FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 8247

FusionGeneSummary for CPM_AVIL

check button Fusion gene summary
Fusion gene informationFusion gene name: CPM_AVIL
Fusion gene ID: 8247
HgeneTgene
Gene symbol

CPM

AVIL

Gene ID

1368

10677

Gene namecarboxypeptidase Madvillin
Synonyms-ADVIL|DOC6|p92
Cytomap

12q15

12q14.1

Type of geneprotein-codingprotein-coding
Descriptioncarboxypeptidase Mrenal carboxypeptidaseurinary carboxypeptidase Badvillin
Modification date2018052320180519
UniProtAcc

P14384

O75366

Ensembl transtripts involved in fusion geneENST00000546373, ENST00000551568, 
ENST00000338356, ENST00000549691, 
ENST00000537081, ENST00000257861, 
ENST00000550083, 
Fusion gene scores* DoF score12 X 5 X 6=36015 X 10 X 6=900
# samples 1216
** MAII scorelog2(12/360*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(16/900*10)=-2.49185309632967
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CPM [Title/Abstract] AND AVIL [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A1L0-01ACPMchr12

69326458

-AVILchr12

58194995

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000546373ENST00000537081CPMchr12

69326458

-AVILchr12

58194995

-
In-frameENST00000546373ENST00000257861CPMchr12

69326458

-AVILchr12

58194995

-
5CDS-intronENST00000546373ENST00000550083CPMchr12

69326458

-AVILchr12

58194995

-
In-frameENST00000551568ENST00000537081CPMchr12

69326458

-AVILchr12

58194995

-
In-frameENST00000551568ENST00000257861CPMchr12

69326458

-AVILchr12

58194995

-
5CDS-intronENST00000551568ENST00000550083CPMchr12

69326458

-AVILchr12

58194995

-
In-frameENST00000338356ENST00000537081CPMchr12

69326458

-AVILchr12

58194995

-
In-frameENST00000338356ENST00000257861CPMchr12

69326458

-AVILchr12

58194995

-
5CDS-intronENST00000338356ENST00000550083CPMchr12

69326458

-AVILchr12

58194995

-
intron-3CDSENST00000549691ENST00000537081CPMchr12

69326458

-AVILchr12

58194995

-
intron-3CDSENST00000549691ENST00000257861CPMchr12

69326458

-AVILchr12

58194995

-
intron-intronENST00000549691ENST00000550083CPMchr12

69326458

-AVILchr12

58194995

-

Top

FusionProtFeatures for CPM_AVIL


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CPM

P14384

AVIL

O75366

Specifically removes C-terminal basic residues (Arg orLys) from peptides and proteins. It is believed to play importantroles in the control of peptide hormone and growth factor activityat the cell surface, and in the membrane-localized degradation ofextracellular proteins. {ECO:0000269|PubMed:12457462}. Ca(2+)-regulated actin-binding protein. May have aunique function in the morphogenesis of neuronal cells which formganglia. Required for SREC1-mediated regulation of neurite-likeoutgrowth. Plays a role in regenerative sensory axon outgrowth andremodeling processes after peripheral injury in neonates. Involvedin the formation of long fine actin-containing filopodia-likestructures in fibroblast. Plays a role in ciliogenesis.{ECO:0000269|PubMed:20393563}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-1519753_819717820DomainHP
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-1519753_819710813DomainHP
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-1519731_819717820RegionHeadpiece
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-1519731_819710813RegionHeadpiece

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-1519109_116717820RegionPolyphosphoinositide binding
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-1519135_143717820RegionPolyphosphoinositide binding
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-15191_731717820RegionCore
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-1519109_116710813RegionPolyphosphoinositide binding
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-1519135_143710813RegionPolyphosphoinositide binding
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-15191_731710813RegionCore
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-1519145_185717820RepeatNote=Gelsolin-like 2
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-151924_73717820RepeatNote=Gelsolin-like 1
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-1519262_306717820RepeatNote=Gelsolin-like 3
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-1519403_454717820RepeatNote=Gelsolin-like 4
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-1519525_565717820RepeatNote=Gelsolin-like 5
TgeneAVILchr12:69326458chr12:58194995ENST00000257861-1519628_669717820RepeatNote=Gelsolin-like 6
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-1519145_185710813RepeatNote=Gelsolin-like 2
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-151924_73710813RepeatNote=Gelsolin-like 1
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-1519262_306710813RepeatNote=Gelsolin-like 3
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-1519403_454710813RepeatNote=Gelsolin-like 4
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-1519525_565710813RepeatNote=Gelsolin-like 5
TgeneAVILchr12:69326458chr12:58194995ENST00000537081-1519628_669710813RepeatNote=Gelsolin-like 6


