCCTGCGTCCACACTGCAAGGACTTCCTGGAGAAGATCGCCAAGCTGTAC
GAGCTGCACGTCTTCACCTTCGGCAGCCGGCTGTACGCACACACCATCGCAGGCTTTTTAGACCCCGAGAAGAAGCTTTTTTCTCACCGA
ATATTATCAAGGGATGAATGTATTGACCCATTTTCTAAAACGGGAAACCTTAGAAATCTCTTTCCTTGTGGAGACTCAATGGTTTGCATT
ATTGATGATCGAGAAGATGTCTGGAAGTTTGCCCCCAATCTGATAACTGTGAAGAAATATGTATACTTCCAGGGCACGGGTGATATGAAT
GCGCCCCCTGGGTCCCGAGAATCTCAGACGAGAAAGAAAGTAAATCATTCTCGAGGCACTGAGGTCTCAGAGCCATCTCCGCCCGTGAGA
GACCCTGAGGGGGTAACGCAGGCCCCTGGAGTGGAGCCCAGCAATGGCCTGGAGAAGCCTGCACGGGAGCTGAACGGCAGCGAGGCCGCC
ACCCCGCGGGACTCACCCCGCCCCGGGAAGCCAGACGAGAGGGACATCTGGCCCCCTGCCCAGGCCCCCACCAGCAGCCAAGAGCTGGCA
GGCGCTCCTGAGCCCCAGGGATCCTGTGCGCAGGGTGGCCGGGTGGCACCGGGACAGCGGCCTGCCCAGGGTGCCACGGGCACTGACCTG
GACTTTGACTTATCCAGCGACAGCGAGAGCAGCAGTGAGTCCGAGGGCACGAAGTCCTCCTCCTCCGCCTCTGATGGCGAAAGCGAGGGG
AAAAGAGGCCGGCAGAAGCCGAAGGCTGCCCCAGAGGGAGCCGGGGCGCTGGCACAGGGCAGTTCCCTGGAGCCGGGGCGGCCTGCAGCA
CCGAGTCTCCCCGGAGAGGCCGAGCCTGGCGCGCATGCCCCGGACAAGGAGCCTGAGCTGGGTGGGCAGGAGGAGGGCGAGCGGGATGGC
CTCTGCGGCCTGGGCAACGGCTGTGCCGACAGGAAGGAGGCGGAGACCGAGTCACAGAACAGCGAGCTGTCGGGGGTCACTGCGGGTGAG
TCCCTGGACCAGAGCATGGAGGAGGAGGAGGAGGAGGACACGGATGAGGATGACCACCTCATCTACCTGGAGGAGATCCTGGTCCGTGTA
CACACTGACTACTATGCCAAGTATGACCGCTACCTCAACAAGGAGATCGAGGAGGCGCCGGACATCCGCAAGATCGTGCCGGAGCTCAAG
AGCAAGGTGCTGGCAGACGTGGCCATAATTTTCAGTGGGCTACACCCGACAAACTTCCCGATAGAGAAGACGCGGGAGCATTACCACGCC
ACGGCGCTGGGAGCGAAGATCCTCACTCGGCTGGTGCTGAGCCCCGACGCCCCTGACAGGGCCACGCACCTGATCGCCGCGCGAGCTGGC
ACAGAGAAGGTGCTGCAGGCACAGGAGTGCGGACACCTGCACGTGGTCAACCCTGACTGGCTGTGGAGCTGCCTGGAGCGCTGGGACAAG
GTGGAGGAGCAGCTCTTCCCGCTCAGGGACGATCACACCAAGGCACAGAGGGAGAACAGCCCTGCGGCCTTTCCCGACCGGGAGGGTGTG
CCCCCCACCGCCTTGTTCCACCCGATGCCGGTTCTTCCCAAGGCCCAGCCTGGCCCCGAGGTTCGGATCTACGACTCCAACACGGGGAAG
CTCATCAGGACGGGCGCCCGGGGGCCCCCAGCACCCTCCAGCTCCCTACCCATCCGCCAGGAGCCCTCTTCCTTCAGAATTCTCTGGTGG
TTGAGATCCCGCCATTTCGGAATCAGAGGATAACCAGCCCCGTTCACGTCAGTTTCTACGTCTGCAACGGGAAGAGAAAGCGAAGCCAGT

>In-frame_CTDP1_ENST00000299543_chr18_77478016_+_NFATC1_ENST00000587635_chr18_77227450_+_2463nt
ATGGAGGTGCCGGCCGCGGGTCGCGTTCCTGCCGAGGGCGCCCCGACGGCGGCTGTGGCCGAGGTGCGCTGCCCGGGGCCCGCGCCGCTG
CGCCTGCTGGAGTGGAGGGTGGCGGCGGGCGCGGCCGTGCGCATCGGCTCGGTGCTGGCCGTGTTCGAGGCCGCCGCCTCCGCGCAGTCC
TCCGGGGCCTCTCAGTCCCGTGTAGCCTCCGGGGGCTGCGTGCGCCCCGCGCGGCCGGAACGCAGGCTGAGGTCGGAGCGCGCGGGCGTG
GTGCGGGAGCTGTGCGCGCAGCCGGGCCAGGTGGTCGCCCCAGGAGCGGTTCTGGTGAGGTTGGAAGGATGCAGCCACCCGGTTGTCATG
AAAGGCCTGTGTGCTGAATGTGGCCAAGACCTCACCCAGTTGCAGAGTAAGAACGGGAAGCAGCAGGTGCCGCTGTCCACGGCGACCGTG
TCCATGGTGCACAGCGTGCCGGAGTTGATGGTGAGCTCCGAGCAAGCTGAACAGCTGGGAAGAGAAGACCAGCAGCGACTGCACCGAAAC
CGGAAGCTGGTGCTCATGGTGGACTTGGACCAGACGTTGATTCACACAACCGAGCAGCACTGTCAGCAGATGTCGAATAAAGGCATCTTT
CACTTCCAGCTGGGCCGGGGTGAGCCCATGCTGCACACGCGCCTGCGTCCACACTGCAAGGACTTCCTGGAGAAGATCGCCAAGCTGTAC
GAGCTGCACGTCTTCACCTTCGGCAGCCGGCTGTACGCACACACCATCGCAGGCTTTTTAGACCCCGAGAAGAAGCTTTTTTCTCACCGA
ATATTATCAAGGGATGAATGTATTGACCCATTTTCTAAAACGGGAAACCTTAGAAATCTCTTTCCTTGTGGAGACTCAATGGTTTGCATT
ATTGATGATCGAGAAGATGTCTGGAAGTTTGCCCCCAATCTGATAACTGTGAAGAAATATGTATACTTCCAGGGCACGGGTGATATGAAT
