FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8491

FusionGeneSummary for CRK_GEMIN4

check button Fusion gene summary
Fusion gene informationFusion gene name: CRK_GEMIN4
Fusion gene ID: 8491
HgeneTgene
Gene symbol

CRK

GEMIN4

Gene ID

1398

50628

Gene nameCRK proto-oncogene, adaptor proteingem nuclear organelle associated protein 4
SynonymsCRKII|p38HC56|HCAP1|HHRF-1|NEDMCR|p97
Cytomap

17p13.3

17p13.3

Type of geneprotein-codingprotein-coding
Descriptionadapter molecule crkproto-oncogene c-Crkv-crk avian sarcoma virus CT10 oncogene homologv-crk sarcoma virus CT10 oncogene-like proteingem-associated protein 4HCC-associated protein 1component of gems 4gemin-4
Modification date2018052220180523
UniProtAcc

P46108

P57678

Ensembl transtripts involved in fusion geneENST00000398970, ENST00000300574, 
ENST00000574295, ENST00000572145, 
ENST00000319004, ENST00000437269, 
ENST00000576778, 
Fusion gene scores* DoF score10 X 5 X 6=3002 X 1 X 2=4
# samples 102
** MAII scorelog2(10/300*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: CRK [Title/Abstract] AND GEMIN4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCRK

GO:0009966

regulation of signal transduction

17515907

HgeneCRK

GO:0032956

regulation of actin cytoskeleton organization

11870224

HgeneCRK

GO:0043087

regulation of GTPase activity

11870224

HgeneCRK

GO:0048013

ephrin receptor signaling pathway

11870224

HgeneCRK

GO:0061045

negative regulation of wound healing

17515907

HgeneCRK

GO:0071538

SH2 domain-mediated complex assembly

12384576

HgeneCRK

GO:2000146

negative regulation of cell motility

17515907

TgeneGEMIN4

GO:0000387

spliceosomal snRNP assembly

18984161


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-86-8669-01ACRKchr17

1340084

-GEMIN4chr17

651272

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000398970ENST00000319004CRKchr17

1340084

-GEMIN4chr17

651272

-
In-frameENST00000398970ENST00000437269CRKchr17

1340084

-GEMIN4chr17

651272

-
5CDS-5UTRENST00000398970ENST00000576778CRKchr17

1340084

-GEMIN4chr17

651272

-
intron-3CDSENST00000300574ENST00000319004CRKchr17

1340084

-GEMIN4chr17

651272

-
intron-3CDSENST00000300574ENST00000437269CRKchr17

1340084

-GEMIN4chr17

651272

-
intron-5UTRENST00000300574ENST00000576778CRKchr17

1340084

-GEMIN4chr17

651272

-
intron-3CDSENST00000574295ENST00000319004CRKchr17

1340084

-GEMIN4chr17

651272

-
intron-3CDSENST00000574295ENST00000437269CRKchr17

1340084

-GEMIN4chr17

651272

-
intron-5UTRENST00000574295ENST00000576778CRKchr17

1340084

-GEMIN4chr17

651272

-
5UTR-3CDSENST00000572145ENST00000319004CRKchr17

1340084

-GEMIN4chr17

651272

-
5UTR-3CDSENST00000572145ENST00000437269CRKchr17

1340084

-GEMIN4chr17

651272

-
5UTR-5UTRENST00000572145ENST00000576778CRKchr17

1340084

-GEMIN4chr17

651272

-

Top

FusionProtFeatures for CRK_GEMIN4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CRK