Top

FusionGeneSequence for CPM_AVIL


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CPM_ENST00000546373_chr12_69326458_-_AVIL_ENST00000537081_chr12_58194995_-_156aa
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRKNI_TIKRRAGRCCCTHANHC_HEECNPLPEF__Q

>In-frame_CPM_ENST00000546373_chr12_69326458_-_AVIL_ENST00000257861_chr12_58194995_-_156aa
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRKNI_TIKRRAGRCCCTHANHC_HEECNPLPEF__Q

>In-frame_CPM_ENST00000551568_chr12_69326458_-_AVIL_ENST00000537081_chr12_58194995_-_156aa
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRKNI_TIKRRAGRCCCTHANHC_HEECNPLPEF__Q

>In-frame_CPM_ENST00000551568_chr12_69326458_-_AVIL_ENST00000257861_chr12_58194995_-_156aa
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRKNI_TIKRRAGRCCCTHANHC_HEECNPLPEF__Q

>In-frame_CPM_ENST00000338356_chr12_69326458_-_AVIL_ENST00000537081_chr12_58194995_-_156aa
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRKNI_TIKRRAGRCCCTHANHC_HEECNPLPEF__Q

>In-frame_CPM_ENST00000338356_chr12_69326458_-_AVIL_ENST00000257861_chr12_58194995_-_156aa
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRKNI_TIKRRAGRCCCTHANHC_HEECNPLPEF__Q


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CPM_ENST00000546373_chr12_69326458_-_AVIL_ENST00000537081_chr12_58194995_-_469nt
ATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCG
TTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGCAGGAAAAACATATGAACA
ATTAAAAGAAGAGCTGGGAGATGCTGCTGCTATCATGCGAATCACTGCTGACATGAAGAATGCAACCCTCTCCCTGAATTCTAATGACAG
TGAGCCAAAATATTACCCTATAGCAGTTCTGTTGAAAAACCAGAATCAGGAGCTGCCTGAGGATGTAAACCCTGCCAAAAAGGAGAATTA
CCTCTCTGAACAGGACTTTGTGTCTGTGTTTGGCATCACAAGAGGGCAATTTGCAGCTCTGCCTGGCTGGAAACAGCTCCAAATGAAGAA

>In-frame_CPM_ENST00000546373_chr12_69326458_-_AVIL_ENST00000257861_chr12_58194995_-_469nt
ATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCG
TTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGCAGGAAAAACATATGAACA
ATTAAAAGAAGAGCTGGGAGATGCTGCTGCTATCATGCGAATCACTGCTGACATGAAGAATGCAACCCTCTCCCTGAATTCTAATGACAG
TGAGCCAAAATATTACCCTATAGCAGTTCTGTTGAAAAACCAGAATCAGGAGCTGCCTGAGGATGTAAACCCTGCCAAAAAGGAGAATTA
CCTCTCTGAACAGGACTTTGTGTCTGTGTTTGGCATCACAAGAGGGCAATTTGCAGCTCTGCCTGGCTGGAAACAGCTCCAAATGAAGAA

>In-frame_CPM_ENST00000551568_chr12_69326458_-_AVIL_ENST00000537081_chr12_58194995_-_469nt
ATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCG
TTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGCAGGAAAAACATATGAACA
ATTAAAAGAAGAGCTGGGAGATGCTGCTGCTATCATGCGAATCACTGCTGACATGAAGAATGCAACCCTCTCCCTGAATTCTAATGACAG
TGAGCCAAAATATTACCCTATAGCAGTTCTGTTGAAAAACCAGAATCAGGAGCTGCCTGAGGATGTAAACCCTGCCAAAAAGGAGAATTA
CCTCTCTGAACAGGACTTTGTGTCTGTGTTTGGCATCACAAGAGGGCAATTTGCAGCTCTGCCTGGCTGGAAACAGCTCCAAATGAAGAA

>In-frame_CPM_ENST00000551568_chr12_69326458_-_AVIL_ENST00000257861_chr12_58194995_-_469nt
ATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCG
TTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGCAGGAAAAACATATGAACA
ATTAAAAGAAGAGCTGGGAGATGCTGCTGCTATCATGCGAATCACTGCTGACATGAAGAATGCAACCCTCTCCCTGAATTCTAATGACAG
TGAGCCAAAATATTACCCTATAGCAGTTCTGTTGAAAAACCAGAATCAGGAGCTGCCTGAGGATGTAAACCCTGCCAAAAAGGAGAATTA
CCTCTCTGAACAGGACTTTGTGTCTGTGTTTGGCATCACAAGAGGGCAATTTGCAGCTCTGCCTGGCTGGAAACAGCTCCAAATGAAGAA

>In-frame_CPM_ENST00000338356_chr12_69326458_-_AVIL_ENST00000537081_chr12_58194995_-_469nt
ATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCG
TTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGCAGGAAAAACATATGAACA
ATTAAAAGAAGAGCTGGGAGATGCTGCTGCTATCATGCGAATCACTGCTGACATGAAGAATGCAACCCTCTCCCTGAATTCTAATGACAG
TGAGCCAAAATATTACCCTATAGCAGTTCTGTTGAAAAACCAGAATCAGGAGCTGCCTGAGGATGTAAACCCTGCCAAAAAGGAGAATTA
CCTCTCTGAACAGGACTTTGTGTCTGTGTTTGGCATCACAAGAGGGCAATTTGCAGCTCTGCCTGGCTGGAAACAGCTCCAAATGAAGAA

>In-frame_CPM_ENST00000338356_chr12_69326458_-_AVIL_ENST00000257861_chr12_58194995_-_469nt
ATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCG
TTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGCAGGAAAAACATATGAACA
ATTAAAAGAAGAGCTGGGAGATGCTGCTGCTATCATGCGAATCACTGCTGACATGAAGAATGCAACCCTCTCCCTGAATTCTAATGACAG
TGAGCCAAAATATTACCCTATAGCAGTTCTGTTGAAAAACCAGAATCAGGAGCTGCCTGAGGATGTAAACCCTGCCAAAAAGGAGAATTA
CCTCTCTGAACAGGACTTTGTGTCTGTGTTTGGCATCACAAGAGGGCAATTTGCAGCTCTGCCTGGCTGGAAACAGCTCCAAATGAAGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CPM_ENST00000546373_chr12_69326458_-_AVIL_ENST00000537081_chr12_58194995_-_1073nt
GTCTAGATTCTTCTTGGCCTCTCTGAGCAGCATTTCTTCCTTCTGCGTATGGGACAGGACCCTTTCTGGAATGGGGGTCTTATGACCTAC
AATCAAACAAGAACATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGG
AAGGGATGGAAGCGTTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGCAGGA
AAAACATATGAACAATTAAAAGAAGAGCTGGGAGATGCTGCTGCTATCATGCGAATCACTGCTGACATGAAGAATGCAACCCTCTCCCTG
AATTCTAATGACAGTGAGCCAAAATATTACCCTATAGCAGTTCTGTTGAAAAACCAGAATCAGGAGCTGCCTGAGGATGTAAACCCTGCC
AAAAAGGAGAATTACCTCTCTGAACAGGACTTTGTGTCTGTGTTTGGCATCACAAGAGGGCAATTTGCAGCTCTGCCTGGCTGGAAACAG
CTCCAAATGAAGAAAGAAAAGGGGCTTTTCTAAAGCAAGAAGGCCTATACCTATTGCAAGGCCACAGAAAAGAGCAGATAGTGCCAATAT
CAGGAAATAATTTATCCACCAATTTCTGCCTGACATTCAGCTACTTAATTTAGATATAATAGAGTCTGCAAATCACGGCATGTTCTCCAT
TTTTTCTCATCCTTGCATTCCTTGCTTGTTATATACCTAAAATGTTAACCATATAGTTTTTGGGTTTTGTGGCCCTCTAGCTAAAGCCTC
AGCAGAAAGCACTAAAACTGCATAAATCTGGAGAAATCAAAAGAAAGAGAACCAAAAAACAATGCTTAAAATGTTTAATAACTTTATGTT
TAATATTATACCAGGACCTACCTTTGTTTTCAATTTTAAGATGATTATTTCTAAAATCTATTTAGCCTGTAAATCATTGAAATCATATAT

