FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 7044

FusionGeneSummary for CHEK2_C22orf31

check button Fusion gene summary
Fusion gene informationFusion gene name: CHEK2_C22orf31
Fusion gene ID: 7044
HgeneTgene
Gene symbol

CHEK2

C22orf31

Gene ID

11200

25770

Gene namecheckpoint kinase 2chromosome 22 open reading frame 31
SynonymsCDS1|CHK2|HuCds1|LFS2|PP1425|RAD53|hCds1HS747E2A|bK747E2.1
Cytomap

22q12.1

22q12.1

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase Chk2CHK2 checkpoint homologcds1 homologcheckpoint-like protein CHK2uncharacterized protein C22orf31
Modification date2018052720180519
UniProtAcc

O96017

O95567

Ensembl transtripts involved in fusion geneENST00000382565, ENST00000382578, 
ENST00000382566, ENST00000348295, 
ENST00000544772, ENST00000404276, 
ENST00000328354, ENST00000405598, 
ENST00000382580, ENST00000402731, 
ENST00000403642, ENST00000464581, 
ENST00000216071, 
Fusion gene scores* DoF score2 X 2 X 2=82 X 1 X 2=4
# samples 22
** MAII scorelog2(2/8*10)=1.32192809488736log2(2/4*10)=2.32192809488736
Context

PubMed: CHEK2 [Title/Abstract] AND C22orf31 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
DDR (DNA damage repair) gene involved fusion gene, retained protein feature but frameshift.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCHEK2

GO:0006355

regulation of transcription, DNA-templated

12717439

HgeneCHEK2

GO:0006468

protein phosphorylation

12717439

HgeneCHEK2

GO:0006974

cellular response to DNA damage stimulus

24550317

HgeneCHEK2

GO:0008630

intrinsic apoptotic signaling pathway in response to DNA damage

12402044

HgeneCHEK2

GO:0042770

signal transduction in response to DNA damage

14744935

HgeneCHEK2

GO:0045893

positive regulation of transcription, DNA-templated

17101782

HgeneCHEK2

GO:0046777

protein autophosphorylation

16794575|18644861

HgeneCHEK2

GO:0050821

protein stabilization

12717439


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-NC-A5HD-01ACHEK2chr22

29130391

-C22orf31chr22

29456831

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000382565ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
Frame-shitENST00000382578ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
In-frameENST00000382566ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
Frame-shitENST00000348295ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
5UTR-3CDSENST00000544772ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
In-frameENST00000404276ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
Frame-shitENST00000328354ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
Frame-shitENST00000405598ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
Frame-shitENST00000382580ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
In-frameENST00000402731ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
In-frameENST00000403642ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-
intron-3CDSENST00000464581ENST00000216071CHEK2chr22

29130391

-C22orf31chr22

29456831

-

Top

FusionProtFeatures for CHEK2_C22orf31


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CHEK2

O96017

C22orf31

O95567


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CHEK2_C22orf31


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CHEK2_ENST00000382566_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_396aa
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELTSIPEDQEPEDQEPEEPTP
APWARLWALQDGFANLAPNQCETRPQHPTLWTPTVHLIKYQASGLLCGLTGSHQHLDGQNMCKAEH_CPSTSYHFLLGSCKEPINCQFLL
PG_ACTQAATEE_VLPTTMQVWRRKTLEEIKAQGRFSDESHPAGQEKKLHQFQEQAASRA_EACRRHQRE_RKFKGEKTNSPPRS_GQIC
_TCGCHPSATPGQWDSSLEGPSVAS_NPKETAVVGGHANHPWSPHRGLPGSVPRCGGANAVESFRDPQEVQPGAGQGH_TKALGGSLQSG

