FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7560

FusionGeneSummary for CLU_MYH9

check button Fusion gene summary
Fusion gene informationFusion gene name: CLU_MYH9
Fusion gene ID: 7560
HgeneTgene
Gene symbol

CLU

MYH9

Gene ID

1191

4627

Gene nameclusterinmyosin heavy chain 9
SynonymsAAG4|APO-J|APOJ|CLI|CLU1|CLU2|KUB1|NA1/NA2|SGP-2|SGP2|SP-40|TRPM-2|TRPM2BDPLT6|DFNA17|EPSTS|FTNS|MHA|NMHC-II-A|NMMHC-IIA|NMMHCA
Cytomap

8p21.1

22q12.3

Type of geneprotein-codingprotein-coding
Descriptionclusterinaging-associated protein 4apolipoprotein Jcomplement cytolysis inhibitorcomplement lysis inhibitorcomplement-associated protein SP-40,40ku70-binding protein 1sulfated glycoprotein 2testosterone-repressed prostate message 2myosin-9cellular myosin heavy chain, type Amyosin, heavy chain 9, non-musclenon-muscle myosin heavy chain 9non-muscle myosin heavy chain Anon-muscle myosin heavy chain IIanon-muscle myosin heavy polypeptide 9nonmuscle myosin heavy chain II-A
Modification date2018052720180522
UniProtAcc

P10909

P35579

Ensembl transtripts involved in fusion geneENST00000316403, ENST00000546343, 
ENST00000560366, ENST00000405140, 
ENST00000523500, 
ENST00000216181, 
ENST00000475726, ENST00000401701, 
Fusion gene scores* DoF score24 X 23 X 8=441623 X 25 X 7=4025
# samples 3028
** MAII scorelog2(30/4416*10)=-3.87970576628229
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(28/4025*10)=-3.84549005094438
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CLU [Title/Abstract] AND MYH9 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCLU

GO:0000902

cell morphogenesis

15857407

HgeneCLU

GO:0001774

microglial cell activation

15857407

HgeneCLU

GO:0017038

protein import

24446231

HgeneCLU

GO:0032463

negative regulation of protein homooligomerization

22179788|23106396

HgeneCLU

GO:0032464

positive regulation of protein homooligomerization

22179788

HgeneCLU

GO:0032760

positive regulation of tumor necrosis factor production

15857407

HgeneCLU

GO:0045429

positive regulation of nitric oxide biosynthetic process

15857407

HgeneCLU

GO:0050821

protein stabilization

11123922

HgeneCLU

GO:0051131

chaperone-mediated protein complex assembly

17412999

HgeneCLU

GO:0051788

response to misfolded protein

19996109

HgeneCLU

GO:0061077

chaperone-mediated protein folding

11123922

HgeneCLU

GO:0061518

microglial cell proliferation

15857407

HgeneCLU

GO:1900221

regulation of amyloid-beta clearance

24446231

HgeneCLU

GO:1901214

regulation of neuron death

17412999

HgeneCLU

GO:1901216

positive regulation of neuron death

15857407

HgeneCLU

GO:1902430

negative regulation of amyloid-beta formation

12047389|17412999

HgeneCLU

GO:1905907

negative regulation of amyloid fibril formation

22179788

TgeneMYH9

GO:0001525

angiogenesis

16403913

TgeneMYH9

GO:0006509

membrane protein ectodomain proteolysis

16186248

TgeneMYH9

GO:0030048

actin filament-based movement

12237319|15845534

TgeneMYH9

GO:0031032

actomyosin structure organization

24072716


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-UY-A9PE-01ACLUchr8

27463871

-MYH9chr22

36723533

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000316403ENST00000216181CLUchr8