P46108

GEMIN4

P57678

Isoform Crk-II: Regulates cell adhesion, spreading andmigration. Mediates attachment-induced MAPK8 activation, membraneruffling and cell motility in a Rac-dependent manner. Involved inphagocytosis of apoptotic cells and cell motility via itsinteraction with DOCK1 and DOCK4. May regulate the EFNA5-EPHA3signaling. {ECO:0000269|PubMed:11870224,ECO:0000269|PubMed:1630456, ECO:0000269|PubMed:17515907,ECO:0000269|PubMed:19004829}. The SMN complex plays a catalyst role in the assembly ofsmall nuclear ribonucleoproteins (snRNPs), the building blocks ofthe spliceosome. Thereby, plays an important role in the splicingof cellular pre-mRNAs. Most spliceosomal snRNPs contain a commonset of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF andSNRPG that assemble in a heptameric protein ring on the Sm site ofthe small nuclear RNA to form the core snRNP. In the cytosol, theSm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped inan inactive 6S pICln-Sm complex by the chaperone CLNS1A thatcontrols the assembly of the core snRNP. Dissociation by the SMNcomplex of CLNS1A from the trapped Sm proteins and their transferto an SMN-Sm complex triggers the assembly of core snRNPs andtheir transport to the nucleus. {ECO:0000269|PubMed:18984161}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CRK_GEMIN4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CRK_ENST00000398970_chr17_1340084_-_GEMIN4_ENST00000437269_chr17_651272_-_384aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDTVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIG
DQEFDSLPALLEFYKIHTLDTTTLIEPVSRSRQGSGVILRQEEAETVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKTRPASASVSALIGGPLNICEEMTILHGGFLLAEQLFHPKALAELTKSDWERVGRPIVEALREISSAAAHSQPFAWKKKALI
IIWAKVLQPHPVTPSDTETRWQEDLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CRK_ENST00000398970_chr17_1340084_-_GEMIN4_ENST00000437269_chr17_651272_-_1152nt
ATGGCGGGCAACTTCGACTCGGAGGAGCGGAGTAGCTGGTACTGGGGGAGGTTGAGTCGGCAGGAGGCGGTGGCGCTGCTGCAGGGCCAG
CGGCACGGGGTGTTCCTGGTGCGGGACTCGAGCACCAGCCCCGGGGACTATGTGCTCAGCGTCTCAGAGAACTCGCGCGTCTCCCACTAC
ATCATCAACAGCAGCGGCCCGCGCCCGCCGGTGCCACCGTCGCCCGCCCAGCCTCCGCCCGGGGTGAGCCCCTCCAGACTCCGAATAGGA
GATCAAGAGTTTGATTCATTGCCTGCTTTACTGGAATTCTACAAAATACACTATTTGGACACTACAACGTTGATAGAACCAGTTTCCAGA
TCCAGGCAGGGTAGTGGAGTGATTCTCAGGCAGGAGGAGGCGGAGTATGTGCGAGCCCTCTTTGACTTTAATGGGAATGATGAGGAAGAT
CTTCCCTTTAAGAAAGGAGACATCTTGAGAATCCGGGACAAGCCTGAAGAGCAGTGGTGGAATGCGGAGGACAGCGAAGGCAAGAGAGGG