GCGCCCCCTGGGTCCCGAGAATCTCAGACGAGAAAGAAAGTAAATCATTCTCGAGGCACTGAGGTCTCAGAGCCATCTCCGCCCGTGAGA
GACCCTGAGGGGGTAACGCAGGCCCCTGGAGTGGAGCCCAGCAATGGCCTGGAGAAGCCTGCACGGGAGCTGAACGGCAGCGAGGCCGCC
ACCCCGCGGGACTCACCCCGCCCCGGGAAGCCAGACGAGAGGGACATCTGGCCCCCTGCCCAGGCCCCCACCAGCAGCCAAGAGCTGGCA
GGCGCTCCTGAGCCCCAGGGATCCTGTGCGCAGGGTGGCCGGGTGGCACCGGGACAGCGGCCTGCCCAGGGTGCCACGGGCACTGACCTG
GACTTTGACTTATCCAGCGACAGCGAGAGCAGCAGTGAGTCCGAGGGCACGAAGTCCTCCTCCTCCGCCTCTGATGGCGAAAGCGAGGGG
AAAAGAGGCCGGCAGAAGCCGAAGGCTGCCCCAGAGGGAGCCGGGGCGCTGGCACAGGGCAGTTCCCTGGAGCCGGGGCGGCCTGCAGCA
CCGAGTCTCCCCGGAGAGGCCGAGCCTGGCGCGCATGCCCCGGACAAGGAGCCTGAGCTGGGTGGGCAGGAGGAGGGCGAGCGGGATGGC
CTCTGCGGCCTGGGCAACGGCTGTGCCGACAGGAAGGAGGCGGAGACCGAGTCACAGAACAGCGAGCTGTCGGGGGTCACTGCGGGTGAG
TCCCTGGACCAGAGCATGGAGGAGGAGGAGGAGGAGGACACGGATGAGGATGACCACCTCATCTACCTGGAGGAGATCCTGGTCCGTGTA
CACACTGACTACTATGCCAAGTATGACCGCTACCTCAACAAGGAGATCGAGGAGGCGCCGGACATCCGCAAGATCGTGCCGGAGCTCAAG
AGCAAGGTGCTGGCAGACGTGGCCATAATTTTCAGTGGGCTACACCCGACAAACTTCCCGATAGAGAAGACGCGGGAGCATTACCACGCC
ACGGCGCTGGGAGCGAAGATCCTCACTCGGCTGGTGCTGAGCCCCGACGCCCCTGACAGGGCCACGCACCTGATCGCCGCGCGAGCTGGC
ACAGAGAAGGTGCTGCAGGCACAGGAGTGCGGACACCTGCACGTGGTCAACCCTGACTGGCTGTGGAGCTGCCTGGAGCGCTGGGACAAG
GTGGAGGAGCAGCTCTTCCCGCTCAGGGACGATCACACCAAGGCACAGAGGGAGAACAGCCCTGCGGCCTTTCCCGACCGGGAGGGTGTG
CCCCCCACCGCCTTGTTCCACCCGATGCCGGTTCTTCCCAAGGCCCAGCCTGGCCCCGAGGTTCGGATCTACGACTCCAACACGGGGAAG
CTCATCAGGACGGGCGCCCGGGGGCCCCCAGCACCCTCCAGCTCCCTACCCATCCGCCAGGAGCCCTCTTCCTTCAGAATTCTCTGGTGG

>In-frame_CTDP1_ENST00000075430_chr18_77478016_+_NFATC1_ENST00000591814_chr18_77227450_+_2609nt
ATGGAGGTGCCGGCCGCGGGTCGCGTTCCTGCCGAGGGCGCCCCGACGGCGGCTGTGGCCGAGGTGCGCTGCCCGGGGCCCGCGCCGCTG
CGCCTGCTGGAGTGGAGGGTGGCGGCGGGCGCGGCCGTGCGCATCGGCTCGGTGCTGGCCGTGTTCGAGGCCGCCGCCTCCGCGCAGTCC
TCCGGGGCCTCTCAGTCCCGTGTAGCCTCCGGGGGCTGCGTGCGCCCCGCGCGGCCGGAACGCAGGCTGAGGTCGGAGCGCGCGGGCGTG
GTGCGGGAGCTGTGCGCGCAGCCGGGCCAGGTGGTCGCCCCAGGAGCGGTTCTGGTGAGGTTGGAAGGATGCAGCCACCCGGTTGTCATG
AAAGGCCTGTGTGCTGAATGTGGCCAAGACCTCACCCAGTTGCAGAGTAAGAACGGGAAGCAGCAGGTGCCGCTGTCCACGGCGACCGTG
TCCATGGTGCACAGCGTGCCGGAGTTGATGGTGAGCTCCGAGCAAGCTGAACAGCTGGGAAGAGAAGACCAGCAGCGACTGCACCGAAAC
CGGAAGCTGGTGCTCATGGTGGACTTGGACCAGACGTTGATTCACACAACCGAGCAGCACTGTCAGCAGATGTCGAATAAAGGCATCTTT
CACTTCCAGCTGGGCCGGGGTGAGCCCATGCTGCACACGCGCCTGCGTCCACACTGCAAGGACTTCCTGGAGAAGATCGCCAAGCTGTAC
GAGCTGCACGTCTTCACCTTCGGCAGCCGGCTGTACGCACACACCATCGCAGGCTTTTTAGACCCCGAGAAGAAGCTTTTTTCTCACCGA
ATATTATCAAGGGATGAATGTATTGACCCATTTTCTAAAACGGGAAACCTTAGAAATCTCTTTCCTTGTGGAGACTCAATGGTTTGCATT
ATTGATGATCGAGAAGATGTCTGGAAGTTTGCCCCCAATCTGATAACTGTGAAGAAATATGTATACTTCCAGGGCACGGGTGATATGAAT
GCGCCCCCTGGGTCCCGAGAATCTCAGACGAGAAAGAAAGTAAATCATTCTCGAGGCACTGAGGTCTCAGAGCCATCTCCGCCCGTGAGA
GACCCTGAGGGGGTAACGCAGGCCCCTGGAGTGGAGCCCAGCAATGGCCTGGAGAAGCCTGCACGGGAGCTGAACGGCAGCGAGGCCGCC
ACCCCGCGGGACTCACCCCGCCCCGGGAAGCCAGACGAGAGGGACATCTGGCCCCCTGCCCAGGCCCCCACCAGCAGCCAAGAGCTGGCA
GGCGCTCCTGAGCCCCAGGGATCCTGTGCGCAGGGTGGCCGGGTGGCACCGGGACAGCGGCCTGCCCAGGGTGCCACGGGCACTGACCTG