27463871

-MYH9chr22

36723533

-
5CDS-intronENST00000316403ENST00000475726CLUchr8

27463871

-MYH9chr22

36723533

-
5CDS-intronENST00000316403ENST00000401701CLUchr8

27463871

-MYH9chr22

36723533

-
Frame-shitENST00000546343ENST00000216181CLUchr8

27463871

-MYH9chr22

36723533

-
5CDS-intronENST00000546343ENST00000475726CLUchr8

27463871

-MYH9chr22

36723533

-
5CDS-intronENST00000546343ENST00000401701CLUchr8

27463871

-MYH9chr22

36723533

-
Frame-shitENST00000560366ENST00000216181CLUchr8

27463871

-MYH9chr22

36723533

-
5CDS-intronENST00000560366ENST00000475726CLUchr8

27463871

-MYH9chr22

36723533

-
5CDS-intronENST00000560366ENST00000401701CLUchr8

27463871

-MYH9chr22

36723533

-
In-frameENST00000405140ENST00000216181CLUchr8

27463871

-MYH9chr22

36723533

-
5CDS-intronENST00000405140ENST00000475726CLUchr8

27463871

-MYH9chr22

36723533

-
5CDS-intronENST00000405140ENST00000401701CLUchr8

27463871

-MYH9chr22

36723533

-
Frame-shitENST00000523500ENST00000216181CLUchr8

27463871

-MYH9chr22

36723533

-
5CDS-intronENST00000523500ENST00000475726CLUchr8

27463871

-MYH9chr22

36723533

-
5CDS-intronENST00000523500ENST00000401701CLUchr8

27463871

-MYH9chr22

36723533

-

Top

FusionProtFeatures for CLU_MYH9


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CLU

P10909

MYH9

P35579

Isoform 1 functions as extracellular chaperone thatprevents aggregation of nonnative proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formationof amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA andaggregation-prone LYZ variants (in vitro). Does not require ATP.Maintains partially unfolded proteins in a state appropriate forsubsequent refolding by other chaperones, such as HSPA8/HSC70.Does not refold proteins by itself. Binding to cell surfacereceptors triggers internalization of the chaperone-client complexand subsequent lysosomal or proteasomal degradation. Secretedisoform 1 protects cells against apoptosis and against cytolysisby complement. Intracellular isoforms interact with ubiquitin andSCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligasecomplexes and promote the ubiquitination and subsequentproteasomal degradation of target proteins. Promotes proteasomaldegradation of COMMD1 and IKBKB. Modulates NF-kappa-Btranscriptional activity. Nuclear isoforms promote apoptosis.Mitochondrial isoforms suppress BAX-dependent release ofcytochrome c into the cytoplasm and inhibit apoptosis. Plays arole in the regulation of cell proliferation.{ECO:0000269|PubMed:11123922, ECO:0000269|PubMed:12047389,ECO:0000269|PubMed:12176985, ECO:0000269|PubMed:12551933,ECO:0000269|PubMed:12882985, ECO:0000269|PubMed:16113678,ECO:0000269|PubMed:17260971, ECO:0000269|PubMed:17407782,ECO:0000269|PubMed:17412999, ECO:0000269|PubMed:17689225,ECO:0000269|PubMed:19137541, ECO:0000269|PubMed:19535339,ECO:0000269|PubMed:19996109, ECO:0000269|PubMed:20068069,ECO:0000269|PubMed:21505792}. Cellular myosin that appears to play a role incytokinesis, cell shape, and specialized functions such assecretion and capping. During cell spreading, plays an importantrole in cytoskeleton reorganization, focal contacts formation (inthe margins but not the central part of spreading cells), andlamellipodial retraction; this function is mechanicallyantagonized by MYH10. {ECO:0000269|PubMed:20052411}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CLU_MYH9