>In-frame_CPM_ENST00000546373_chr12_69326458_-_AVIL_ENST00000257861_chr12_58194995_-_573nt
GTCTAGATTCTTCTTGGCCTCTCTGAGCAGCATTTCTTCCTTCTGCGTATGGGACAGGACCCTTTCTGGAATGGGGGTCTTATGACCTAC
AATCAAACAAGAACATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGG
AAGGGATGGAAGCGTTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGCAGGA
AAAACATATGAACAATTAAAAGAAGAGCTGGGAGATGCTGCTGCTATCATGCGAATCACTGCTGACATGAAGAATGCAACCCTCTCCCTG
AATTCTAATGACAGTGAGCCAAAATATTACCCTATAGCAGTTCTGTTGAAAAACCAGAATCAGGAGCTGCCTGAGGATGTAAACCCTGCC
AAAAAGGAGAATTACCTCTCTGAACAGGACTTTGTGTCTGTGTTTGGCATCACAAGAGGGCAATTTGCAGCTCTGCCTGGCTGGAAACAG

>In-frame_CPM_ENST00000551568_chr12_69326458_-_AVIL_ENST00000537081_chr12_58194995_-_1030nt
ATAACACCCGGCCCCGCCGGGCGGCCGCGGGTGGGTAGAGGTGCGCGCCTGGGACCTGAACATGGACTTCCCGTGCCTCTGGCTAGGGCT
GTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCGTTTTTGAAGACTGTTGCCCAAAACTACAG
TTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGCAGGAAAAACATATGAACAATTAAAAGAAGAGCTGGGAGATGCTGCTG
CTATCATGCGAATCACTGCTGACATGAAGAATGCAACCCTCTCCCTGAATTCTAATGACAGTGAGCCAAAATATTACCCTATAGCAGTTC
TGTTGAAAAACCAGAATCAGGAGCTGCCTGAGGATGTAAACCCTGCCAAAAAGGAGAATTACCTCTCTGAACAGGACTTTGTGTCTGTGT
TTGGCATCACAAGAGGGCAATTTGCAGCTCTGCCTGGCTGGAAACAGCTCCAAATGAAGAAAGAAAAGGGGCTTTTCTAAAGCAAGAAGG
CCTATACCTATTGCAAGGCCACAGAAAAGAGCAGATAGTGCCAATATCAGGAAATAATTTATCCACCAATTTCTGCCTGACATTCAGCTA
CTTAATTTAGATATAATAGAGTCTGCAAATCACGGCATGTTCTCCATTTTTTCTCATCCTTGCATTCCTTGCTTGTTATATACCTAAAAT
GTTAACCATATAGTTTTTGGGTTTTGTGGCCCTCTAGCTAAAGCCTCAGCAGAAAGCACTAAAACTGCATAAATCTGGAGAAATCAAAAG
AAAGAGAACCAAAAAACAATGCTTAAAATGTTTAATAACTTTATGTTTAATATTATACCAGGACCTACCTTTGTTTTCAATTTTAAGATG
ATTATTTCTAAAATCTATTTAGCCTGTAAATCATTGAAATCATATATGCACTCCATAGGCAAAATCCAAATACCCAGATCTGTAATGTGT

>In-frame_CPM_ENST00000551568_chr12_69326458_-_AVIL_ENST00000257861_chr12_58194995_-_530nt
ATAACACCCGGCCCCGCCGGGCGGCCGCGGGTGGGTAGAGGTGCGCGCCTGGGACCTGAACATGGACTTCCCGTGCCTCTGGCTAGGGCT
GTTGCTGCCTTTGGTAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCGTTTTTGAAGACTGTTGCCCAAAACTACAG
TTCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGCAGGAAAAACATATGAACAATTAAAAGAAGAGCTGGGAGATGCTGCTG
CTATCATGCGAATCACTGCTGACATGAAGAATGCAACCCTCTCCCTGAATTCTAATGACAGTGAGCCAAAATATTACCCTATAGCAGTTC
TGTTGAAAAACCAGAATCAGGAGCTGCCTGAGGATGTAAACCCTGCCAAAAAGGAGAATTACCTCTCTGAACAGGACTTTGTGTCTGTGT

>In-frame_CPM_ENST00000338356_chr12_69326458_-_AVIL_ENST00000537081_chr12_58194995_-_1016nt
CCCTCATGTGTTCTCAGGTTCTTCTTATTTTTATTCATCTCTAGAACATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGG
TAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCGTTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACT
TACACAGTATTGGGAAATCTGTGAAAGGCAGGAAAAACATATGAACAATTAAAAGAAGAGCTGGGAGATGCTGCTGCTATCATGCGAATC
ACTGCTGACATGAAGAATGCAACCCTCTCCCTGAATTCTAATGACAGTGAGCCAAAATATTACCCTATAGCAGTTCTGTTGAAAAACCAG
AATCAGGAGCTGCCTGAGGATGTAAACCCTGCCAAAAAGGAGAATTACCTCTCTGAACAGGACTTTGTGTCTGTGTTTGGCATCACAAGA
GGGCAATTTGCAGCTCTGCCTGGCTGGAAACAGCTCCAAATGAAGAAAGAAAAGGGGCTTTTCTAAAGCAAGAAGGCCTATACCTATTGC
AAGGCCACAGAAAAGAGCAGATAGTGCCAATATCAGGAAATAATTTATCCACCAATTTCTGCCTGACATTCAGCTACTTAATTTAGATAT
AATAGAGTCTGCAAATCACGGCATGTTCTCCATTTTTTCTCATCCTTGCATTCCTTGCTTGTTATATACCTAAAATGTTAACCATATAGT
TTTTGGGTTTTGTGGCCCTCTAGCTAAAGCCTCAGCAGAAAGCACTAAAACTGCATAAATCTGGAGAAATCAAAAGAAAGAGAACCAAAA
AACAATGCTTAAAATGTTTAATAACTTTATGTTTAATATTATACCAGGACCTACCTTTGTTTTCAATTTTAAGATGATTATTTCTAAAAT
CTATTTAGCCTGTAAATCATTGAAATCATATATGCACTCCATAGGCAAAATCCAAATACCCAGATCTGTAATGTGTCAAAGCATTTTTCA

>In-frame_CPM_ENST00000338356_chr12_69326458_-_AVIL_ENST00000257861_chr12_58194995_-_516nt
CCCTCATGTGTTCTCAGGTTCTTCTTATTTTTATTCATCTCTAGAACATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGG
TAGCTGCGCTGGATTTCAACTACCACCGCCAGGAAGGGATGGAAGCGTTTTTGAAGACTGTTGCCCAAAACTACAGTTCTGTCACTCACT
TACACAGTATTGGGAAATCTGTGAAAGGCAGGAAAAACATATGAACAATTAAAAGAAGAGCTGGGAGATGCTGCTGCTATCATGCGAATC
ACTGCTGACATGAAGAATGCAACCCTCTCCCTGAATTCTAATGACAGTGAGCCAAAATATTACCCTATAGCAGTTCTGTTGAAAAACCAG
AATCAGGAGCTGCCTGAGGATGTAAACCCTGCCAAAAAGGAGAATTACCTCTCTGAACAGGACTTTGTGTCTGTGTTTGGCATCACAAGA


Top

FusionGenePPI for CPM_AVIL


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CPMELAVL1, CAPZA2, DBN1, FLNA, GAK, MYH9, PPP1CC, RAB7A, PDLIM7, ATP6AP2, SYNPO, MAPRE1, GOLT1B, LIMA1, ANLN, MYO19, ZSCAN12, ULBP1, FTH1, TBC1D22B, GTPBP3AVILCRK, RBSN, DDX11, DUS3L, FIGNL1, SCYL1, DOCK7, VIL1, TMOD2, RICTOR, RIPK4, DCTN6, MCM8, THUMPD3, BRIP1, MYO5C, ALMS1, MYO1F, TUBA4A, TUBB8, MYO1B, MYO5A, USP47, C14orf80, TUBB3, DDX11L8, WDR59, BBS1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CPM_AVIL


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CPM_AVIL


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCPMC0014175Endometriosis1CTD_human
HgeneCPMC0037116Silicosis1CTD_human