GACTTTGACTTATCCAGCGACAGCGAGAGCAGCAGTGAGTCCGAGGGCACGAAGTCCTCCTCCTCCGCCTCTGATGGCGAAAGCGAGGGG
AAAAGAGGCCGGCAGAAGCCGAAGGCTGCCCCAGAGGGAGCCGGGGCGCTGGCACAGGGCAGTTCCCTGGAGCCGGGGCGGCCTGCAGCA
CCGAGTCTCCCCGGAGAGGCCGAGCCTGGCGCGCATGCCCCGGACAAGGAGCCTGAGCTGGGTGGGCAGGAGGAGGGCGAGCGGGATGGC
CTCTGCGGCCTGGGCAACGGCTGTGCCGACAGGAAGGAGGCGGAGACCGAGTCACAGAACAGCGAGCTGTCGGGGGTCACTGCGGGTGAG
TCCCTGGACCAGAGCATGGAGGAGGAGGAGGAGGAGGACACGGATGAGGATGACCACCTCATCTACCTGGAGGAGATCCTGGTCCGTGTA
CACACTGACTACTATGCCAAGTATGACCGCTACCTCAACAAGGAGATCGAGGAGGCGCCGGACATCCGCAAGATCGTGCCGGAGCTCAAG
AGCAAGGTGCTGGCAGACGTGGCCATAATTTTCAGTGGGCTACACCCGACAAACTTCCCGATAGAGAAGACGCGGGAGCATTACCACGCC
ACGGCGCTGGGAGCGAAGATCCTCACTCGGCTGGTGCTGAGCCCCGACGCCCCTGACAGGGCCACGCACCTGATCGCCGCGCGAGCTGGC
ACAGAGAAGGTGCTGCAGGCACAGGAGTGCGGACACCTGCACGTGGTCAACCCTGACTGGCTGTGGAGCTGCCTGGAGCGCTGGGACAAG
GTGGAGGAGCAGCTCTTCCCGCTCAGGGACGATCACACCAAGGCACAGAGGGAGAACAGCCCTGCGGCCTTTCCCGACCGGGAGGGTGTG
CCCCCCACCGCCTTGTTCCACCCGATGCCGGTTCTTCCCAAGGCCCAGCCTGGCCCCGAGGTTCGGATCTACGACTCCAACACGGGGAAG
CTCATCAGGACGGGCGCCCGGGGGCCCCCAGCACCCTCCAGCTCCCTACCCATCCGCCAGGAGCCCTCTTCCTTCAGAATTCTCTGGTGG
TTGAGATCCCGCCATTTCGGAATCAGAGGATAACCAGCCCCGTTCACGTCAGTTTCTACGTCTGCAACGGGAAGAGAAAGCGAAGCCAGT

>In-frame_CTDP1_ENST00000075430_chr18_77478016_+_NFATC1_ENST00000587635_chr18_77227450_+_2463nt
ATGGAGGTGCCGGCCGCGGGTCGCGTTCCTGCCGAGGGCGCCCCGACGGCGGCTGTGGCCGAGGTGCGCTGCCCGGGGCCCGCGCCGCTG
CGCCTGCTGGAGTGGAGGGTGGCGGCGGGCGCGGCCGTGCGCATCGGCTCGGTGCTGGCCGTGTTCGAGGCCGCCGCCTCCGCGCAGTCC
TCCGGGGCCTCTCAGTCCCGTGTAGCCTCCGGGGGCTGCGTGCGCCCCGCGCGGCCGGAACGCAGGCTGAGGTCGGAGCGCGCGGGCGTG
GTGCGGGAGCTGTGCGCGCAGCCGGGCCAGGTGGTCGCCCCAGGAGCGGTTCTGGTGAGGTTGGAAGGATGCAGCCACCCGGTTGTCATG
AAAGGCCTGTGTGCTGAATGTGGCCAAGACCTCACCCAGTTGCAGAGTAAGAACGGGAAGCAGCAGGTGCCGCTGTCCACGGCGACCGTG
TCCATGGTGCACAGCGTGCCGGAGTTGATGGTGAGCTCCGAGCAAGCTGAACAGCTGGGAAGAGAAGACCAGCAGCGACTGCACCGAAAC
CGGAAGCTGGTGCTCATGGTGGACTTGGACCAGACGTTGATTCACACAACCGAGCAGCACTGTCAGCAGATGTCGAATAAAGGCATCTTT
CACTTCCAGCTGGGCCGGGGTGAGCCCATGCTGCACACGCGCCTGCGTCCACACTGCAAGGACTTCCTGGAGAAGATCGCCAAGCTGTAC
GAGCTGCACGTCTTCACCTTCGGCAGCCGGCTGTACGCACACACCATCGCAGGCTTTTTAGACCCCGAGAAGAAGCTTTTTTCTCACCGA
ATATTATCAAGGGATGAATGTATTGACCCATTTTCTAAAACGGGAAACCTTAGAAATCTCTTTCCTTGTGGAGACTCAATGGTTTGCATT
ATTGATGATCGAGAAGATGTCTGGAAGTTTGCCCCCAATCTGATAACTGTGAAGAAATATGTATACTTCCAGGGCACGGGTGATATGAAT
GCGCCCCCTGGGTCCCGAGAATCTCAGACGAGAAAGAAAGTAAATCATTCTCGAGGCACTGAGGTCTCAGAGCCATCTCCGCCCGTGAGA
GACCCTGAGGGGGTAACGCAGGCCCCTGGAGTGGAGCCCAGCAATGGCCTGGAGAAGCCTGCACGGGAGCTGAACGGCAGCGAGGCCGCC
ACCCCGCGGGACTCACCCCGCCCCGGGAAGCCAGACGAGAGGGACATCTGGCCCCCTGCCCAGGCCCCCACCAGCAGCCAAGAGCTGGCA
GGCGCTCCTGAGCCCCAGGGATCCTGTGCGCAGGGTGGCCGGGTGGCACCGGGACAGCGGCCTGCCCAGGGTGCCACGGGCACTGACCTG
GACTTTGACTTATCCAGCGACAGCGAGAGCAGCAGTGAGTCCGAGGGCACGAAGTCCTCCTCCTCCGCCTCTGATGGCGAAAGCGAGGGG
AAAAGAGGCCGGCAGAAGCCGAAGGCTGCCCCAGAGGGAGCCGGGGCGCTGGCACAGGGCAGTTCCCTGGAGCCGGGGCGGCCTGCAGCA
CCGAGTCTCCCCGGAGAGGCCGAGCCTGGCGCGCATGCCCCGGACAAGGAGCCTGAGCTGGGTGGGCAGGAGGAGGGCGAGCGGGATGGC