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CLU_ENST00000405140_chr8_27463871_-_MYH9_ENST00000216181_chr22_36723533_-_1936aa
MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRE
SETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQTEKINPSCALVNLELARRRTPRRSSSIWRTWRPRTRARRTR
ASWSGSCCRPTPSWRPSGTPRP_RMTTPPASANSFASTLMSMATLLEPTLRLIFWRNLVLSAKPRKNGPSTSSIISCLGLEST_RPISCW
SRTTNTASCPMDTSPSPGSRTRTCSRRPWRP_GLWASQKRSKWACCGSSQGFFSSATSSSRRSGTLTRRPCPTTQLPKRCPISWVSM_PI
SPEESSPRASRWDGITSRRRRLKSRLTLPSRPWPRRPMSGCSAGWCCASTRLWTRPRGRAPPSSGSWTLPASRSLI_TRLSSCASITPMR
SCSSSSTTPCSSWSRRSTSARASSGTSSTLASTCSPASTSLRSQQAPRAFWPCWTRSAGSPKPPTRASWRR_CRSRAPTPSSRSPSS_RT
KLISALSTMPARWITKLTSG__RTWIP_MTTSPHCSTSPLTSLSRSCGRMWTASSAWTRWPACRRPHCPGPSRRGRACSALWGSFTRSSW
PS_WLR_GTRTPTLSAASSPTTRRRPASWTRISCWTSCAATVFSRASVSAARASPTGWSSRSFGRDMRS_LQTPFPRVSWTGSRRACS__
KPWSSTAICTALARAKSSSVPVCWPTWRRSET_RSPTSS_GSRPAAGATWPGKHLPSGSSSLPP_RSSSGTALPT_SCGTGSGGGSSPRS
SRCCR_AGRRRR_WPRRRSW_RSERSSWLRRTGSRRWRRCSLSSWQRNCSCRSSSRQKPSCVPRLRSSGPA_PPRSRN_KRSAMT_RPGW
RRRRSAASTCRRRRRRCSRTSRSLRSSWRRRRAPGRSCSWRR_PPRRS_KSWRRSRSSWRTRTASWPRKRNCWKTE_LSSPPTSQKRRRN
LRASPSSRTSMRQ_SLTWKSASAGRRSSDRSWRRPAGSWRETPQTSATRSPSSRPRSRSSRCSWPRKRRSSRPPWPEWKRKLPRRTWPSR
RSGSWNLRSLNSRKTWSLSVLPGIKLRSRNGTLGKS_RL_KQSWRTRWIPQLPSRSSGQNVSRR_TS_RRPWRRRPRPTRPRSRR_GRST
HRPWRSWRSSWSRRSG_KQTSRRQSRLWRTSGGSWPTR_RCCCRAKGTRSTSARKWRRSCRSCRSSSTRESACAQSWPTRSPSCRWSWTT
_PGFSASPTASPASSPRTSPRWSPSCRTLRSCCRRRTGRS_A_APSSSRWRTRRIPSGSSWRRRRRPSTTWRSRSPPSMPRWPT_KRRWR
TVWGAWKLLRR_RGSSRRTWRA_ASGTRRRWPPTTSWRRPRRGCSRSWTTCWWTWTTSARARATWRRSRRSLTSSWRRRRPSLPSMQRSA
TGLRRRPERRRPRLCRWPGPWRKPWSRRRSWSGSTSSSARRWRTL_APRMMWARVSTSWRSPSGP_SSRWRR_RRSWKSWRTSCRPPKMP
SCGWRSTCRP_RPSSSGTCRAGTSRARRRRSSWSDRCGRWRQSWRTRGSSARWQWPPGRSWRWT_RTWRRTSTRPTRTGTKPSNSCGSCR
PR_RTACASWMTPAPLVRRSWPRPKRTRRS_RAWRPR_SSCRRNWQPRSVPSARPSRSGMSWLTRSPTAAAKEPWR_RRSGVWRPASPSW
RRSWRRSRATRS_STTG_RRPTCRSTRSTPT_TWSAATPRRTRMLGSSWNARTRSLRSSCRRWRALSSPSTRPPSPPSRPRLHSWRSSWT
TRPRSARQPANRCVGPRRS_RMCCCRWMTSGGTPSSTRTRPTRHLPA_SSSSGSWRRPKRRPSGPTPPAGNCSASWRTPLRRPMP_TAKS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CLU_ENST00000405140_chr8_27463871_-_MYH9_ENST00000216181_chr22_36723533_-_5810nt
ATGATGAAGACTCTGCTGCTGTTTGTGGGGCTGCTGCTGACCTGGGAGAGTGGGCAGGTCCTGGGGGACCAGACGGTCTCAGACAATGAG
CTCCAGGAAATGTCCAATCAGGGAAGTAAGTACGTCAATAAGGAAATTCAAAATGCTGTCAACGGGGTGAAACAGATAAAGACTCTCATA
GAAAAAACAAACGAAGAGCGCAAGACACTGCTCAGCAACCTAGAAGAAGCCAAGAAGAAGAAAGAGGATGCCCTAAATGAGACCAGGGAA
TCAGAGACAAAGCTGAAGGAGCTCCCAGGAGTGTGCAATGAGACCATGATGGCCCTCTGGGAAGAGTGTAAGCCCTGCCTGAAACAGACC
TGCATGAAGTTCTACGCACGCGTCTGCAGAAGTGGCTCAGGCCTGGTTGGCCGCCAGACCGAGAAGATCAATCCATCTTGTGCACTGGTG
AATCTGGAGCTGGCAAGACGGAGAACACCAAGAAGGTCATCCAGTATCTGGCGTACGTGGCGTCCTCGCACAAGAGCAAGAAGGACCAGG