ATGATTCCAGTCCCTTACGTCGAGAAGTATAGACCTGCCTCCGCCTCAGTATCGGCTCTGATTGGAGGACCCTTGAACATCTGTGAAGAA
ATGACTATTCTGCATGGAGGCTTCTTGCTGGCCGAGCAGCTGTTCCACCCTAAGGCACTGGCAGAATTAACAAAGTCTGACTGGGAACGT
GTTGGACGGCCCATCGTGGAGGCCTTAAGGGAGATCTCCTCGGCTGCAGCACACTCCCAGCCCTTTGCCTGGAAGAAGAAAGCCCTGATC
ATCATCTGGGCCAAGGTTCTGCAGCCGCACCCCGTGACCCCGTCCGACACAGAGACACGGTGGCAGGAAGACCTGTTCTTCTCGGTGGGC
AACATGATCCCCACCATCAACCACACCATCCTCTTCGAGCTGCTCAAATCCCTGGAAGCTTCTGGACTCTTTATCCAGCTCCTGATGGCC
CTGCCCACCACCATCTGCCATGCAGAACTAGAGCGCTTTCTGGAACATGTGACCGTTGACACTTCTGCCGAAGACGTGGCCTTCTTCCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CRK_ENST00000398970_chr17_1340084_-_GEMIN4_ENST00000437269_chr17_651272_-_1853nt
GCTGCTGTGAAGCTGAAACCGGAGCCGGTCCGCTGGGCGGCGGGCGCCGGGGGCCGGAGGGGCGCGCGCGGCGGCGGCACCCCAGCGTTT
AGGCGCGGAGGCAGCCATGGCGGGCAACTTCGACTCGGAGGAGCGGAGTAGCTGGTACTGGGGGAGGTTGAGTCGGCAGGAGGCGGTGGC
GCTGCTGCAGGGCCAGCGGCACGGGGTGTTCCTGGTGCGGGACTCGAGCACCAGCCCCGGGGACTATGTGCTCAGCGTCTCAGAGAACTC
GCGCGTCTCCCACTACATCATCAACAGCAGCGGCCCGCGCCCGCCGGTGCCACCGTCGCCCGCCCAGCCTCCGCCCGGGGTGAGCCCCTC
CAGACTCCGAATAGGAGATCAAGAGTTTGATTCATTGCCTGCTTTACTGGAATTCTACAAAATACACTATTTGGACACTACAACGTTGAT
AGAACCAGTTTCCAGATCCAGGCAGGGTAGTGGAGTGATTCTCAGGCAGGAGGAGGCGGAGTATGTGCGAGCCCTCTTTGACTTTAATGG
GAATGATGAGGAAGATCTTCCCTTTAAGAAAGGAGACATCTTGAGAATCCGGGACAAGCCTGAAGAGCAGTGGTGGAATGCGGAGGACAG
CGAAGGCAAGAGAGGGATGATTCCAGTCCCTTACGTCGAGAAGTATAGACCTGCCTCCGCCTCAGTATCGGCTCTGATTGGAGGACCCTT
GAACATCTGTGAAGAAATGACTATTCTGCATGGAGGCTTCTTGCTGGCCGAGCAGCTGTTCCACCCTAAGGCACTGGCAGAATTAACAAA
GTCTGACTGGGAACGTGTTGGACGGCCCATCGTGGAGGCCTTAAGGGAGATCTCCTCGGCTGCAGCACACTCCCAGCCCTTTGCCTGGAA
GAAGAAAGCCCTGATCATCATCTGGGCCAAGGTTCTGCAGCCGCACCCCGTGACCCCGTCCGACACAGAGACACGGTGGCAGGAAGACCT
GTTCTTCTCGGTGGGCAACATGATCCCCACCATCAACCACACCATCCTCTTCGAGCTGCTCAAATCCCTGGAAGCTTCTGGACTCTTTAT
CCAGCTCCTGATGGCCCTGCCCACCACCATCTGCCATGCAGAACTAGAGCGCTTTCTGGAACATGTGACCGTTGACACTTCTGCCGAAGA
CGTGGCCTTCTTCCTGGACGTCTGGTGGGAGAGGACGACCCCCAGGAGGTGTCTGCAACCGTGTATCTGGACAAACTGGCCACGGTGATC
TCTGTGTGGAACTCGGACACCCAGAATCCCTACCACCAGCAGGCGCTGGCAGAGAAGGTGAAGGAGGCAGAACGGGATGTCAGCCTGACC
TCGCTGGCCAAACTCCCCAGTGAGACCATTTTCGTGGGCTGCGAGTTCCTGCACCACCTGCTGCGGGAGTGGGGGGAGGAGTTGCAGGCC
GTGCTCCGCAGCAGCCAGGGGACAAGTTACGACAGCTACCGGCTGTGCGACAGTCTGACTTCCTTCAGCCAGAACGCGACGCTCTACCTG
AACCGCACCAGCCTGTCCAAGGAGGACAGGCAGGTGGTCTCTGAGCTGGCGGAGTGTGTCAGGGACTTCCTGAGGAAAACGAGCACGGTG
CTGAAGAACAGGGCCTTGGAGGATATCACAGCTTCCATTGCCATGGCCGTCATCCAGCAGAAGATGGACCGCCATATGGAAGTGTGCTAC
ATTTTTGCCTCTGAGAAGAAGTGGGCCTTCTCGGACGAGTGGGTAGCCTGCCTGGGGAGTAACAGGGCCCTCTTCCGACAGCCAGACTTG