CTCTGCGGCCTGGGCAACGGCTGTGCCGACAGGAAGGAGGCGGAGACCGAGTCACAGAACAGCGAGCTGTCGGGGGTCACTGCGGGTGAG
TCCCTGGACCAGAGCATGGAGGAGGAGGAGGAGGAGGACACGGATGAGGATGACCACCTCATCTACCTGGAGGAGATCCTGGTCCGTGTA
CACACTGACTACTATGCCAAGTATGACCGCTACCTCAACAAGGAGATCGAGGAGGCGCCGGACATCCGCAAGATCGTGCCGGAGCTCAAG
AGCAAGGTGCTGGCAGACGTGGCCATAATTTTCAGTGGGCTACACCCGACAAACTTCCCGATAGAGAAGACGCGGGAGCATTACCACGCC
ACGGCGCTGGGAGCGAAGATCCTCACTCGGCTGGTGCTGAGCCCCGACGCCCCTGACAGGGCCACGCACCTGATCGCCGCGCGAGCTGGC
ACAGAGAAGGTGCTGCAGGCACAGGAGTGCGGACACCTGCACGTGGTCAACCCTGACTGGCTGTGGAGCTGCCTGGAGCGCTGGGACAAG
GTGGAGGAGCAGCTCTTCCCGCTCAGGGACGATCACACCAAGGCACAGAGGGAGAACAGCCCTGCGGCCTTTCCCGACCGGGAGGGTGTG
CCCCCCACCGCCTTGTTCCACCCGATGCCGGTTCTTCCCAAGGCCCAGCCTGGCCCCGAGGTTCGGATCTACGACTCCAACACGGGGAAG
CTCATCAGGACGGGCGCCCGGGGGCCCCCAGCACCCTCCAGCTCCCTACCCATCCGCCAGGAGCCCTCTTCCTTCAGAATTCTCTGGTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CTDP1_ENST00000299543_chr18_77478016_+_NFATC1_ENST00000591814_chr18_77227450_+_3117nt
GGAAGTCGGCGCGGGCTAGGCGACGGGTGGAAGCCGGTACCGAGAGGAACTACAGCGTCGCCGCCTGGGTTGTGTCGCCGCGGTAGGCGC
TGCGCTCTGAGCGCAGCGCAGGCCCCGTACCGACCGCCCGCCCGCCCTCTGTCCGCGATGGAGGTGCCGGCCGCGGGTCGCGTTCCTGCC
GAGGGCGCCCCGACGGCGGCTGTGGCCGAGGTGCGCTGCCCGGGGCCCGCGCCGCTGCGCCTGCTGGAGTGGAGGGTGGCGGCGGGCGCG
GCCGTGCGCATCGGCTCGGTGCTGGCCGTGTTCGAGGCCGCCGCCTCCGCGCAGTCCTCCGGGGCCTCTCAGTCCCGTGTAGCCTCCGGG
GGCTGCGTGCGCCCCGCGCGGCCGGAACGCAGGCTGAGGTCGGAGCGCGCGGGCGTGGTGCGGGAGCTGTGCGCGCAGCCGGGCCAGGTG
GTCGCCCCAGGAGCGGTTCTGGTGAGGTTGGAAGGATGCAGCCACCCGGTTGTCATGAAAGGCCTGTGTGCTGAATGTGGCCAAGACCTC
ACCCAGTTGCAGAGTAAGAACGGGAAGCAGCAGGTGCCGCTGTCCACGGCGACCGTGTCCATGGTGCACAGCGTGCCGGAGTTGATGGTG
AGCTCCGAGCAAGCTGAACAGCTGGGAAGAGAAGACCAGCAGCGACTGCACCGAAACCGGAAGCTGGTGCTCATGGTGGACTTGGACCAG
ACGTTGATTCACACAACCGAGCAGCACTGTCAGCAGATGTCGAATAAAGGCATCTTTCACTTCCAGCTGGGCCGGGGTGAGCCCATGCTG
CACACGCGCCTGCGTCCACACTGCAAGGACTTCCTGGAGAAGATCGCCAAGCTGTACGAGCTGCACGTCTTCACCTTCGGCAGCCGGCTG
TACGCACACACCATCGCAGGCTTTTTAGACCCCGAGAAGAAGCTTTTTTCTCACCGAATATTATCAAGGGATGAATGTATTGACCCATTT
TCTAAAACGGGAAACCTTAGAAATCTCTTTCCTTGTGGAGACTCAATGGTTTGCATTATTGATGATCGAGAAGATGTCTGGAAGTTTGCC
CCCAATCTGATAACTGTGAAGAAATATGTATACTTCCAGGGCACGGGTGATATGAATGCGCCCCCTGGGTCCCGAGAATCTCAGACGAGA
AAGAAAGTAAATCATTCTCGAGGCACTGAGGTCTCAGAGCCATCTCCGCCCGTGAGAGACCCTGAGGGGGTAACGCAGGCCCCTGGAGTG
GAGCCCAGCAATGGCCTGGAGAAGCCTGCACGGGAGCTGAACGGCAGCGAGGCCGCCACCCCGCGGGACTCACCCCGCCCCGGGAAGCCA
GACGAGAGGGACATCTGGCCCCCTGCCCAGGCCCCCACCAGCAGCCAAGAGCTGGCAGGCGCTCCTGAGCCCCAGGGATCCTGTGCGCAG
GGTGGCCGGGTGGCACCGGGACAGCGGCCTGCCCAGGGTGCCACGGGCACTGACCTGGACTTTGACTTATCCAGCGACAGCGAGAGCAGC
AGTGAGTCCGAGGGCACGAAGTCCTCCTCCTCCGCCTCTGATGGCGAAAGCGAGGGGAAAAGAGGCCGGCAGAAGCCGAAGGCTGCCCCA
GAGGGAGCCGGGGCGCTGGCACAGGGCAGTTCCCTGGAGCCGGGGCGGCCTGCAGCACCGAGTCTCCCCGGAGAGGCCGAGCCTGGCGCG
CATGCCCCGGACAAGGAGCCTGAGCTGGGTGGGCAGGAGGAGGGCGAGCGGGATGGCCTCTGCGGCCTGGGCAACGGCTGTGCCGACAGG
AAGGAGGCGGAGACCGAGTCACAGAACAGCGAGCTGTCGGGGGTCACTGCGGGTGAGTCCCTGGACCAGAGCATGGAGGAGGAGGAGGAG
GAGGACACGGATGAGGATGACCACCTCATCTACCTGGAGGAGATCCTGGTCCGTGTACACACTGACTACTATGCCAAGTATGACCGCTAC