>In-frame_CHEK2_ENST00000404276_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_396aa
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELTSIPEDQEPEDQEPEEPTP
APWARLWALQDGFANLAPNQCETRPQHPTLWTPTVHLIKYQASGLLCGLTGSHQHLDGQNMCKAEH_CPSTSYHFLLGSCKEPINCQFLL
PG_ACTQAATEE_VLPTTMQVWRRKTLEEIKAQGRFSDESHPAGQEKKLHQFQEQAASRA_EACRRHQRE_RKFKGEKTNSPPRS_GQIC
_TCGCHPSATPGQWDSSLEGPSVAS_NPKETAVVGGHANHPWSPHRGLPGSVPRCGGANAVESFRDPQEVQPGAGQGH_TKALGGSLQSG

>In-frame_CHEK2_ENST00000402731_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_396aa
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELTSIPEDQEPEDQEPEEPTP
APWARLWALQDGFANLAPNQCETRPQHPTLWTPTVHLIKYQASGLLCGLTGSHQHLDGQNMCKAEH_CPSTSYHFLLGSCKEPINCQFLL
PG_ACTQAATEE_VLPTTMQVWRRKTLEEIKAQGRFSDESHPAGQEKKLHQFQEQAASRA_EACRRHQRE_RKFKGEKTNSPPRS_GQIC
_TCGCHPSATPGQWDSSLEGPSVAS_NPKETAVVGGHANHPWSPHRGLPGSVPRCGGANAVESFRDPQEVQPGAGQGH_TKALGGSLQSG

>In-frame_CHEK2_ENST00000403642_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_396aa
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELTSIPEDQEPEDQEPEEPTP
APWARLWALQDGFANLAPNQCETRPQHPTLWTPTVHLIKYQASGLLCGLTGSHQHLDGQNMCKAEH_CPSTSYHFLLGSCKEPINCQFLL
PG_ACTQAATEE_VLPTTMQVWRRKTLEEIKAQGRFSDESHPAGQEKKLHQFQEQAASRA_EACRRHQRE_RKFKGEKTNSPPRS_GQIC
_TCGCHPSATPGQWDSSLEGPSVAS_NPKETAVVGGHANHPWSPHRGLPGSVPRCGGANAVESFRDPQEVQPGAGQGH_TKALGGSLQSG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CHEK2_ENST00000382566_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_1189nt
ATGTCTCGGGAGTCGGATGTTGAGGCTCAGCAGTCTCATGGCAGCAGTGCCTGTTCACAGCCCCATGGCAGCGTTACCCAGTCCCAAGGC
TCCTCCTCACAGTCCCAGGGCATATCCAGCTCCTCTACCAGCACGATGCCAAACTCCAGCCAGTCCTCTCACTCCAGCTCTGGGACACTG
AGCTCCTTAGAGACAGTGTCCACTCAGGAACTCTATTCTATTCCTGAGGACCAAGAACCTGAGGACCAAGAACCTGAGGAGCCTACCCCT
GCCCCCTGGGCTCGATTATGGGCCCTTCAGGATGGATTTGCCAATCTTGCACCCAATCAATGTGAGACGAGACCCCAGCATCCCTATCTA
TGGACTCCGACAGTCCATCTTATTAAATACCAGGCTTCAGGACTGCTATGTGGACTCACCGGCTCTCACCAACATCTGGATGGCCAGAAC
ATGTGCAAAGCAGAACATTAATGCCCCAGCACCAGCTACCACTTCCTCTTGGGAAGTTGTAAGGAACCCATTAATTGCCAGTTCCTTCTC
CCTGGTTAAGCTTGTACTCAGGCGGCAACTGAAGAATAAGTGCTGCCCACCACCATGCAAGTTTGGAGAAGGAAAACTCTCGAAGAGATT
AAAGCACAAGGACGATTCAGTGATGAAAGCCACCCAGCAGGCCAGGAAAAGAAACTTCATCAGTTCCAAGAGCAAGCAGCCAGCAGGGCA
TAGGAGGCCTGCAGGAGGCATCAGAGAGAGTAAAGAAAGTTCAAAGGAGAAAAAACTAACAGTCCGCCAAGATCTTGAGGACAGATATGC
TGAACATGTGGCTGCCACCCAAGCGCTACCCCAGGACAGTGGGACAGCAGCCTGGAAGGGCCGAGTGTTGCTTCCTGAAACCCAAAAGAG
ACAGCAGTTGTCGGAGGACACGCTAACCATCCATGGTCTCCCCACAGAGGGTTACCAGGCTCTGTACCACGCTGTGGTGGAGCCAATGCT
GTGGAATCCTTCAGGGACCCCCAAGAGGTACAGCCTGGAGCTGGGCAAGGCCATTAAACAAAAGCTCTGGGAGGCTCTTTGCAGTCAGGG
TGCCATCTCTGAAGGTGCTCAGAGGGACCGGTTCCCTGGCAGGAAGCAGCCAGGTGTCCACGAGGAGCCTGTACTCAAGAAATGGCCCAA