Top

FusionGenePPI for CRK_GEMIN4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CRKPLSCR1, DPPA4, BUB1, PSMC6, EGFR, ERBB4, BCAR1, SRCIN1, ARHGAP32, DOCK1, SRC, PTK2, MAP4K1, EPHA3, SH3KBP1, SOCS1, IRS4, MAPK8, KHDRBS1, ASAP1, PDGFRA, AVIL, GRB2, ARHGAP17, RET, PXN, PDGFRB, NEDD9, EPHB3, FRS2, MAP4K5, EPHB2, RAPGEF1, SH3BP1, SOS1, XPO1, WEE1, SHB, ZAP70, EPS15, CBL, PTPN1, CBLC, MICAL1, SYN1, PPP1CA, BCR, CSE1L, PIK3R1, TERF2IP, POT1, FASLG, EFS, ATXN1, KIT, ABL1, UBASH3B, PIK3R2, SHC1, PIK3CB, KRT1, PIK3CA, KRT2, KRT9, KRT10, HSPA8, KRT14, KRT5, KRT16, KRT6A, HSPA1B, KRT6B, PIK3C2B, TUBB, TUBB4B, CASS4, PTPN11, INPPL1, KRT17, ACTB, TUBB2A, SOS2, NCKIPSD, EDC4, HSPA1L, TUBB3, TUBA1A, CBLB, ABL2, HSPA9, RPS19, PIK3R3, PEAK1, GAB2, HSPA6, KRT3, KRT19, KRT15, HSPA5, AP2A1, KRT76, KRT77, PIK3CD, GAB1, KRT73, KRT8, AGO2, YWHAG, KRT79, KRT78, UBC, EEF1A1, YWHAQ, CORO1C, AP2B1, RPS5, DDX3X, DDX6, UBASH3A, KRT24, RPS25, SFN, ASAP3, KRT12, KRT4, AGO1, DNAJA3, RNGTT, RPL23, HSP90AB1, TUBA4B, LYZ, DDX5, RPS3, SERPINB6, HSPBP1, DSC1, AP2M1, GGA3, FUBP1, ATIC, SERPINH1, NANS, DHX9, HSPB1, SPR, DOK1, ERBB2, ERBB3, PPFIBP2, LMNA, BAG3, PTPN4, MAPK4, MET, SPRR2A, HUWE1, FAM154A, CAST, GFPT1, SRM, BEX5, RTCB, CHTF18, CNDP2, DOK2, DOK3, DOK7, ELK1, EPYC, EYA3, GAREM, FSTL1, GABPB2, HSH2D, KCTD13, KLHL20, LASP1, MAGEC3, MPG, MYLIP, MYOZ2, NUFIP2, OFCC1, PAFAH1B2, PHC2, PRKACA, PRRG2, RAB2B, SEMA4D, SH2D2A, SOCS6, STAT4, TCAP, TM4SF19, VAC14, ANKZF1, ANLN, ASB9, ASCL4, PRRC2B, BATF3, C4orf17, SETD9, C6orf141, CORO6, ESD, HABP4, IFT140, INO80E, ISL1, KCTD17, KLF15, LHX8, MNDA, PSMC1, PTTG1, RYBP, SEPT6, STRN4, TDG, TP53, TUBA1C, TWIST2, WDR83, ZKSCAN7, ZNF557, ATF3, FER, CLNK, RIN3, CCP110, CEP128, CEP89, ODF2, CEP19, COX6C, HIST1H1D, PPP1R12A, NUMA1, KAT6A, MPDZ, ARPC1B, SLC25A13, C10orf12, MRPL48, INF2, FLNA, STAT5A, FGFR1, TRIM15, TSG101, CDH1GEMIN4GSK3B, RNPS1, NFKBIL1, GIPC1, ILK, SNRPB, CDK4, FIBP, BRF2, MYC, AGO2, PPP4R2, DDX20, PPP4C, SMN1, GEMIN5, FBL, GAR1, LGALS1, LGALS3, GEMIN6, DHX9, SLX1B, CLN3, GIGYF2, SIRT7, CALCOCO2, GRK5, TOP1, GEMIN2, RNU1-1, RNU2-1, SRP9, SRP54, BARD1, PNKP, IQCB1, DICER1, UBL4A, HDAC11, GEMIN4, EGFR, RN7SL1, FLAD1, MORC4, DMPK, SQSTM1, SPRY1, PIAS3, SRRT, GLYR1, MIB1, RPA3, RPA2, RPA1, BMI1, P2RY12, F2RL1, PTGER3, CRYAB, ALDH3A2, WHSC1, NTRK1, GEMIN7, SNW1, CDC5L, USP9X, SMN2, SNRNP70, SNRPE, STRAP, SNRPF, SIGLECL1, SNRPG, OPRM1, FZD10, UXS1, PTPN9, CD2BP2, PARK7, NUFIP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CRK_GEMIN4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CRK_GEMIN4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCRKC0151744Myocardial Ischemia1CTD_human
TgeneGEMIN4C0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneGEMIN4C0036341Schizophrenia1PSYGENET