CTCAACAAGGAGATCGAGGAGGCGCCGGACATCCGCAAGATCGTGCCGGAGCTCAAGAGCAAGGTGCTGGCAGACGTGGCCATAATTTTC
AGTGGGCTACACCCGACAAACTTCCCGATAGAGAAGACGCGGGAGCATTACCACGCCACGGCGCTGGGAGCGAAGATCCTCACTCGGCTG
GTGCTGAGCCCCGACGCCCCTGACAGGGCCACGCACCTGATCGCCGCGCGAGCTGGCACAGAGAAGGTGCTGCAGGCACAGGAGTGCGGA
CACCTGCACGTGGTCAACCCTGACTGGCTGTGGAGCTGCCTGGAGCGCTGGGACAAGGTGGAGGAGCAGCTCTTCCCGCTCAGGGACGAT
CACACCAAGGCACAGAGGGAGAACAGCCCTGCGGCCTTTCCCGACCGGGAGGGTGTGCCCCCCACCGCCTTGTTCCACCCGATGCCGGTT
CTTCCCAAGGCCCAGCCTGGCCCCGAGGTTCGGATCTACGACTCCAACACGGGGAAGCTCATCAGGACGGGCGCCCGGGGGCCCCCAGCA
CCCTCCAGCTCCCTACCCATCCGCCAGGAGCCCTCTTCCTTCAGAATTCTCTGGTGGTTGAGATCCCGCCATTTCGGAATCAGAGGATAA
CCAGCCCCGTTCACGTCAGTTTCTACGTCTGCAACGGGAAGAGAAAGCGAAGCCAGTACCAGCGTTTCACCTACCTTCCCGCCAACGGTA
ACGCCATCTTTCTAACCGTAAGCCGTGAACATGAGCGCGTGGGGTGCTTTTTCTAAAGACGCAGAAACGACGTCGCCGTAAAGCAGCGTG
GCGTGTTGCACATTTAACTGTGTGATGTCCCGTTAGTGAGACCGAGCCATCGATGCCCTGAAAAGGAAAGGAAAAGGGAAGCTTCGGATG
CATTTTCCTTGATCCCTGTTGGGGGTGGGGGGCGGGGGTTGCATACTCAGATAGTCACGGTTATTTTGCTTCTTGCGAATGTATAACAGC
CAAGGGGAAAACATGGCTCTTCTGCTCCAAAAAACTGAGGGGGTCCTGGTGTGCATTTGCACCCTAAAGCTGCTTACGGTGAAAAGGCAA

>In-frame_CTDP1_ENST00000299543_chr18_77478016_+_NFATC1_ENST00000587635_chr18_77227450_+_2791nt
GGAAGTCGGCGCGGGCTAGGCGACGGGTGGAAGCCGGTACCGAGAGGAACTACAGCGTCGCCGCCTGGGTTGTGTCGCCGCGGTAGGCGC
TGCGCTCTGAGCGCAGCGCAGGCCCCGTACCGACCGCCCGCCCGCCCTCTGTCCGCGATGGAGGTGCCGGCCGCGGGTCGCGTTCCTGCC
GAGGGCGCCCCGACGGCGGCTGTGGCCGAGGTGCGCTGCCCGGGGCCCGCGCCGCTGCGCCTGCTGGAGTGGAGGGTGGCGGCGGGCGCG
GCCGTGCGCATCGGCTCGGTGCTGGCCGTGTTCGAGGCCGCCGCCTCCGCGCAGTCCTCCGGGGCCTCTCAGTCCCGTGTAGCCTCCGGG
GGCTGCGTGCGCCCCGCGCGGCCGGAACGCAGGCTGAGGTCGGAGCGCGCGGGCGTGGTGCGGGAGCTGTGCGCGCAGCCGGGCCAGGTG
GTCGCCCCAGGAGCGGTTCTGGTGAGGTTGGAAGGATGCAGCCACCCGGTTGTCATGAAAGGCCTGTGTGCTGAATGTGGCCAAGACCTC
ACCCAGTTGCAGAGTAAGAACGGGAAGCAGCAGGTGCCGCTGTCCACGGCGACCGTGTCCATGGTGCACAGCGTGCCGGAGTTGATGGTG
AGCTCCGAGCAAGCTGAACAGCTGGGAAGAGAAGACCAGCAGCGACTGCACCGAAACCGGAAGCTGGTGCTCATGGTGGACTTGGACCAG
ACGTTGATTCACACAACCGAGCAGCACTGTCAGCAGATGTCGAATAAAGGCATCTTTCACTTCCAGCTGGGCCGGGGTGAGCCCATGCTG
CACACGCGCCTGCGTCCACACTGCAAGGACTTCCTGGAGAAGATCGCCAAGCTGTACGAGCTGCACGTCTTCACCTTCGGCAGCCGGCTG
TACGCACACACCATCGCAGGCTTTTTAGACCCCGAGAAGAAGCTTTTTTCTCACCGAATATTATCAAGGGATGAATGTATTGACCCATTT
TCTAAAACGGGAAACCTTAGAAATCTCTTTCCTTGTGGAGACTCAATGGTTTGCATTATTGATGATCGAGAAGATGTCTGGAAGTTTGCC
CCCAATCTGATAACTGTGAAGAAATATGTATACTTCCAGGGCACGGGTGATATGAATGCGCCCCCTGGGTCCCGAGAATCTCAGACGAGA
AAGAAAGTAAATCATTCTCGAGGCACTGAGGTCTCAGAGCCATCTCCGCCCGTGAGAGACCCTGAGGGGGTAACGCAGGCCCCTGGAGTG
GAGCCCAGCAATGGCCTGGAGAAGCCTGCACGGGAGCTGAACGGCAGCGAGGCCGCCACCCCGCGGGACTCACCCCGCCCCGGGAAGCCA
GACGAGAGGGACATCTGGCCCCCTGCCCAGGCCCCCACCAGCAGCCAAGAGCTGGCAGGCGCTCCTGAGCCCCAGGGATCCTGTGCGCAG
GGTGGCCGGGTGGCACCGGGACAGCGGCCTGCCCAGGGTGCCACGGGCACTGACCTGGACTTTGACTTATCCAGCGACAGCGAGAGCAGC
AGTGAGTCCGAGGGCACGAAGTCCTCCTCCTCCGCCTCTGATGGCGAAAGCGAGGGGAAAAGAGGCCGGCAGAAGCCGAAGGCTGCCCCA
GAGGGAGCCGGGGCGCTGGCACAGGGCAGTTCCCTGGAGCCGGGGCGGCCTGCAGCACCGAGTCTCCCCGGAGAGGCCGAGCCTGGCGCG
CATGCCCCGGACAAGGAGCCTGAGCTGGGTGGGCAGGAGGAGGGCGAGCGGGATGGCCTCTGCGGCCTGGGCAACGGCTGTGCCGACAGG