>In-frame_CHEK2_ENST00000404276_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_1189nt
ATGTCTCGGGAGTCGGATGTTGAGGCTCAGCAGTCTCATGGCAGCAGTGCCTGTTCACAGCCCCATGGCAGCGTTACCCAGTCCCAAGGC
TCCTCCTCACAGTCCCAGGGCATATCCAGCTCCTCTACCAGCACGATGCCAAACTCCAGCCAGTCCTCTCACTCCAGCTCTGGGACACTG
AGCTCCTTAGAGACAGTGTCCACTCAGGAACTCTATTCTATTCCTGAGGACCAAGAACCTGAGGACCAAGAACCTGAGGAGCCTACCCCT
GCCCCCTGGGCTCGATTATGGGCCCTTCAGGATGGATTTGCCAATCTTGCACCCAATCAATGTGAGACGAGACCCCAGCATCCCTATCTA
TGGACTCCGACAGTCCATCTTATTAAATACCAGGCTTCAGGACTGCTATGTGGACTCACCGGCTCTCACCAACATCTGGATGGCCAGAAC
ATGTGCAAAGCAGAACATTAATGCCCCAGCACCAGCTACCACTTCCTCTTGGGAAGTTGTAAGGAACCCATTAATTGCCAGTTCCTTCTC
CCTGGTTAAGCTTGTACTCAGGCGGCAACTGAAGAATAAGTGCTGCCCACCACCATGCAAGTTTGGAGAAGGAAAACTCTCGAAGAGATT
AAAGCACAAGGACGATTCAGTGATGAAAGCCACCCAGCAGGCCAGGAAAAGAAACTTCATCAGTTCCAAGAGCAAGCAGCCAGCAGGGCA
TAGGAGGCCTGCAGGAGGCATCAGAGAGAGTAAAGAAAGTTCAAAGGAGAAAAAACTAACAGTCCGCCAAGATCTTGAGGACAGATATGC
TGAACATGTGGCTGCCACCCAAGCGCTACCCCAGGACAGTGGGACAGCAGCCTGGAAGGGCCGAGTGTTGCTTCCTGAAACCCAAAAGAG
ACAGCAGTTGTCGGAGGACACGCTAACCATCCATGGTCTCCCCACAGAGGGTTACCAGGCTCTGTACCACGCTGTGGTGGAGCCAATGCT
GTGGAATCCTTCAGGGACCCCCAAGAGGTACAGCCTGGAGCTGGGCAAGGCCATTAAACAAAAGCTCTGGGAGGCTCTTTGCAGTCAGGG
TGCCATCTCTGAAGGTGCTCAGAGGGACCGGTTCCCTGGCAGGAAGCAGCCAGGTGTCCACGAGGAGCCTGTACTCAAGAAATGGCCCAA