GCGAGCTGGAGCGGCAGCTGCTGCAGGCCAACCCCATCCTGGAGGCCTTCGGGAACGCCAAGACCGTGAAGAATGACAACTCCTCCCGCT
TCGGCAAATTCATTCGCATCAACTTTGATGTCAATGGCTACATTGTTGGAGCCAACATTGAGACTTATCTTTTGGAGAAATCTCGTGCTA
TCCGCCAAGCCAAGGAAGAACGGACCTTCCACATCTTCTATTATCTCCTGTCTGGGGCTGGAGAGCACCTGAAGACCGATCTCCTGTTGG
AGCCGTACAACAAATACCGCTTCCTGTCCAATGGACACGTCACCATCCCCGGGCAGCAGGACAAGGACATGTTCCAGGAGACCATGGAGG
CCATGAGGATTATGGGCATCCCAGAAGAGGAGCAAATGGGCCTGCTGCGGGTCATCTCAGGGGTTCTTCAGCTCGGCAACATCGTCTTCA
AGAAGGAGCGGAACACTGACCAGGCGTCCATGCCCGACAACACAGCTGCCCAAAAGGTGTCCCATCTCTTGGGTATCAATGTGACCGATT
TCACCAGAGGAATCCTCACCCCGCGCATCAAGGTGGGACGGGATTACGTCCAGAAGGCGCAGACTAAAGAGCAGGCTGACTTTGCCATCG
AGGCCTTGGCCAAGGCGACCTATGAGCGGATGTTCCGCTGGCTGGTGCTGCGCATCAACAAGGCTCTGGACAAGACCAAGAGGCAGGGCG
CCTCCTTCATCGGGATCCTGGACATTGCCGGCTTCGAGATCTTTGATCTGAACTCGTTTGAGCAGCTGTGCATCAATTACACCAATGAGA
AGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGACTTTG
GCCTCGACCTGCAGCCCTGCATCGACCTCATTGAGAAGCCAGCAGGCCCCCCGGGCATTCTGGCCCTGCTGGACGAGGAGTGCTGGTTCC
CCAAAGCCACCGACAAGAGCTTCGTGGAGAAGGTGATGCAGGAGCAGGGCACCCACCCCAAGTTCCAGAAGCCCAAGCAGCTGAAGGACA
AAGCTGATTTCTGCATTATCCACTATGCCGGCAAGGTGGATTACAAAGCTGACGAGTGGCTGATGAAGAACATGGATCCCCTGAATGACA
ACATCGCCACACTGCTCCACCAGTCCTCTGACAAGTTTGTCTCGGAGCTGTGGAAGGATGTGGACCGCATCATCGGCCTGGACCAGGTGG
CCGGCATGTCGGAGACCGCACTGCCCGGGGCCTTCAAGACGCGGAAGGGCATGTTCCGCACTGTGGGGCAGCTTTACAAGGAGCAGCTGG
CCAAGCTGATGGCTACGCTGAGGAACACGAACCCCAACTTTGTCCGCTGCATCATCCCCAACCACGAGAAGAAGGCCGGCAAGCTGGACC
CGCATCTCGTGCTGGACCAGCTGCGCTGCAACGGTGTTCTCGAGGGCATCCGTATCTGCCGCCAGGGCTTCCCCAACAGGGTGGTCTTCC
AGGAGTTTCGGCAGAGATATGAGATCCTGACTCCAAACTCCATTCCCAAGGGTTTCATGGACGGGAAGCAGGCGTGCGTGCTCATGATAA
AAGCCCTGGAGCTCGACAGCAATCTGTACCGCATTGGCCAGAGCAAAGTCTTCTTCCGTGCCGGTGTGCTGGCCCACCTGGAGGAGGAGC
GAGACCTGAAGATCACCGACGTCATCATAGGGTTCCAGGCCTGCTGCAGGGGCTACCTGGCCAGGAAAGCATTTGCCAAGCGGCAGCAGC
AGCTTACCGCCATGAAGGTCCTCCAGCGGAACTGCGCTGCCTACCTGAAGCTGCGGAACTGGCAGTGGTGGCGGCTCTTCACCAAGGTCA
AGCCGCTGCTGCAGGTGAGCCGGCAGGAGGAGGAGATGATGGCCAAGGAGGAGGAGCTGGTGAAGGTCAGAGAGAAGCAGCTGGCTGCGG
AGAACAGGCTCACGGAGATGGAGACGCTGCAGTCTCAGCTCATGGCAGAGAAATTGCAGCTGCAGGAGCAGCTCCAGGCAGAAACCGAGC
TGTGTGCCGAGGCTGAGGAGCTCCGGGCCCGCCTGACCGCCAAGAAGCAGGAATTAGAAGAGATCTGCCATGACCTAGAGGCCAGGGTGG
AGGAGGAGGAGGAGCGCTGCCAGCACCTGCAGGCGGAGAAGAAGAAGATGCAGCAGAACATCCAGGAGCTTGAGGAGCAGCTGGAGGAGG
AGGAGAGCGCCCGGCAGAAGCTGCAGCTGGAGAAGGTGACCACCGAGGCGAAGCTGAAAAAGCTGGAGGAGGAGCAGATCATCCTGGAGG
ACCAGAACTGCAAGCTGGCCAAGGAAAAGAAACTGCTGGAAGACAGAATAGCTGAGTTCACCACCAACCTCACAGAAGAGGAGGAGAAAT
CTAAGAGCCTCGCCAAGCTCAAGAACAAGCATGAGGCAATGATCACTGACTTGGAAGAGCGCCTCCGCAGGGAGGAGAAGCAGCGACAGG
AGCTGGAGAAGACCCGCCGGAAGCTGGAGGGAGACTCCACAGACCTCAGCGACCAGATCGCCGAGCTCCAGGCCCAGATCGCGGAGCTCA