AAGGAGGCGGAGACCGAGTCACAGAACAGCGAGCTGTCGGGGGTCACTGCGGGTGAGTCCCTGGACCAGAGCATGGAGGAGGAGGAGGAG
GAGGACACGGATGAGGATGACCACCTCATCTACCTGGAGGAGATCCTGGTCCGTGTACACACTGACTACTATGCCAAGTATGACCGCTAC
CTCAACAAGGAGATCGAGGAGGCGCCGGACATCCGCAAGATCGTGCCGGAGCTCAAGAGCAAGGTGCTGGCAGACGTGGCCATAATTTTC
AGTGGGCTACACCCGACAAACTTCCCGATAGAGAAGACGCGGGAGCATTACCACGCCACGGCGCTGGGAGCGAAGATCCTCACTCGGCTG
GTGCTGAGCCCCGACGCCCCTGACAGGGCCACGCACCTGATCGCCGCGCGAGCTGGCACAGAGAAGGTGCTGCAGGCACAGGAGTGCGGA
CACCTGCACGTGGTCAACCCTGACTGGCTGTGGAGCTGCCTGGAGCGCTGGGACAAGGTGGAGGAGCAGCTCTTCCCGCTCAGGGACGAT
CACACCAAGGCACAGAGGGAGAACAGCCCTGCGGCCTTTCCCGACCGGGAGGGTGTGCCCCCCACCGCCTTGTTCCACCCGATGCCGGTT
CTTCCCAAGGCCCAGCCTGGCCCCGAGGTTCGGATCTACGACTCCAACACGGGGAAGCTCATCAGGACGGGCGCCCGGGGGCCCCCAGCA
CCCTCCAGCTCCCTACCCATCCGCCAGGAGCCCTCTTCCTTCAGAATTCTCTGGTGGTTGAGATCCCGCCATTTCGGAATCAGAGGATAA
CCAGCCCCGTTCACGTCAGTTTCTACGTCTGCAACGGGAAGAGAAAGCGAAGCCAGTACCAGCGTTTCACCTACCTTCCCGCCAACGGTA
ACGCCATCTTTCTAACCGTAAGCCGTGAACATGAGCGCGTGGGGTGCTTTTTCTAAAGACGCAGAAACGACGTCGCCGTAAAGCAGCGTG

>In-frame_CTDP1_ENST00000075430_chr18_77478016_+_NFATC1_ENST00000591814_chr18_77227450_+_3072nt
GGAACTACAGCGTCGCCGCCTGGGTTGTGTCGCCGCGGTAGGCGCTGCGCTCTGAGCGCAGCGCAGGCCCCGTACCGACCGCCCGCCCGC
CCTCTGTCCGCGATGGAGGTGCCGGCCGCGGGTCGCGTTCCTGCCGAGGGCGCCCCGACGGCGGCTGTGGCCGAGGTGCGCTGCCCGGGG
CCCGCGCCGCTGCGCCTGCTGGAGTGGAGGGTGGCGGCGGGCGCGGCCGTGCGCATCGGCTCGGTGCTGGCCGTGTTCGAGGCCGCCGCC
TCCGCGCAGTCCTCCGGGGCCTCTCAGTCCCGTGTAGCCTCCGGGGGCTGCGTGCGCCCCGCGCGGCCGGAACGCAGGCTGAGGTCGGAG
CGCGCGGGCGTGGTGCGGGAGCTGTGCGCGCAGCCGGGCCAGGTGGTCGCCCCAGGAGCGGTTCTGGTGAGGTTGGAAGGATGCAGCCAC
CCGGTTGTCATGAAAGGCCTGTGTGCTGAATGTGGCCAAGACCTCACCCAGTTGCAGAGTAAGAACGGGAAGCAGCAGGTGCCGCTGTCC
ACGGCGACCGTGTCCATGGTGCACAGCGTGCCGGAGTTGATGGTGAGCTCCGAGCAAGCTGAACAGCTGGGAAGAGAAGACCAGCAGCGA
CTGCACCGAAACCGGAAGCTGGTGCTCATGGTGGACTTGGACCAGACGTTGATTCACACAACCGAGCAGCACTGTCAGCAGATGTCGAAT
AAAGGCATCTTTCACTTCCAGCTGGGCCGGGGTGAGCCCATGCTGCACACGCGCCTGCGTCCACACTGCAAGGACTTCCTGGAGAAGATC
GCCAAGCTGTACGAGCTGCACGTCTTCACCTTCGGCAGCCGGCTGTACGCACACACCATCGCAGGCTTTTTAGACCCCGAGAAGAAGCTT
TTTTCTCACCGAATATTATCAAGGGATGAATGTATTGACCCATTTTCTAAAACGGGAAACCTTAGAAATCTCTTTCCTTGTGGAGACTCA
ATGGTTTGCATTATTGATGATCGAGAAGATGTCTGGAAGTTTGCCCCCAATCTGATAACTGTGAAGAAATATGTATACTTCCAGGGCACG
GGTGATATGAATGCGCCCCCTGGGTCCCGAGAATCTCAGACGAGAAAGAAAGTAAATCATTCTCGAGGCACTGAGGTCTCAGAGCCATCT
CCGCCCGTGAGAGACCCTGAGGGGGTAACGCAGGCCCCTGGAGTGGAGCCCAGCAATGGCCTGGAGAAGCCTGCACGGGAGCTGAACGGC
AGCGAGGCCGCCACCCCGCGGGACTCACCCCGCCCCGGGAAGCCAGACGAGAGGGACATCTGGCCCCCTGCCCAGGCCCCCACCAGCAGC
CAAGAGCTGGCAGGCGCTCCTGAGCCCCAGGGATCCTGTGCGCAGGGTGGCCGGGTGGCACCGGGACAGCGGCCTGCCCAGGGTGCCACG
GGCACTGACCTGGACTTTGACTTATCCAGCGACAGCGAGAGCAGCAGTGAGTCCGAGGGCACGAAGTCCTCCTCCTCCGCCTCTGATGGC
GAAAGCGAGGGGAAAAGAGGCCGGCAGAAGCCGAAGGCTGCCCCAGAGGGAGCCGGGGCGCTGGCACAGGGCAGTTCCCTGGAGCCGGGG
CGGCCTGCAGCACCGAGTCTCCCCGGAGAGGCCGAGCCTGGCGCGCATGCCCCGGACAAGGAGCCTGAGCTGGGTGGGCAGGAGGAGGGC
GAGCGGGATGGCCTCTGCGGCCTGGGCAACGGCTGTGCCGACAGGAAGGAGGCGGAGACCGAGTCACAGAACAGCGAGCTGTCGGGGGTC