>In-frame_CHEK2_ENST00000402731_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_1189nt
ATGTCTCGGGAGTCGGATGTTGAGGCTCAGCAGTCTCATGGCAGCAGTGCCTGTTCACAGCCCCATGGCAGCGTTACCCAGTCCCAAGGC
TCCTCCTCACAGTCCCAGGGCATATCCAGCTCCTCTACCAGCACGATGCCAAACTCCAGCCAGTCCTCTCACTCCAGCTCTGGGACACTG
AGCTCCTTAGAGACAGTGTCCACTCAGGAACTCTATTCTATTCCTGAGGACCAAGAACCTGAGGACCAAGAACCTGAGGAGCCTACCCCT
GCCCCCTGGGCTCGATTATGGGCCCTTCAGGATGGATTTGCCAATCTTGCACCCAATCAATGTGAGACGAGACCCCAGCATCCCTATCTA
TGGACTCCGACAGTCCATCTTATTAAATACCAGGCTTCAGGACTGCTATGTGGACTCACCGGCTCTCACCAACATCTGGATGGCCAGAAC
ATGTGCAAAGCAGAACATTAATGCCCCAGCACCAGCTACCACTTCCTCTTGGGAAGTTGTAAGGAACCCATTAATTGCCAGTTCCTTCTC
CCTGGTTAAGCTTGTACTCAGGCGGCAACTGAAGAATAAGTGCTGCCCACCACCATGCAAGTTTGGAGAAGGAAAACTCTCGAAGAGATT
AAAGCACAAGGACGATTCAGTGATGAAAGCCACCCAGCAGGCCAGGAAAAGAAACTTCATCAGTTCCAAGAGCAAGCAGCCAGCAGGGCA
TAGGAGGCCTGCAGGAGGCATCAGAGAGAGTAAAGAAAGTTCAAAGGAGAAAAAACTAACAGTCCGCCAAGATCTTGAGGACAGATATGC
TGAACATGTGGCTGCCACCCAAGCGCTACCCCAGGACAGTGGGACAGCAGCCTGGAAGGGCCGAGTGTTGCTTCCTGAAACCCAAAAGAG
ACAGCAGTTGTCGGAGGACACGCTAACCATCCATGGTCTCCCCACAGAGGGTTACCAGGCTCTGTACCACGCTGTGGTGGAGCCAATGCT
GTGGAATCCTTCAGGGACCCCCAAGAGGTACAGCCTGGAGCTGGGCAAGGCCATTAAACAAAAGCTCTGGGAGGCTCTTTGCAGTCAGGG
TGCCATCTCTGAAGGTGCTCAGAGGGACCGGTTCCCTGGCAGGAAGCAGCCAGGTGTCCACGAGGAGCCTGTACTCAAGAAATGGCCCAA

>In-frame_CHEK2_ENST00000403642_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_1189nt
ATGTCTCGGGAGTCGGATGTTGAGGCTCAGCAGTCTCATGGCAGCAGTGCCTGTTCACAGCCCCATGGCAGCGTTACCCAGTCCCAAGGC
TCCTCCTCACAGTCCCAGGGCATATCCAGCTCCTCTACCAGCACGATGCCAAACTCCAGCCAGTCCTCTCACTCCAGCTCTGGGACACTG
AGCTCCTTAGAGACAGTGTCCACTCAGGAACTCTATTCTATTCCTGAGGACCAAGAACCTGAGGACCAAGAACCTGAGGAGCCTACCCCT
GCCCCCTGGGCTCGATTATGGGCCCTTCAGGATGGATTTGCCAATCTTGCACCCAATCAATGTGAGACGAGACCCCAGCATCCCTATCTA
TGGACTCCGACAGTCCATCTTATTAAATACCAGGCTTCAGGACTGCTATGTGGACTCACCGGCTCTCACCAACATCTGGATGGCCAGAAC
ATGTGCAAAGCAGAACATTAATGCCCCAGCACCAGCTACCACTTCCTCTTGGGAAGTTGTAAGGAACCCATTAATTGCCAGTTCCTTCTC
CCTGGTTAAGCTTGTACTCAGGCGGCAACTGAAGAATAAGTGCTGCCCACCACCATGCAAGTTTGGAGAAGGAAAACTCTCGAAGAGATT
AAAGCACAAGGACGATTCAGTGATGAAAGCCACCCAGCAGGCCAGGAAAAGAAACTTCATCAGTTCCAAGAGCAAGCAGCCAGCAGGGCA
TAGGAGGCCTGCAGGAGGCATCAGAGAGAGTAAAGAAAGTTCAAAGGAGAAAAAACTAACAGTCCGCCAAGATCTTGAGGACAGATATGC
TGAACATGTGGCTGCCACCCAAGCGCTACCCCAGGACAGTGGGACAGCAGCCTGGAAGGGCCGAGTGTTGCTTCCTGAAACCCAAAAGAG
ACAGCAGTTGTCGGAGGACACGCTAACCATCCATGGTCTCCCCACAGAGGGTTACCAGGCTCTGTACCACGCTGTGGTGGAGCCAATGCT
GTGGAATCCTTCAGGGACCCCCAAGAGGTACAGCCTGGAGCTGGGCAAGGCCATTAAACAAAAGCTCTGGGAGGCTCTTTGCAGTCAGGG
TGCCATCTCTGAAGGTGCTCAGAGGGACCGGTTCCCTGGCAGGAAGCAGCCAGGTGTCCACGAGGAGCCTGTACTCAAGAAATGGCCCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CHEK2_ENST00000382566_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_1331nt
GCAGGTTTAGCGCCACTCTGCTGGCTGAGGCTGCGGAGAGTGTGCGGCTCCAGGTGGGCTCACGCGGTCGTGATGTCTCGGGAGTCGGAT
GTTGAGGCTCAGCAGTCTCATGGCAGCAGTGCCTGTTCACAGCCCCATGGCAGCGTTACCCAGTCCCAAGGCTCCTCCTCACAGTCCCAG
GGCATATCCAGCTCCTCTACCAGCACGATGCCAAACTCCAGCCAGTCCTCTCACTCCAGCTCTGGGACACTGAGCTCCTTAGAGACAGTG
TCCACTCAGGAACTCTATTCTATTCCTGAGGACCAAGAACCTGAGGACCAAGAACCTGAGGAGCCTACCCCTGCCCCCTGGGCTCGATTA
TGGGCCCTTCAGGATGGATTTGCCAATCTTGCACCCAATCAATGTGAGACGAGACCCCAGCATCCCTATCTATGGACTCCGACAGTCCAT
CTTATTAAATACCAGGCTTCAGGACTGCTATGTGGACTCACCGGCTCTCACCAACATCTGGATGGCCAGAACATGTGCAAAGCAGAACAT
TAATGCCCCAGCACCAGCTACCACTTCCTCTTGGGAAGTTGTAAGGAACCCATTAATTGCCAGTTCCTTCTCCCTGGTTAAGCTTGTACT
CAGGCGGCAACTGAAGAATAAGTGCTGCCCACCACCATGCAAGTTTGGAGAAGGAAAACTCTCGAAGAGATTAAAGCACAAGGACGATTC
AGTGATGAAAGCCACCCAGCAGGCCAGGAAAAGAAACTTCATCAGTTCCAAGAGCAAGCAGCCAGCAGGGCATAGGAGGCCTGCAGGAGG
CATCAGAGAGAGTAAAGAAAGTTCAAAGGAGAAAAAACTAACAGTCCGCCAAGATCTTGAGGACAGATATGCTGAACATGTGGCTGCCAC
CCAAGCGCTACCCCAGGACAGTGGGACAGCAGCCTGGAAGGGCCGAGTGTTGCTTCCTGAAACCCAAAAGAGACAGCAGTTGTCGGAGGA
CACGCTAACCATCCATGGTCTCCCCACAGAGGGTTACCAGGCTCTGTACCACGCTGTGGTGGAGCCAATGCTGTGGAATCCTTCAGGGAC
CCCCAAGAGGTACAGCCTGGAGCTGGGCAAGGCCATTAAACAAAAGCTCTGGGAGGCTCTTTGCAGTCAGGGTGCCATCTCTGAAGGTGC
TCAGAGGGACCGGTTCCCTGGCAGGAAGCAGCCAGGTGTCCACGAGGAGCCTGTACTCAAGAAATGGCCCAAGTTAAAGAGCAAAAAATA