AGATGCAGCTGGCCAAGAAAGAGGAGGAGCTCCAGGCCGCCCTGGCCAGAGTGGAAGAGGAAGCTGCCCAGAAGAACATGGCCCTCAAGA
AGATCCGGGAGCTGGAATCTCAGATCTCTGAACTCCAGGAAGACCTGGAGTCTGAGCGTGCTTCCAGGAATAAAGCTGAGAAGCAGAAAC
GGGACCTTGGGGAAGAGCTAGAGGCTCTGAAAACAGAGTTGGAGGACACGCTGGATTCCACAGCTGCCCAGCAGGAGCTCAGGTCAAAAC
GTGAGCAGGAGGTGAACATCCTGAAGAAGACCCTGGAGGAGGAGGCCAAGACCCACGAGGCCCAGATCCAGGAGATGAGGCAGAAGCACT
CACAGGCCGTGGAGGAGCTGGCGGAGCAGCTGGAGCAGACGAAGCGGGTGAAAGCAAACCTCGAGAAGGCAAAGCAGACTCTGGAGAACG
AGCGGGGGGAGCTGGCCAACGAGGTGAAGGTGCTGCTGCAGGGCAAAGGGGACTCGGAGCACAAGCGCAAGAAAGTGGAGGCGCAGCTGC
AGGAGCTGCAGGTCAAGTTCAACGAGGGAGAGCGCGTGCGCACAGAGCTGGCCGACAAGGTCACCAAGCTGCAGGTGGAGCTGGACAACG
TGACCGGGCTTCTCAGCCAGTCCGACAGCAAGTCCAGCAAGCTCACCAAGGACTTCTCCGCGCTGGAGTCCCAGCTGCAGGACACTCAGG
AGCTGCTGCAGGAGGAGAACCGGCAGAAGCTGAGCCTGAGCACCAAGCTCAAGCAGGTGGAGGACGAGAAGAATTCCTTCCGGGAGCAGC
TGGAGGAGGAGGAGGAGGCCAAGCACAACCTGGAGAAGCAGATCGCCACCCTCCATGCCCAGGTGGCCGACATGAAAAAGAAGATGGAGG
ACAGTGTGGGGTGCCTGGAAACTGCTGAGGAGGTGAAGAGGAAGCTCCAGAAGGACCTGGAGGGCCTGAGCCAGCGGCACGAGGAGAAGG
TGGCCGCCTACGACAAGCTGGAGAAGACCAAGACGCGGCTGCAGCAGGAGCTGGACGACCTGCTGGTGGACCTGGACCACCAGCGCCAGA
GCGCGTGCAACCTGGAGAAGAAGCAGAAGAAGTTTGACCAGCTCCTGGCGGAGGAGAAGACCATCTCTGCCAAGTATGCAGAGGAGCGCG
ACCGGGCTGAGGCGGAGGCCCGAGAGAAGGAGACCAAGGCTCTGTCGCTGGCCCGGGCCCTGGAGGAAGCCATGGAGCAGAAGGCGGAGC
TGGAGCGGCTCAACAAGCAGTTCCGCACGGAGATGGAGGACCTTATGAGCTCCAAGGATGATGTGGGCAAGAGTGTCCACGAGCTGGAGA
AGTCCAAGCGGGCCCTAGAGCAGCAGGTGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACGAGCTGCAGGCCACCGAAGATGCCA
AGCTGCGGTTGGAGGTCAACCTGCAGGCCATGAAGGCCCAGTTCGAGCGGGACCTGCAGGGCCGGGACGAGCAGAGCGAGGAGAAGAAGA
AGCAGCTGGTCAGACAGGTGCGGGAGATGGAGGCAGAGCTGGAGGACGAGAGGAAGCAGCGCTCGATGGCAGTGGCCGCCCGGAAGAAGC
TGGAGATGGACCTGAAGGACCTGGAGGCGCACATCGACTCGGCCAACAAGAACCGGGACGAAGCCATCAAACAGCTGCGGAAGCTGCAGG
CCCAGATGAAGGACTGCATGCGCGAGCTGGATGACACCCGCGCCTCTCGTGAGGAGATCCTGGCCCAGGCCAAAGAGAACGAGAAGAAGC
TGAAGAGCATGGAGGCCGAGATGATCCAGTTGCAGGAGGAACTGGCAGCCGCGGAGCGTGCCAAGCGCCAGGCCCAGCAGGAGCGGGATG
AGCTGGCTGACGAGATCGCCAACAGCAGCGGCAAAGGAGCCCTGGCGTTAGAGGAGAAGCGGCGTCTGGAGGCCCGCATCGCCCAGCTGG
AGGAGGAGCTGGAGGAGGAGCAGGGCAACACGGAGCTGATCAACGACCGGCTGAAGAAGGCCAACCTGCAGATCGACCAGATCAACACCG
ACCTGAACCTGGAGCGCAGCCACGCCCAGAAGAACGAGAATGCTCGGCAGCAGCTGGAACGCCAGAACAAGGAGCTTAAGGTCAAGCTGC
AGGAGATGGAGGGCACTGTCAAGTCCAAGTACAAGGCCTCCATCACCGCCCTCGAGGCCAAGATTGCACAGCTGGAGGAGCAGCTGGACA
ACGAGACCAAGGAGCGCCAGGCAGCCTGCAAACAGGTGCGTCGGACCGAGAAGAAGCTGAAGGATGTGCTGCTGCAGGTGGATGACGAGC
GGAGGAACGCCGAGCAGTACAAGGACCAGGCCGACAAGGCATCTACCCGCCTGAAGCAGCTCAAGCGGCAGCTGGAGGAGGCCGAAGAGG
AGGCCCAGCGGGCCAACGCCTCCCGCCGGAAACTGCAGCGCGAGCTGGAGGACGCCACTGAGACGGCCGATGCCATGAACCGCGAAGTCA
GCTCCCTAAAGAACAAGCTCAGGCGCGGGGACCTGCCGTTTGTCGTGCCCCGCCGAATGGCCCGGAAAGGCGCCGGGGATGGCTCCGACG