ACTGCGGGTGAGTCCCTGGACCAGAGCATGGAGGAGGAGGAGGAGGAGGACACGGATGAGGATGACCACCTCATCTACCTGGAGGAGATC
CTGGTCCGTGTACACACTGACTACTATGCCAAGTATGACCGCTACCTCAACAAGGAGATCGAGGAGGCGCCGGACATCCGCAAGATCGTG
CCGGAGCTCAAGAGCAAGGTGCTGGCAGACGTGGCCATAATTTTCAGTGGGCTACACCCGACAAACTTCCCGATAGAGAAGACGCGGGAG
CATTACCACGCCACGGCGCTGGGAGCGAAGATCCTCACTCGGCTGGTGCTGAGCCCCGACGCCCCTGACAGGGCCACGCACCTGATCGCC
GCGCGAGCTGGCACAGAGAAGGTGCTGCAGGCACAGGAGTGCGGACACCTGCACGTGGTCAACCCTGACTGGCTGTGGAGCTGCCTGGAG
CGCTGGGACAAGGTGGAGGAGCAGCTCTTCCCGCTCAGGGACGATCACACCAAGGCACAGAGGGAGAACAGCCCTGCGGCCTTTCCCGAC
CGGGAGGGTGTGCCCCCCACCGCCTTGTTCCACCCGATGCCGGTTCTTCCCAAGGCCCAGCCTGGCCCCGAGGTTCGGATCTACGACTCC
AACACGGGGAAGCTCATCAGGACGGGCGCCCGGGGGCCCCCAGCACCCTCCAGCTCCCTACCCATCCGCCAGGAGCCCTCTTCCTTCAGA
ATTCTCTGGTGGTTGAGATCCCGCCATTTCGGAATCAGAGGATAACCAGCCCCGTTCACGTCAGTTTCTACGTCTGCAACGGGAAGAGAA
AGCGAAGCCAGTACCAGCGTTTCACCTACCTTCCCGCCAACGGTAACGCCATCTTTCTAACCGTAAGCCGTGAACATGAGCGCGTGGGGT
GCTTTTTCTAAAGACGCAGAAACGACGTCGCCGTAAAGCAGCGTGGCGTGTTGCACATTTAACTGTGTGATGTCCCGTTAGTGAGACCGA
GCCATCGATGCCCTGAAAAGGAAAGGAAAAGGGAAGCTTCGGATGCATTTTCCTTGATCCCTGTTGGGGGTGGGGGGCGGGGGTTGCATA
CTCAGATAGTCACGGTTATTTTGCTTCTTGCGAATGTATAACAGCCAAGGGGAAAACATGGCTCTTCTGCTCCAAAAAACTGAGGGGGTC
CTGGTGTGCATTTGCACCCTAAAGCTGCTTACGGTGAAAAGGCAAATAGGTATAGCTATTTTGCAGGCACCTTTAGGAATAAACTTTGCT

>In-frame_CTDP1_ENST00000075430_chr18_77478016_+_NFATC1_ENST00000587635_chr18_77227450_+_2746nt
GGAACTACAGCGTCGCCGCCTGGGTTGTGTCGCCGCGGTAGGCGCTGCGCTCTGAGCGCAGCGCAGGCCCCGTACCGACCGCCCGCCCGC
CCTCTGTCCGCGATGGAGGTGCCGGCCGCGGGTCGCGTTCCTGCCGAGGGCGCCCCGACGGCGGCTGTGGCCGAGGTGCGCTGCCCGGGG
CCCGCGCCGCTGCGCCTGCTGGAGTGGAGGGTGGCGGCGGGCGCGGCCGTGCGCATCGGCTCGGTGCTGGCCGTGTTCGAGGCCGCCGCC
TCCGCGCAGTCCTCCGGGGCCTCTCAGTCCCGTGTAGCCTCCGGGGGCTGCGTGCGCCCCGCGCGGCCGGAACGCAGGCTGAGGTCGGAG
CGCGCGGGCGTGGTGCGGGAGCTGTGCGCGCAGCCGGGCCAGGTGGTCGCCCCAGGAGCGGTTCTGGTGAGGTTGGAAGGATGCAGCCAC
CCGGTTGTCATGAAAGGCCTGTGTGCTGAATGTGGCCAAGACCTCACCCAGTTGCAGAGTAAGAACGGGAAGCAGCAGGTGCCGCTGTCC
ACGGCGACCGTGTCCATGGTGCACAGCGTGCCGGAGTTGATGGTGAGCTCCGAGCAAGCTGAACAGCTGGGAAGAGAAGACCAGCAGCGA
CTGCACCGAAACCGGAAGCTGGTGCTCATGGTGGACTTGGACCAGACGTTGATTCACACAACCGAGCAGCACTGTCAGCAGATGTCGAAT
AAAGGCATCTTTCACTTCCAGCTGGGCCGGGGTGAGCCCATGCTGCACACGCGCCTGCGTCCACACTGCAAGGACTTCCTGGAGAAGATC
GCCAAGCTGTACGAGCTGCACGTCTTCACCTTCGGCAGCCGGCTGTACGCACACACCATCGCAGGCTTTTTAGACCCCGAGAAGAAGCTT
TTTTCTCACCGAATATTATCAAGGGATGAATGTATTGACCCATTTTCTAAAACGGGAAACCTTAGAAATCTCTTTCCTTGTGGAGACTCA
ATGGTTTGCATTATTGATGATCGAGAAGATGTCTGGAAGTTTGCCCCCAATCTGATAACTGTGAAGAAATATGTATACTTCCAGGGCACG
GGTGATATGAATGCGCCCCCTGGGTCCCGAGAATCTCAGACGAGAAAGAAAGTAAATCATTCTCGAGGCACTGAGGTCTCAGAGCCATCT
CCGCCCGTGAGAGACCCTGAGGGGGTAACGCAGGCCCCTGGAGTGGAGCCCAGCAATGGCCTGGAGAAGCCTGCACGGGAGCTGAACGGC
AGCGAGGCCGCCACCCCGCGGGACTCACCCCGCCCCGGGAAGCCAGACGAGAGGGACATCTGGCCCCCTGCCCAGGCCCCCACCAGCAGC
CAAGAGCTGGCAGGCGCTCCTGAGCCCCAGGGATCCTGTGCGCAGGGTGGCCGGGTGGCACCGGGACAGCGGCCTGCCCAGGGTGCCACG
GGCACTGACCTGGACTTTGACTTATCCAGCGACAGCGAGAGCAGCAGTGAGTCCGAGGGCACGAAGTCCTCCTCCTCCGCCTCTGATGGC