>In-frame_CHEK2_ENST00000404276_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_1259nt
ATGTCTCGGGAGTCGGATGTTGAGGCTCAGCAGTCTCATGGCAGCAGTGCCTGTTCACAGCCCCATGGCAGCGTTACCCAGTCCCAAGGC
TCCTCCTCACAGTCCCAGGGCATATCCAGCTCCTCTACCAGCACGATGCCAAACTCCAGCCAGTCCTCTCACTCCAGCTCTGGGACACTG
AGCTCCTTAGAGACAGTGTCCACTCAGGAACTCTATTCTATTCCTGAGGACCAAGAACCTGAGGACCAAGAACCTGAGGAGCCTACCCCT
GCCCCCTGGGCTCGATTATGGGCCCTTCAGGATGGATTTGCCAATCTTGCACCCAATCAATGTGAGACGAGACCCCAGCATCCCTATCTA
TGGACTCCGACAGTCCATCTTATTAAATACCAGGCTTCAGGACTGCTATGTGGACTCACCGGCTCTCACCAACATCTGGATGGCCAGAAC
ATGTGCAAAGCAGAACATTAATGCCCCAGCACCAGCTACCACTTCCTCTTGGGAAGTTGTAAGGAACCCATTAATTGCCAGTTCCTTCTC
CCTGGTTAAGCTTGTACTCAGGCGGCAACTGAAGAATAAGTGCTGCCCACCACCATGCAAGTTTGGAGAAGGAAAACTCTCGAAGAGATT
AAAGCACAAGGACGATTCAGTGATGAAAGCCACCCAGCAGGCCAGGAAAAGAAACTTCATCAGTTCCAAGAGCAAGCAGCCAGCAGGGCA
TAGGAGGCCTGCAGGAGGCATCAGAGAGAGTAAAGAAAGTTCAAAGGAGAAAAAACTAACAGTCCGCCAAGATCTTGAGGACAGATATGC
TGAACATGTGGCTGCCACCCAAGCGCTACCCCAGGACAGTGGGACAGCAGCCTGGAAGGGCCGAGTGTTGCTTCCTGAAACCCAAAAGAG
ACAGCAGTTGTCGGAGGACACGCTAACCATCCATGGTCTCCCCACAGAGGGTTACCAGGCTCTGTACCACGCTGTGGTGGAGCCAATGCT
GTGGAATCCTTCAGGGACCCCCAAGAGGTACAGCCTGGAGCTGGGCAAGGCCATTAAACAAAAGCTCTGGGAGGCTCTTTGCAGTCAGGG
TGCCATCTCTGAAGGTGCTCAGAGGGACCGGTTCCCTGGCAGGAAGCAGCCAGGTGTCCACGAGGAGCCTGTACTCAAGAAATGGCCCAA

>In-frame_CHEK2_ENST00000402731_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_1259nt
ATGTCTCGGGAGTCGGATGTTGAGGCTCAGCAGTCTCATGGCAGCAGTGCCTGTTCACAGCCCCATGGCAGCGTTACCCAGTCCCAAGGC
TCCTCCTCACAGTCCCAGGGCATATCCAGCTCCTCTACCAGCACGATGCCAAACTCCAGCCAGTCCTCTCACTCCAGCTCTGGGACACTG
AGCTCCTTAGAGACAGTGTCCACTCAGGAACTCTATTCTATTCCTGAGGACCAAGAACCTGAGGACCAAGAACCTGAGGAGCCTACCCCT
GCCCCCTGGGCTCGATTATGGGCCCTTCAGGATGGATTTGCCAATCTTGCACCCAATCAATGTGAGACGAGACCCCAGCATCCCTATCTA
TGGACTCCGACAGTCCATCTTATTAAATACCAGGCTTCAGGACTGCTATGTGGACTCACCGGCTCTCACCAACATCTGGATGGCCAGAAC
ATGTGCAAAGCAGAACATTAATGCCCCAGCACCAGCTACCACTTCCTCTTGGGAAGTTGTAAGGAACCCATTAATTGCCAGTTCCTTCTC
CCTGGTTAAGCTTGTACTCAGGCGGCAACTGAAGAATAAGTGCTGCCCACCACCATGCAAGTTTGGAGAAGGAAAACTCTCGAAGAGATT
AAAGCACAAGGACGATTCAGTGATGAAAGCCACCCAGCAGGCCAGGAAAAGAAACTTCATCAGTTCCAAGAGCAAGCAGCCAGCAGGGCA
TAGGAGGCCTGCAGGAGGCATCAGAGAGAGTAAAGAAAGTTCAAAGGAGAAAAAACTAACAGTCCGCCAAGATCTTGAGGACAGATATGC
TGAACATGTGGCTGCCACCCAAGCGCTACCCCAGGACAGTGGGACAGCAGCCTGGAAGGGCCGAGTGTTGCTTCCTGAAACCCAAAAGAG
ACAGCAGTTGTCGGAGGACACGCTAACCATCCATGGTCTCCCCACAGAGGGTTACCAGGCTCTGTACCACGCTGTGGTGGAGCCAATGCT
GTGGAATCCTTCAGGGACCCCCAAGAGGTACAGCCTGGAGCTGGGCAAGGCCATTAAACAAAAGCTCTGGGAGGCTCTTTGCAGTCAGGG
TGCCATCTCTGAAGGTGCTCAGAGGGACCGGTTCCCTGGCAGGAAGCAGCCAGGTGTCCACGAGGAGCCTGTACTCAAGAAATGGCCCAA

>In-frame_CHEK2_ENST00000403642_chr22_29130391_-_C22orf31_ENST00000216071_chr22_29456831_-_1259nt
ATGTCTCGGGAGTCGGATGTTGAGGCTCAGCAGTCTCATGGCAGCAGTGCCTGTTCACAGCCCCATGGCAGCGTTACCCAGTCCCAAGGC
TCCTCCTCACAGTCCCAGGGCATATCCAGCTCCTCTACCAGCACGATGCCAAACTCCAGCCAGTCCTCTCACTCCAGCTCTGGGACACTG
AGCTCCTTAGAGACAGTGTCCACTCAGGAACTCTATTCTATTCCTGAGGACCAAGAACCTGAGGACCAAGAACCTGAGGAGCCTACCCCT
GCCCCCTGGGCTCGATTATGGGCCCTTCAGGATGGATTTGCCAATCTTGCACCCAATCAATGTGAGACGAGACCCCAGCATCCCTATCTA
TGGACTCCGACAGTCCATCTTATTAAATACCAGGCTTCAGGACTGCTATGTGGACTCACCGGCTCTCACCAACATCTGGATGGCCAGAAC
ATGTGCAAAGCAGAACATTAATGCCCCAGCACCAGCTACCACTTCCTCTTGGGAAGTTGTAAGGAACCCATTAATTGCCAGTTCCTTCTC
CCTGGTTAAGCTTGTACTCAGGCGGCAACTGAAGAATAAGTGCTGCCCACCACCATGCAAGTTTGGAGAAGGAAAACTCTCGAAGAGATT
AAAGCACAAGGACGATTCAGTGATGAAAGCCACCCAGCAGGCCAGGAAAAGAAACTTCATCAGTTCCAAGAGCAAGCAGCCAGCAGGGCA
TAGGAGGCCTGCAGGAGGCATCAGAGAGAGTAAAGAAAGTTCAAAGGAGAAAAAACTAACAGTCCGCCAAGATCTTGAGGACAGATATGC
TGAACATGTGGCTGCCACCCAAGCGCTACCCCAGGACAGTGGGACAGCAGCCTGGAAGGGCCGAGTGTTGCTTCCTGAAACCCAAAAGAG
ACAGCAGTTGTCGGAGGACACGCTAACCATCCATGGTCTCCCCACAGAGGGTTACCAGGCTCTGTACCACGCTGTGGTGGAGCCAATGCT
GTGGAATCCTTCAGGGACCCCCAAGAGGTACAGCCTGGAGCTGGGCAAGGCCATTAAACAAAAGCTCTGGGAGGCTCTTTGCAGTCAGGG
TGCCATCTCTGAAGGTGCTCAGAGGGACCGGTTCCCTGGCAGGAAGCAGCCAGGTGTCCACGAGGAGCCTGTACTCAAGAAATGGCCCAA


Top

FusionGenePPI for CHEK2_C22orf31


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CHEK2MSH2, BRCA1, MDC1, PLK3, PLK1, GINS2, VCP, BRCA2, RAD50, TP53BP1, MUS81, CDC25A, MDM2, MDM4, FOXM1, ATR, CDC25C, REV3L, TP53, ATM, AATF, CHEK2, PPP2R2B, PPP2R5A, PPP2R5D, PPP2R5C, PPP2R5E, PPP2R5B, PPP2R1A, PPP2CA, ELAVL1, TRIM28, RNF8, PSME3, LATS2, KAT2B, PML, UBR5, DAPK3, RB1, KPNA2, APP, STRAP, CUL4A, CUL1, PER3, RCHY1, VHL, PRKDC, NR4A1, POLR2L, ARHGAP1, SRPK1, TEX264, SIRT1, CCAR2, ILKAP, MAPK1, MAPK3, BEX1, CCL5, CDH13, CYP17A1, DIRAS3, FAM84B, HOXC6, IL24, ITIH5, KLK7, KLK9, LYPD3, PRDM14, PSMC3IP, RHOBTB2, RNF20, ST14, WHSC1L1, BAALC, ENO1, GNAS, HMGN1, SLC25A6, PRMT2, STMN1, TLR3, SRPK2, FOS, FOXK1, FOXK2, SIAH2, ERBB2, KMT2D, CDK4, TP63, WEE1, CHEK1, CDC6, CDC73, BLM, RFC1, RAD17, FZR1, ATAD5, LLGL1, CDC14A, RPS10, WRN, DAAM1, TTN, BRD4, TUBA1A, PPM1DC22orf31HDAC1, LACRT, HDAC2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CHEK2_C22orf31


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CHEK2_C22orf31


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCHEK2C1836482Li-Fraumeni Syndrome 26CTD_human;UNIPROT
HgeneCHEK2C0376358Malignant neoplasm of prostate4UNIPROT
HgeneCHEK2C1458155Mammary Neoplasms4CTD_human
HgeneCHEK2C0085390Li-Fraumeni Syndrome2CTD_human;ORPHANET
HgeneCHEK2C0006142Malignant neoplasm of breast1UNIPROT
HgeneCHEK2C0009404Colorectal Neoplasms1CTD_human
HgeneCHEK2C0024121Lung Neoplasms1CTD_human
HgeneCHEK2C0024305Lymphoma, Non-Hodgkin1CTD_human
HgeneCHEK2C0027819Neuroblastoma1CTD_human
HgeneCHEK2C0029463Osteosarcoma1CTD_human;HPO;ORPHANET
HgeneCHEK2C0033578Prostatic Neoplasms1CTD_human
HgeneCHEK2C0038356Stomach Neoplasms1CTD_human
HgeneCHEK2C0206720Squamous Cell Neoplasms1CTD_human
HgeneCHEK2C0242788Breast Neoplasms, Male1CTD_human
HgeneCHEK2C2931456Prostate cancer, familial1CTD_human;ORPHANET