* Fusion transcript sequences (Full-length transcript).
>In-frame_CLU_ENST00000405140_chr8_27463871_-_MYH9_ENST00000216181_chr22_36723533_-_7512nt
AACACTGGCAGGGCAGCCTGCTGTCGGCTTAGAGGGGATGGGCAGTGTGGAGGGCCTGGCAGAGCAAGAGGACTCATCCTTCCAAAGGGA
CTTTCTCTGGGAAGCCTGCTCCTCGGGCCACTGCGAACCCTCTCTACTCTCCGAAGGGAATTGTCCTTCCTGGCTTCCACTACTTCCACC
CCTGAATGCACAGGCAGCCCGGCCCAAGTCTCCCACTAGGGATGCAGATGGATTCGGTGTGAAGGGCTGGCTGCTGTTGCCTCCGGCTCT
TGAAAGTCAAGTTCAGAGGCGTGCAAAGACTCCAGAATTGGAGGCATGATGAAGACTCTGCTGCTGTTTGTGGGGCTGCTGCTGACCTGG
GAGAGTGGGCAGGTCCTGGGGGACCAGACGGTCTCAGACAATGAGCTCCAGGAAATGTCCAATCAGGGAAGTAAGTACGTCAATAAGGAA
ATTCAAAATGCTGTCAACGGGGTGAAACAGATAAAGACTCTCATAGAAAAAACAAACGAAGAGCGCAAGACACTGCTCAGCAACCTAGAA
GAAGCCAAGAAGAAGAAAGAGGATGCCCTAAATGAGACCAGGGAATCAGAGACAAAGCTGAAGGAGCTCCCAGGAGTGTGCAATGAGACC
ATGATGGCCCTCTGGGAAGAGTGTAAGCCCTGCCTGAAACAGACCTGCATGAAGTTCTACGCACGCGTCTGCAGAAGTGGCTCAGGCCTG
GTTGGCCGCCAGACCGAGAAGATCAATCCATCTTGTGCACTGGTGAATCTGGAGCTGGCAAGACGGAGAACACCAAGAAGGTCATCCAGT
ATCTGGCGTACGTGGCGTCCTCGCACAAGAGCAAGAAGGACCAGGGCGAGCTGGAGCGGCAGCTGCTGCAGGCCAACCCCATCCTGGAGG
CCTTCGGGAACGCCAAGACCGTGAAGAATGACAACTCCTCCCGCTTCGGCAAATTCATTCGCATCAACTTTGATGTCAATGGCTACATTG
TTGGAGCCAACATTGAGACTTATCTTTTGGAGAAATCTCGTGCTATCCGCCAAGCCAAGGAAGAACGGACCTTCCACATCTTCTATTATC
TCCTGTCTGGGGCTGGAGAGCACCTGAAGACCGATCTCCTGTTGGAGCCGTACAACAAATACCGCTTCCTGTCCAATGGACACGTCACCA
TCCCCGGGCAGCAGGACAAGGACATGTTCCAGGAGACCATGGAGGCCATGAGGATTATGGGCATCCCAGAAGAGGAGCAAATGGGCCTGC
TGCGGGTCATCTCAGGGGTTCTTCAGCTCGGCAACATCGTCTTCAAGAAGGAGCGGAACACTGACCAGGCGTCCATGCCCGACAACACAG
CTGCCCAAAAGGTGTCCCATCTCTTGGGTATCAATGTGACCGATTTCACCAGAGGAATCCTCACCCCGCGCATCAAGGTGGGACGGGATT
ACGTCCAGAAGGCGCAGACTAAAGAGCAGGCTGACTTTGCCATCGAGGCCTTGGCCAAGGCGACCTATGAGCGGATGTTCCGCTGGCTGG
TGCTGCGCATCAACAAGGCTCTGGACAAGACCAAGAGGCAGGGCGCCTCCTTCATCGGGATCCTGGACATTGCCGGCTTCGAGATCTTTG
ATCTGAACTCGTTTGAGCAGCTGTGCATCAATTACACCAATGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGG
AGGAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGCCTCGACCTGCAGCCCTGCATCGACCTCATTGAGAAGCCAGCAG
GCCCCCCGGGCATTCTGGCCCTGCTGGACGAGGAGTGCTGGTTCCCCAAAGCCACCGACAAGAGCTTCGTGGAGAAGGTGATGCAGGAGC
AGGGCACCCACCCCAAGTTCCAGAAGCCCAAGCAGCTGAAGGACAAAGCTGATTTCTGCATTATCCACTATGCCGGCAAGGTGGATTACA
AAGCTGACGAGTGGCTGATGAAGAACATGGATCCCCTGAATGACAACATCGCCACACTGCTCCACCAGTCCTCTGACAAGTTTGTCTCGG
AGCTGTGGAAGGATGTGGACCGCATCATCGGCCTGGACCAGGTGGCCGGCATGTCGGAGACCGCACTGCCCGGGGCCTTCAAGACGCGGA
AGGGCATGTTCCGCACTGTGGGGCAGCTTTACAAGGAGCAGCTGGCCAAGCTGATGGCTACGCTGAGGAACACGAACCCCAACTTTGTCC
GCTGCATCATCCCCAACCACGAGAAGAAGGCCGGCAAGCTGGACCCGCATCTCGTGCTGGACCAGCTGCGCTGCAACGGTGTTCTCGAGG
GCATCCGTATCTGCCGCCAGGGCTTCCCCAACAGGGTGGTCTTCCAGGAGTTTCGGCAGAGATATGAGATCCTGACTCCAAACTCCATTC
CCAAGGGTTTCATGGACGGGAAGCAGGCGTGCGTGCTCATGATAAAAGCCCTGGAGCTCGACAGCAATCTGTACCGCATTGGCCAGAGCA
AAGTCTTCTTCCGTGCCGGTGTGCTGGCCCACCTGGAGGAGGAGCGAGACCTGAAGATCACCGACGTCATCATAGGGTTCCAGGCCTGCT
GCAGGGGCTACCTGGCCAGGAAAGCATTTGCCAAGCGGCAGCAGCAGCTTACCGCCATGAAGGTCCTCCAGCGGAACTGCGCTGCCTACC
TGAAGCTGCGGAACTGGCAGTGGTGGCGGCTCTTCACCAAGGTCAAGCCGCTGCTGCAGGTGAGCCGGCAGGAGGAGGAGATGATGGCCA
AGGAGGAGGAGCTGGTGAAGGTCAGAGAGAAGCAGCTGGCTGCGGAGAACAGGCTCACGGAGATGGAGACGCTGCAGTCTCAGCTCATGG
CAGAGAAATTGCAGCTGCAGGAGCAGCTCCAGGCAGAAACCGAGCTGTGTGCCGAGGCTGAGGAGCTCCGGGCCCGCCTGACCGCCAAGA
AGCAGGAATTAGAAGAGATCTGCCATGACCTAGAGGCCAGGGTGGAGGAGGAGGAGGAGCGCTGCCAGCACCTGCAGGCGGAGAAGAAGA
AGATGCAGCAGAACATCCAGGAGCTTGAGGAGCAGCTGGAGGAGGAGGAGAGCGCCCGGCAGAAGCTGCAGCTGGAGAAGGTGACCACCG
AGGCGAAGCTGAAAAAGCTGGAGGAGGAGCAGATCATCCTGGAGGACCAGAACTGCAAGCTGGCCAAGGAAAAGAAACTGCTGGAAGACA
GAATAGCTGAGTTCACCACCAACCTCACAGAAGAGGAGGAGAAATCTAAGAGCCTCGCCAAGCTCAAGAACAAGCATGAGGCAATGATCA
CTGACTTGGAAGAGCGCCTCCGCAGGGAGGAGAAGCAGCGACAGGAGCTGGAGAAGACCCGCCGGAAGCTGGAGGGAGACTCCACAGACC
TCAGCGACCAGATCGCCGAGCTCCAGGCCCAGATCGCGGAGCTCAAGATGCAGCTGGCCAAGAAAGAGGAGGAGCTCCAGGCCGCCCTGG
CCAGAGTGGAAGAGGAAGCTGCCCAGAAGAACATGGCCCTCAAGAAGATCCGGGAGCTGGAATCTCAGATCTCTGAACTCCAGGAAGACC
TGGAGTCTGAGCGTGCTTCCAGGAATAAAGCTGAGAAGCAGAAACGGGACCTTGGGGAAGAGCTAGAGGCTCTGAAAACAGAGTTGGAGG
ACACGCTGGATTCCACAGCTGCCCAGCAGGAGCTCAGGTCAAAACGTGAGCAGGAGGTGAACATCCTGAAGAAGACCCTGGAGGAGGAGG
CCAAGACCCACGAGGCCCAGATCCAGGAGATGAGGCAGAAGCACTCACAGGCCGTGGAGGAGCTGGCGGAGCAGCTGGAGCAGACGAAGC
GGGTGAAAGCAAACCTCGAGAAGGCAAAGCAGACTCTGGAGAACGAGCGGGGGGAGCTGGCCAACGAGGTGAAGGTGCTGCTGCAGGGCA
AAGGGGACTCGGAGCACAAGCGCAAGAAAGTGGAGGCGCAGCTGCAGGAGCTGCAGGTCAAGTTCAACGAGGGAGAGCGCGTGCGCACAG
AGCTGGCCGACAAGGTCACCAAGCTGCAGGTGGAGCTGGACAACGTGACCGGGCTTCTCAGCCAGTCCGACAGCAAGTCCAGCAAGCTCA
CCAAGGACTTCTCCGCGCTGGAGTCCCAGCTGCAGGACACTCAGGAGCTGCTGCAGGAGGAGAACCGGCAGAAGCTGAGCCTGAGCACCA
AGCTCAAGCAGGTGGAGGACGAGAAGAATTCCTTCCGGGAGCAGCTGGAGGAGGAGGAGGAGGCCAAGCACAACCTGGAGAAGCAGATCG
CCACCCTCCATGCCCAGGTGGCCGACATGAAAAAGAAGATGGAGGACAGTGTGGGGTGCCTGGAAACTGCTGAGGAGGTGAAGAGGAAGC
TCCAGAAGGACCTGGAGGGCCTGAGCCAGCGGCACGAGGAGAAGGTGGCCGCCTACGACAAGCTGGAGAAGACCAAGACGCGGCTGCAGC
AGGAGCTGGACGACCTGCTGGTGGACCTGGACCACCAGCGCCAGAGCGCGTGCAACCTGGAGAAGAAGCAGAAGAAGTTTGACCAGCTCC
TGGCGGAGGAGAAGACCATCTCTGCCAAGTATGCAGAGGAGCGCGACCGGGCTGAGGCGGAGGCCCGAGAGAAGGAGACCAAGGCTCTGT
CGCTGGCCCGGGCCCTGGAGGAAGCCATGGAGCAGAAGGCGGAGCTGGAGCGGCTCAACAAGCAGTTCCGCACGGAGATGGAGGACCTTA
TGAGCTCCAAGGATGATGTGGGCAAGAGTGTCCACGAGCTGGAGAAGTCCAAGCGGGCCCTAGAGCAGCAGGTGGAGGAGATGAAGACGC
AGCTGGAAGAGCTGGAGGACGAGCTGCAGGCCACCGAAGATGCCAAGCTGCGGTTGGAGGTCAACCTGCAGGCCATGAAGGCCCAGTTCG
AGCGGGACCTGCAGGGCCGGGACGAGCAGAGCGAGGAGAAGAAGAAGCAGCTGGTCAGACAGGTGCGGGAGATGGAGGCAGAGCTGGAGG
ACGAGAGGAAGCAGCGCTCGATGGCAGTGGCCGCCCGGAAGAAGCTGGAGATGGACCTGAAGGACCTGGAGGCGCACATCGACTCGGCCA
ACAAGAACCGGGACGAAGCCATCAAACAGCTGCGGAAGCTGCAGGCCCAGATGAAGGACTGCATGCGCGAGCTGGATGACACCCGCGCCT
CTCGTGAGGAGATCCTGGCCCAGGCCAAAGAGAACGAGAAGAAGCTGAAGAGCATGGAGGCCGAGATGATCCAGTTGCAGGAGGAACTGG
CAGCCGCGGAGCGTGCCAAGCGCCAGGCCCAGCAGGAGCGGGATGAGCTGGCTGACGAGATCGCCAACAGCAGCGGCAAAGGAGCCCTGG
CGTTAGAGGAGAAGCGGCGTCTGGAGGCCCGCATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACACGGAGCTGATCAACG
ACCGGCTGAAGAAGGCCAACCTGCAGATCGACCAGATCAACACCGACCTGAACCTGGAGCGCAGCCACGCCCAGAAGAACGAGAATGCTC
GGCAGCAGCTGGAACGCCAGAACAAGGAGCTTAAGGTCAAGCTGCAGGAGATGGAGGGCACTGTCAAGTCCAAGTACAAGGCCTCCATCA
CCGCCCTCGAGGCCAAGATTGCACAGCTGGAGGAGCAGCTGGACAACGAGACCAAGGAGCGCCAGGCAGCCTGCAAACAGGTGCGTCGGA
CCGAGAAGAAGCTGAAGGATGTGCTGCTGCAGGTGGATGACGAGCGGAGGAACGCCGAGCAGTACAAGGACCAGGCCGACAAGGCATCTA
CCCGCCTGAAGCAGCTCAAGCGGCAGCTGGAGGAGGCCGAAGAGGAGGCCCAGCGGGCCAACGCCTCCCGCCGGAAACTGCAGCGCGAGC
TGGAGGACGCCACTGAGACGGCCGATGCCATGAACCGCGAAGTCAGCTCCCTAAAGAACAAGCTCAGGCGCGGGGACCTGCCGTTTGTCG
TGCCCCGCCGAATGGCCCGGAAAGGCGCCGGGGATGGCTCCGACGAAGAGGTAGATGGCAAAGCGGATGGGGCTGAGGCCAAACCTGCCG
AATAAGCCTCTTCTCCTGCAGCCTGAGATGGATGGACAGACAGACACCACAGCCTCCCCTTCCCAGACCCCGCAGCACGCCTCTCCCCAC
CTTCTTGGGACTGCTGTGAACATGCCTCCTCCTGCCCTCCGCCCCGTCCCCCCATCCCGTTTCCCTCCAGGTGTTGTTGAGGGCATTTGG
CTTCCTCTGCTGCATCCCCTTCCAGCTCCCTCCCCTGCTCAGAATCTGATACCAAAGAGACAGGGCCCGGGCCCAGGCAGAGAGCGACCA
GCAGGCTCCTCAGCCCTCTCTTGCCAAAAAGCACAAGATGTTGAGGCGAGCAGGGCAGGCCCCCGGGGAGGGGCCAGAGTTTTCTATGAA
TCTATTTTTCTTCAGACTGAGGCCTTTTGGTAGTCGGAGCCCCCGCAGTCGTCAGCCTCCCTGACGTCTGCCACCAGCGCCCCCACTCCT
CCTCCTTTCTTTGCTGTTTGCAATCACACGTGGTGACCTCACACACCTCTGCCCCTTGGGCCTCCCACTCCCATGGCTCTGGGCGGTCCA
GAAGGAGCAGGCCCTGGGCCTCCACCTCTGTGCAGGGCACAGAAGGCTGGGGTGGGGGGAGGAGTGGATTCCTCCCCACCCTGTCCCAGG
CAGCGCCACTGTCCGCTGTCTCCCTCCTGATTCTAAAATGTCTCAAGTGCAATGCCCCCTCCCCTCCTTTACCGAGGACAGCCTGCCTCT
GCCACAGCAAGGCTGTCGGGGTCAAGCTGGAAAGGCCAGCAGCCTTCCAGTGGCTTCTCCCAACACTCTTGGGGACCAAATATATTTAAT
GGTTAAGGGACTTGTCCCAAGTCTGACAGCCAGAGCGTTAGAGGGGCCAGCGGCCCTCCCAGGCGATCTTGTGTCTACTCTAGGACTGGG
CCCGAGGGTGGTTTACCTGCACCGTTGACTCAGTATAGTTTAAAAATCTGCCACCTGCACAGGTATTTTTGAAAGCAAAATAAGGTTTTC
TTTTTTCCCCTTTCTTGTAATAAATGATAAAATTCCGAGTCTTTCTCACTGCCTTTGTTTAGAAGAGAGTAGCTCGTCCTCACTGGTCTA
CACTGGTTGCCGAATTTACTTGTATTCCTAACTGTTTTGTATATGCTGCATTGAGACTTACGGCAAGAAGGCATTTTTTTTTTTTAAAGG
AAACAAACTCTCAAATCATGAAGTGATATAAAAGCTGCATATGCCTACAAAGCTCTGAATTCAGGTCCCAGTTGCTGTCACAAAGGAGTG
AGTGAAACTCCCACCCTACCCCCTTTTTTATATAATAAAAGTGCCTTAGCATGTGTTGCAGCTGTCACCACTACAGTAAGCTGGTTTACA


Top

FusionGenePPI for CLU_MYH9


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CLUCLU, TGFBR2, MMP25, XRCC6, C8B, C7, C9, LRP2, TGFBR1, SYVN1, H2AFX, COMMD1, NFKB1, NFKBIA, CUL1, BTRC, DISC1, TNIK, GRB2, RAD21, VHL, CHUK, TTR, BAX, CD209, XPO1, ACTN1, ZWINT, KATNA1, KNSTRN, SLC4A1, HBA1, CBY1, ELN, APP, LYZ, ATP7B, ATP7A, BCL2L1, CLUAP1, IL24, HSPD1, PRNP, PON1, FBXO6, PAXIP1, LIG4, MDC1, PDIA3, APOA1, POLR1C, BAG6, CYP2E1, MAPK9, RBBP8, KLF11, RPL23, KEAP1, TSC22D4, FOS, MDM2, CDK19, HSPA1L, NUCB2, TUBB6, TUFM, HSPA5, HSP90B1, HYOU1, UBC, EGFR, RPE, HLA-DPA1, HAX1, CCND3, DPPA4, IL20RB, SUMF2, GPR180, GINM1, SDF4, MMP3, RASSF7, TNF, RNASE13, IFNA5, PLK1, EPPIN, LTF, SEMG1, ADCYAP1R1, SRPK2, CANX, PDGFRA, ARMC6, TUBGCP5, FXR1, SETX, DOCK6, GPAM, ATG3, MAP1LC3A, MCM2, MMP9, VEGFA, SDK2, ATP2B2, PTPRS, TENM3, FAT4, FBXO27, CBWD3, KIAA0355, DHX57, ITGA8, EDEM2, MANEA, DDX31, ARHGAP36, EXTL2, TOR1A, MAN1A1, TNFSF9, PCYOX1L, PTPRF, GNB2, MAN1A2, CELSR1, NLGN2, TXNDC11, INTS5, PCYOX1, MTMR9, OCIAD1, LMAN2L, EIF3FMYH9EPB41, MARK4, ASCC2, MYL9, PRKCE, USP1, USP45, GRB2, RAC1, YWHAZ, EMD, TERF1, TERF2, CBL, PPP2R4, AGO3, YWHAQ, MME, HDAC5, NCOA3, CREBBP, UBE3A, ARRB1, ARRB2, SIRT7, TRAF4, SP1, ISG15, FBXO25, CDK2, CUL1, TRIM72, GRK5, UBASH3B, PIK3R2, SHC1, MYL6, SPTAN1, HSP90AB1, ACTA2, MYH10, HNRNPU, FLNA, ACTR1A, RAB11A, EIF4B, SEL1L, ATP5A1, SEPT7, RALA, HSPA5, TUBA4A, EIF3A, EIF3C, TPM4, MRPS18B, PSME3, HSPA1A, ESR1, TSGA10, EIF4A3, MAGOH, TRAF3IP1, MEN1, HSP90AA1, VCAM1, FN1, IQCB1, ITGA4, PAN2, ACE, ACTB, CSNK2A1, PIK3C3, PPP2CA, CASP4, TARDBP, AKAP10, CDC73, MYH14, OTUD6B, MYL12A, RPA1, RPA2, RPA3, LGR4, IVNS1ABP, TP53, HUWE1, ALK, UBE2I, EED, AMFR, OS9, SYVN1, ATG9A, USP7, HNRNPA1, ATP5L, MYO1E, SRSF5, SSB, NTRK1, ACTA1, ACTG1, ACTN4, ACTN1, AP2A1, AP2B1, ANXA2, APOB, DST, CALD1, CALM1, CALML3, CAPZA1, CAPZA2, CAPZB, CD44, CFL1, CFL2, AP2M1, CLTA, CLTB, CLTC, CPM, DAB2, DAPK3, DBN1, DSG2, CTTN, STOM, EPS15, FLII, FLNB, FYN, GNAI1, GNAI2, GNAS, GNB2, GSN, HIP1, ITPR2, ITPR3, JUP, LGALS1, ABLIM1, LMO7, LSS, LYN, MYO1B, MSN, PDLIM7, ANLN, MYO19, MYO18A, MYLK, MYO1C, MYO5A, MYO5B, MYO6, PPP1R12A, PPP1R12B, NAP1L1, PAWR, PIK3C2A, PLEC, PLS1, PPIA, PPP1CA, PPP1CB, PPP1CC, PSMB10, TWF1, PEX5, RPL22, SIPA1, SORD, SPTBN1, SPTBN2, SSFA2, ST5, SVIL, TCEA2, TMOD1, TNFAIP1, TPM1, TPM2, TPM3, CORO2A, YES1, LUZP1, PICALM, PIP5K1A, SORBS2, IQGAP1, HIP1R, GPRC5A, LRRFIP2, CLINT1, ARHGAP11A, ARHGEF17, SEC16A, WDR1, ARPC4, ARPC3, ARPC1B, ACTR3, ACTR2, ARPC2, BCAP31, FLOT1, BASP1, IMMT, RBPMS, DSTN, TRIOBP, CEP250, AKAP2, TWF2, SYNPO, CEP162, LIMCH1, PALLD, SIPA1L3, MPRIP, COBL, KIF13B, SPECC1L, ATP13A2, MACF1, CORO1C, STX12, GCA, PLEKHG3, RAI14, ZBTB20, AHDC1, PACSIN3, TMOD3, PNMA3, FCF1, CEP83, LIMA1, GTSE1, KDM3B, UACA, CDCA8, BMP2K, UNC45A, MYO5C, GNG12, MUC13, CORO1B, MICAL3, ARHGAP21, SHROOM3, AFAP1, INF2, NARFL, METTL17, AHNAK, EFHD2, CYBRD1, WDR76, DSN1, RNF170, TRIM56, ARPC5L, ANTXR1, LZTS2, PPP1R9B, CEP89, STON2, DOCK7, DIXDC1, SSH2, NEXN, ELMSAN1, SPECC1, CCDC102A, FCHO2, MISP, JMY, CD109, ACTRT1, MYL6B, CCDC50, OARD1, GAS2L3, TTLL6, TPRN, ACTBL2, MCM2, MCM5, SNW1, CDC5L, BOP1, PES1, EGFR, CDH1, C9orf156, MYL3, H2AFY, CYLD, TRIM25, BRCA1, HDAC6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CLU_MYH9


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneCLUP10909DB01593ZincClusterinsmall moleculeapproved|investigational
TgeneMYH9P35579DB11638ArtenimolMyosin-9small moleculeapproved|investigational

Top

RelatedDiseases for CLU_MYH9


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCLUC2609414Acute kidney injury5CTD_human
HgeneCLUC0002395Alzheimer's Disease3CTD_human
HgeneCLUC0022658Kidney Diseases3CTD_human
HgeneCLUC0029408Degenerative polyarthritis2CTD_human
HgeneCLUC0024141Lupus Erythematosus, Systemic1CTD_human
HgeneCLUC0025202melanoma1CTD_human
HgeneCLUC0027686Pathologic Neovascularization1CTD_human
HgeneCLUC0033578Prostatic Neoplasms1CTD_human
HgeneCLUC0036341Schizophrenia1PSYGENET
HgeneCLUC0036572Seizures1CTD_human
HgeneCLUC0041755Adverse reaction to drug1CTD_human
HgeneCLUC0333641Atrophic1CTD_human
HgeneCLUC1862939AMYOTROPHIC LATERAL SCLEROSIS 11CTD_human
HgeneCLUC3495559Juvenile arthritis1CTD_human
HgeneCLUC4277682Chemical and Drug Induced Liver Injury1CTD_human
TgeneMYH9C0403445Fechtner syndrome (disorder)9UNIPROT
TgeneMYH9C0398641Epstein syndrome (disorder)7UNIPROT
TgeneMYH9C0340978May-Hegglin anomaly6UNIPROT
TgeneMYH9C0022661Kidney Failure, Chronic2CTD_human
TgeneMYH9C1854520SEBASTIAN SYNDROME2CTD_human;ORPHANET;UNIPROT
TgeneMYH9C0017668Focal glomerulosclerosis1CTD_human
TgeneMYH9C0020544Renal hypertension1CTD_human
TgeneMYH9C0027706Hereditary nephritis1CTD_human
TgeneMYH9C0036341Schizophrenia1PSYGENET
TgeneMYH9C1863659DEAFNESS, AUTOSOMAL DOMINANT 171UNIPROT
TgeneMYH9C2673482Increased susceptibility to schizophrenia1PSYGENET