GAAAGCGAGGGGAAAAGAGGCCGGCAGAAGCCGAAGGCTGCCCCAGAGGGAGCCGGGGCGCTGGCACAGGGCAGTTCCCTGGAGCCGGGG
CGGCCTGCAGCACCGAGTCTCCCCGGAGAGGCCGAGCCTGGCGCGCATGCCCCGGACAAGGAGCCTGAGCTGGGTGGGCAGGAGGAGGGC
GAGCGGGATGGCCTCTGCGGCCTGGGCAACGGCTGTGCCGACAGGAAGGAGGCGGAGACCGAGTCACAGAACAGCGAGCTGTCGGGGGTC
ACTGCGGGTGAGTCCCTGGACCAGAGCATGGAGGAGGAGGAGGAGGAGGACACGGATGAGGATGACCACCTCATCTACCTGGAGGAGATC
CTGGTCCGTGTACACACTGACTACTATGCCAAGTATGACCGCTACCTCAACAAGGAGATCGAGGAGGCGCCGGACATCCGCAAGATCGTG
CCGGAGCTCAAGAGCAAGGTGCTGGCAGACGTGGCCATAATTTTCAGTGGGCTACACCCGACAAACTTCCCGATAGAGAAGACGCGGGAG
CATTACCACGCCACGGCGCTGGGAGCGAAGATCCTCACTCGGCTGGTGCTGAGCCCCGACGCCCCTGACAGGGCCACGCACCTGATCGCC
GCGCGAGCTGGCACAGAGAAGGTGCTGCAGGCACAGGAGTGCGGACACCTGCACGTGGTCAACCCTGACTGGCTGTGGAGCTGCCTGGAG
CGCTGGGACAAGGTGGAGGAGCAGCTCTTCCCGCTCAGGGACGATCACACCAAGGCACAGAGGGAGAACAGCCCTGCGGCCTTTCCCGAC
CGGGAGGGTGTGCCCCCCACCGCCTTGTTCCACCCGATGCCGGTTCTTCCCAAGGCCCAGCCTGGCCCCGAGGTTCGGATCTACGACTCC
AACACGGGGAAGCTCATCAGGACGGGCGCCCGGGGGCCCCCAGCACCCTCCAGCTCCCTACCCATCCGCCAGGAGCCCTCTTCCTTCAGA
ATTCTCTGGTGGTTGAGATCCCGCCATTTCGGAATCAGAGGATAACCAGCCCCGTTCACGTCAGTTTCTACGTCTGCAACGGGAAGAGAA
AGCGAAGCCAGTACCAGCGTTTCACCTACCTTCCCGCCAACGGTAACGCCATCTTTCTAACCGTAAGCCGTGAACATGAGCGCGTGGGGT


Top

FusionGenePPI for CTDP1_NFATC1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CTDP1POLR2A, GTF2F1, TCEA1, WDR77, CHD8, POLR2J, GTF2F2, GTF2B, POLR2B, STK38, ERH, PRMT5, INTS1, INTS3, INTS6, INTS7, INTS8, MED1, MED14, MED23, MED15, MED24, MED16, MED25, MED17, MED26, MED4, MED7, MED6, MED8, CDK9, CDK8, CDK7, PRKDC, ELP2, ELP3, GRK5, POLR2C, UPP1, PPP1CA, PPP2CA, RPRD1B, POLR2G, CSNK2A1, CSNK2A2, HMGB1, CSNK2B, ETS2, POLR2F, LTN1, IWS1, NUF2, DSN1, FBXW7NFATC1EGR1, EGR2, PIM1, HDAC3, PARP1, FOXP3, HDAC5, KAT2B, EP300, TUBA1A, KPNB1, HNRNPA1, UBE2I, PIAS1, HDAC2, HDAC1, HDAC4, RPS6KA3, RPS6KB1, GZF1, PML, OGT, YWHAQ, PPP3CC, FOS, JUN, HOXD13, CREB1, HIST1H2BA, HIST1H2BC, HIST3H3, ATF3, TP53, CHD4, ZMYM3, ISL1, SMARCA5, ADNP, CUX1, HIST1H2AD, RECQL, ATF1, FLYWCH1, GATAD2B, HMGA1, SMC3, ATF2, BEND3, KIF4A, LRWD1, SMC2, FRMPD1, HMGA2, HOXA10, JUND, ORC2, ORC5, PDS5A, PRDM15, SMARCA4, SMARCB1, SMARCC2, TAF10, TRPS1, ANKRD20A1, RBPJ, TEAD2, RPTOR, SCAI, GSK3B, WDR48, IKZF2, CHEK1, IKZF1, SATB1, RUNX1, CSNK1D, TRMT61B, MOSPD2, RFC5, NEK7, NEK6, FOXK2, PHGDH, JUNB, CREBBP, MTHFD2, LRRC47, NFATC2, FXR1, ACAD9, ZBTB40, RANBP9, DPF2, SMARCD2, LEF1, RFC2, VAPA, ATF7, SMARCE1, IFI16, CHAMP1, MDH2, XRCC6, HLTF, DNAJC7, MTHFD1L, CBFB, XRCC5, ACTL6A, RPA1, CTBP1, SMARCC1, HSPA5, RFC4, FOXK1, HSPA9, SMARCD1, ARID1A, LIG3, TUFM, NUP210, SARS2, BCL11B, TRRAP, CSNK1A1, CSNK1A1L, CAD, HMGCS2, PLOD1, PPP3R1, OBSL1, DNAAF2, SEMA7A, ZMYND19, MKLN1, LRRC28, ARMC8, PPP3CA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CTDP1_NFATC1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneNFATC1O95644DB00852PseudoephedrineNuclear factor of activated T-cells, cytoplasmic 1small moleculeapproved

Top

RelatedDiseases for CTDP1_NFATC1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource