FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6843

FusionGeneSummary for CEP85L_ROS1

check button Fusion gene summary
Fusion gene informationFusion gene name: CEP85L_ROS1
Fusion gene ID: 6843
HgeneTgene
Gene symbol

CEP85L

ROS1

Gene ID

387119

6098

Gene namecentrosomal protein 85 likeROS proto-oncogene 1, receptor tyrosine kinase
SynonymsC6orf204|NY-BR-15|bA57K17.2MCF3|ROS|c-ros-1
Cytomap

6q22.31

6q22.1

Type of geneprotein-codingprotein-coding
Descriptioncentrosomal protein of 85 kDa-likecentrosomal protein 85kDa-likeserologically defined breast cancer antigen NY-BR-15proto-oncogene tyrosine-protein kinase ROSROS proto-oncogene 1 , receptor tyrosine kinasec-ros oncogene 1 , receptor tyrosine kinaseproto-oncogene c-Ros-1transmembrane tyrosine-specific protein kinasev-ros avian UR2 sarcoma virus oncogene homolog 1
Modification date2018052320180523
UniProtAcc

Q5SZL2

P08922

Ensembl transtripts involved in fusion geneENST00000368491, ENST00000368488, 
ENST00000360290, ENST00000392500, 
ENST00000419517, ENST00000472713, 
ENST00000368508, ENST00000368507, 
Fusion gene scores* DoF score5 X 5 X 2=505 X 6 X 3=90
# samples 612
** MAII scorelog2(6/50*10)=0.263034405833794
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(12/90*10)=0.415037499278844
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CEP85L [Title/Abstract] AND ROS1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneROS1

GO:0001558

regulation of cell growth

16885344

TgeneROS1

GO:0006468

protein phosphorylation

16885344

TgeneROS1

GO:0032006

regulation of TOR signaling

16885344


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDGBMTCGA-06-5418-01ACEP85Lchr6

118802942

-ROS1chr6

117641193

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000368491ENST00000368508CEP85Lchr6

118802942

-ROS1chr6

117641193

-
In-frameENST00000368491ENST00000368507CEP85Lchr6

118802942

-ROS1chr6

117641193

-
Frame-shitENST00000368488ENST00000368508CEP85Lchr6

118802942

-ROS1chr6

117641193

-
Frame-shitENST00000368488ENST00000368507CEP85Lchr6

118802942

-ROS1chr6

117641193

-
intron-3CDSENST00000360290ENST00000368508CEP85Lchr6

118802942

-ROS1chr6

117641193

-
intron-3CDSENST00000360290ENST00000368507CEP85Lchr6

118802942

-ROS1chr6

117641193

-
intron-3CDSENST00000392500ENST00000368508CEP85Lchr6

118802942

-ROS1chr6

117641193

-
intron-3CDSENST00000392500ENST00000368507CEP85Lchr6

118802942

-ROS1chr6

117641193

-
intron-3CDSENST00000419517ENST00000368508CEP85Lchr6

118802942

-ROS1chr6

117641193

-
intron-3CDSENST00000419517ENST00000368507CEP85Lchr6

118802942

-ROS1chr6

117641193

-
intron-3CDSENST00000472713ENST00000368508CEP85Lchr6

118802942

-ROS1chr6

117641193

-
intron-3CDSENST00000472713ENST00000368507CEP85Lchr6

118802942

-ROS1chr6

117641193

-

Top

FusionProtFeatures for CEP85L_ROS1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CEP85L

Q5SZL2

ROS1

P08922

Orphan receptor tyrosine kinase (RTK) that plays a rolein epithelial cell differentiation and regionalization of theproximal epididymal epithelium. May activate several downstreamsignaling pathways related to cell differentiation, proliferation,growth and survival including the PI3 kinase-mTOR signalingpathway. Mediates the phosphorylation of PTPN11, an activator ofthis pathway. May also phosphorylate and activate thetranscription factor STAT3 to control anchorage-independent cellgrowth. Mediates the phosphorylation and the activation of VAV3, aguanine nucleotide exchange factor regulating cell morphology. Mayactivate other downstream signaling proteins including AKT1,MAPK1, MAPK3, IRS1 and PLCG2. {ECO:0000269|PubMed:11094073,ECO:0000269|PubMed:16885344}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-34431945_222219252348DomainProtein kinase
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-34431951_195919252348Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCEP85Lchr6:118802942chr6:117641193ENST00000360290-16439_682-117395Coiled coilOntology_term=ECO:0000255
HgeneCEP85Lchr6:118802942chr6:117641193ENST00000368488-914439_682584809Coiled coilOntology_term=ECO:0000255
HgeneCEP85Lchr6:118802942chr6:117641193ENST00000368491-813439_682581806Coiled coilOntology_term=ECO:0000255
HgeneCEP85Lchr6:118802942chr6:117641193ENST00000392500-18439_682-57500Coiled coilOntology_term=ECO:0000255
HgeneCEP85Lchr6:118802942chr6:117641193ENST00000419517-16439_682-196497Coiled coilOntology_term=ECO:0000255
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-3443101_19619252348DomainFibronectin type-III 1
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-34431043_115019252348DomainFibronectin type-III 5
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-34431450_155619252348DomainFibronectin type-III 6
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-34431557_165619252348DomainFibronectin type-III 7
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-34431658_175119252348DomainFibronectin type-III 8
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-34431752_185419252348DomainFibronectin type-III 9
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-3443197_28519252348DomainFibronectin type-III 2
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-3443557_67119252348DomainFibronectin type-III 3
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-3443947_104219252348DomainFibronectin type-III 4
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-34431883_234719252348Topological domainCytoplasmic
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-344328_185919252348Topological domainExtracellular
TgeneROS1chr6:118802942chr6:117641193ENST00000368508-34431860_188219252348TransmembraneHelical


Top

FusionGeneSequence for CEP85L_ROS1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CEP85L_ENST00000368491_chr6_118802942_-_ROS1_ENST00000368508_chr6_117641193_-_1004aa
MWGRFLAPEASGRDSPGGARSFPAGPDTSSAWLPANESLWQATTVPSNHRNNHIRRHSIASDSGDTGIGTSCSDSVEDHSTSSGTLSFKP
SQSLITLPTAHVMPSNSSASISKLRESLTPDGSKWSTSLMQTLGNHSRGEQDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESR
NGLEKIGKAKALTSQLRTIGPSCLHDSMEMLRLEDKEINKKRSSTLDCKTKFESCSKEDFRASSSTLRRQPVDMTTSALPESKPIMTSSE
AFEPPKTLMLGQQAVGGVPIQPSVRTQMWLTEQLRTNPLEGRNTEDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSTSPGTQDFSKW
ESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHTVNCEDSTVASLQPQTENTSLQTPFSEESVSHSQQGEFEQKLAS
TEKEVLQLNEFLKQRLSLFSEEKKKLEEKLKTRDRYISSLKKKCQKESEQNKEKQRRIETLEKTLADLPTLDDVQSQSLQLQILEEKNKN
LQEALIDTEKKLEEIKKQCQDKETQLICQKKKEKELVTTVQSTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVTEGTAVDILGVGSGE
IKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTTLRKARMATFTGPLLTLVDLVDLCVDIS
KGCVYLERMHFIHRDLAARNCLVSVKDTTSPRIVKIGDFGLARDITKNDYTRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEI
LTLGHQPTPAHSNLDVLNTVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSITKSRDEANNSGVINESFE
GEDGDVICLNSDDIMPVALMETKNREGLNTMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGLNT

>In-frame_CEP85L_ENST00000368491_chr6_118802942_-_ROS1_ENST00000368507_chr6_117641193_-_1004aa
MWGRFLAPEASGRDSPGGARSFPAGPDTSSAWLPANESLWQATTVPSNHRNNHIRRHSIASDSGDTGIGTSCSDSVEDHSTSSGTLSFKP
SQSLITLPTAHVMPSNSSASISKLRESLTPDGSKWSTSLMQTLGNHSRGEQDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESR
NGLEKIGKAKALTSQLRTIGPSCLHDSMEMLRLEDKEINKKRSSTLDCKTKFESCSKEDFRASSSTLRRQPVDMTTSALPESKPIMTSSE
AFEPPKTLMLGQQAVGGVPIQPSVRTQMWLTEQLRTNPLEGRNTEDSYSLAPWQQQQIEDFRQGSETPMQVLTGSSRQSTSPGTQDFSKW
ESMLKIKEGLLRQKEIVIDRQKQQITHLHERIRDNELRAQHAMLGHTVNCEDSTVASLQPQTENTSLQTPFSEESVSHSQQGEFEQKLAS
TEKEVLQLNEFLKQRLSLFSEEKKKLEEKLKTRDRYISSLKKKCQKESEQNKEKQRRIETLEKTLADLPTLDDVQSQSLQLQILEEKNKN
LQEALIDTEKKLEEIKKQCQDKETQLICQKKKEKELVTTVQSTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVTEGTAVDILGVGSGE
IKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTTLRKARMATFTGPLLTLVDLVDLCVDIS
KGCVYLERMHFIHRDLAARNCLVSVKDTTSPRIVKIGDFGLARDITKNDYTRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEI
LTLGHQPTPAHSNLDVLNTVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSITKSRDEANNSGVINESFE
GEDGDVICLNSDDIMPVALMETKNREGLNTMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGLNT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CEP85L_ENST00000368491_chr6_118802942_-_ROS1_ENST00000368508_chr6_117641193_-_3012nt
ATGTGGGGGCGCTTCCTGGCTCCGGAGGCCAGCGGCCGGGATAGCCCCGGCGGAGCCCGCAGCTTCCCTGCCGGCCCAGATTATTCATCA
GCATGGCTACCTGCTAATGAATCATTGTGGCAGGCCACAACTGTTCCATCTAACCATCGAAATAACCATATCAGGAGACACAGTATAGCT
TCTGACAGTGGAGACACTGGCATTGGAACTTCCTGTTCTGATAGCGTGGAAGATCATTCAACTTCAAGTGGCACATTATCTTTTAAGCCT
AGTCAATCATTGATTACTCTTCCTACTGCCCATGTGATGCCGTCTAATTCCAGCGCTTCAATTTCCAAACTTAGGGAATCATTGACACCA
GATGGCTCAAAATGGAGTACAAGCCTCATGCAAACATTGGGAAACCACAGTAGGGGGGAGCAGGACTCTTCCCTAGACATGAAGGACTTC
CGGCCACTTCGGAAATGGTCATCTTTATCCAAACTCACTGCCCCGGATAACTGTGGCCAGGGTGGCACTGTATGCAGAGAAGAGTCAAGG
AATGGTTTGGAGAAGATAGGGAAGGCTAAGGCTTTAACATCACAACTGAGGACAATTGGGCCTAGCTGTTTACATGATAGTATGGAGATG
CTTAGGTTAGAGGACAAGGAAATAAATAAAAAACGGTCATCAACTCTGGACTGCAAGTATAAATTTGAGAGCTGTAGCAAGGAGGACTTT
AGAGCCTCTTCCTCTACTCTTAGGAGACAGCCTGTAGACATGACATATAGTGCCTTACCTGAAAGCAAGCCCATTATGACAAGCTCAGAG
GCTTTTGAACCTCCAAAATATTTAATGCTTGGTCAACAGGCAGTAGGTGGAGTTCCCATTCAGCCTTCCGTAAGGACTCAGATGTGGCTT
ACAGAGCAGCTGCGGACAAATCCTTTGGAAGGTAGAAATACAGAGGATTCTTACAGTTTAGCTCCTTGGCAACAGCAGCAAATTGAAGAC
TTTCGACAAGGAAGTGAAACACCAATGCAGGTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGTAAGTGG
GAATCAATGTTGAAAATAAAAGAAGGACTTCTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTGCATGAG
AGGATAAGGGATAATGAATTACGGGCTCAACATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTGCAGCCA
CAATATGAGAACACTTCACTCCAGACACCATTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTTGCATCT
ACTGAGAAAGAAGTTTTACAGCTTAATGAGTTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAAAAACTT
AAAACTAGAGATCGATACATCAGTAGTCTGAAAAAGAAATGCCAGAAGGAATCTGAACAAAACAAAGAAAAGCAGAGAAGAATTGAGACC
TTGGAAAAGTATCTGGCTGATCTTCCAACTCTAGATGATGTACAGAGTCAGAGTCTACAGCTGCAGATTCTGGAAGAAAAAAATAAGAAT
TTACAAGAGGCTTTGATAGATACAGAAAAAAAACTTGAAGAGATCAAAAAGCAGTGTCAAGATAAAGAGACACAGTTAATATGCCAGAAA
AAGAAAGAAAAGGAGTTAGTAACTACCGTTCAGAGTACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAA
CTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAA
ATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTT
AATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTT
CTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCA
AAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGT
CCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCA
GTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATT
TTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGA
AATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAA
CTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAA
GGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTAT
ATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAA
GAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTAT

>In-frame_CEP85L_ENST00000368491_chr6_118802942_-_ROS1_ENST00000368507_chr6_117641193_-_3012nt
ATGTGGGGGCGCTTCCTGGCTCCGGAGGCCAGCGGCCGGGATAGCCCCGGCGGAGCCCGCAGCTTCCCTGCCGGCCCAGATTATTCATCA
GCATGGCTACCTGCTAATGAATCATTGTGGCAGGCCACAACTGTTCCATCTAACCATCGAAATAACCATATCAGGAGACACAGTATAGCT
TCTGACAGTGGAGACACTGGCATTGGAACTTCCTGTTCTGATAGCGTGGAAGATCATTCAACTTCAAGTGGCACATTATCTTTTAAGCCT
AGTCAATCATTGATTACTCTTCCTACTGCCCATGTGATGCCGTCTAATTCCAGCGCTTCAATTTCCAAACTTAGGGAATCATTGACACCA
GATGGCTCAAAATGGAGTACAAGCCTCATGCAAACATTGGGAAACCACAGTAGGGGGGAGCAGGACTCTTCCCTAGACATGAAGGACTTC
CGGCCACTTCGGAAATGGTCATCTTTATCCAAACTCACTGCCCCGGATAACTGTGGCCAGGGTGGCACTGTATGCAGAGAAGAGTCAAGG
AATGGTTTGGAGAAGATAGGGAAGGCTAAGGCTTTAACATCACAACTGAGGACAATTGGGCCTAGCTGTTTACATGATAGTATGGAGATG
CTTAGGTTAGAGGACAAGGAAATAAATAAAAAACGGTCATCAACTCTGGACTGCAAGTATAAATTTGAGAGCTGTAGCAAGGAGGACTTT
AGAGCCTCTTCCTCTACTCTTAGGAGACAGCCTGTAGACATGACATATAGTGCCTTACCTGAAAGCAAGCCCATTATGACAAGCTCAGAG
GCTTTTGAACCTCCAAAATATTTAATGCTTGGTCAACAGGCAGTAGGTGGAGTTCCCATTCAGCCTTCCGTAAGGACTCAGATGTGGCTT
ACAGAGCAGCTGCGGACAAATCCTTTGGAAGGTAGAAATACAGAGGATTCTTACAGTTTAGCTCCTTGGCAACAGCAGCAAATTGAAGAC
TTTCGACAAGGAAGTGAAACACCAATGCAGGTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGTAAGTGG
GAATCAATGTTGAAAATAAAAGAAGGACTTCTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTGCATGAG
AGGATAAGGGATAATGAATTACGGGCTCAACATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTGCAGCCA
CAATATGAGAACACTTCACTCCAGACACCATTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTTGCATCT
ACTGAGAAAGAAGTTTTACAGCTTAATGAGTTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAAAAACTT
AAAACTAGAGATCGATACATCAGTAGTCTGAAAAAGAAATGCCAGAAGGAATCTGAACAAAACAAAGAAAAGCAGAGAAGAATTGAGACC
TTGGAAAAGTATCTGGCTGATCTTCCAACTCTAGATGATGTACAGAGTCAGAGTCTACAGCTGCAGATTCTGGAAGAAAAAAATAAGAAT
TTACAAGAGGCTTTGATAGATACAGAAAAAAAACTTGAAGAGATCAAAAAGCAGTGTCAAGATAAAGAGACACAGTTAATATGCCAGAAA
AAGAAAGAAAAGGAGTTAGTAACTACCGTTCAGAGTACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAA
CTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAA
ATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTT
AATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTT
CTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCA
AAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGT
CCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCA
GTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATT
TTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGA
AATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAA
CTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAA
GGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTAT
ATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAA
GAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CEP85L_ENST00000368491_chr6_118802942_-_ROS1_ENST00000368508_chr6_117641193_-_3826nt
GGGAGGGCGTGAGGGATTACCCAAGGGAGGGGCGAGTATCGCAAAATAGGCCAAGTCGCTGCCCTCTACTCAACTCGCAGGGCGGGAGGA
TGGAGACAGAGGGATGCGGCGGGAGGGCGGGACAGCCCAGTCGCCGCCAAGGAGGCGAAGCGGGGTCGGGGTAGCTCACCCGCCCCCCGC
AGTCCCCGCCCCCCGCAGTCCCCGCCCCGCGCGGCGCCGCGCACGCCTGAAGTCATTGCCCGAGGCCCCGCCCCCTCGCGGCCCCAGCCC
CGGCTCTGGCTCTGCCGGCGGAGGGGGCGGAGAGAACCCGCAGCTGCAACTTCGCCTGGAGCCTTTGAGCCTGGGCTCAGCCGGGGATCT
AGCAGCCGTCACCGCCGAGTCGCCGCTTCCCCGGCGCGGGCCTCAGCCCAGCCGGCTTGGCCATGGCAGGCGCCGGCAGTGCGGCGAATC
TGGCCCCTGCGCTCCCCGCCCGTAGCTGAGCAGCCGTTAACCAGCCATCCCGCCTTTCCTCCTGCCCGTGTCGCCGAGGCCCACGCTCCG
CGCAAGTTTCCGCCGCCGAAGAAGCAGGAGGACGGACGTGAGGAGTCGGGCGTCCCTGGCCCACCCGGCCCTCTCGCCCGCGATGTGGGG
GCGCTTCCTGGCTCCGGAGGCCAGCGGCCGGGATAGCCCCGGCGGAGCCCGCAGCTTCCCTGCCGGCCCAGATTATTCATCAGCATGGCT
ACCTGCTAATGAATCATTGTGGCAGGCCACAACTGTTCCATCTAACCATCGAAATAACCATATCAGGAGACACAGTATAGCTTCTGACAG
TGGAGACACTGGCATTGGAACTTCCTGTTCTGATAGCGTGGAAGATCATTCAACTTCAAGTGGCACATTATCTTTTAAGCCTAGTCAATC
ATTGATTACTCTTCCTACTGCCCATGTGATGCCGTCTAATTCCAGCGCTTCAATTTCCAAACTTAGGGAATCATTGACACCAGATGGCTC
AAAATGGAGTACAAGCCTCATGCAAACATTGGGAAACCACAGTAGGGGGGAGCAGGACTCTTCCCTAGACATGAAGGACTTCCGGCCACT
TCGGAAATGGTCATCTTTATCCAAACTCACTGCCCCGGATAACTGTGGCCAGGGTGGCACTGTATGCAGAGAAGAGTCAAGGAATGGTTT
GGAGAAGATAGGGAAGGCTAAGGCTTTAACATCACAACTGAGGACAATTGGGCCTAGCTGTTTACATGATAGTATGGAGATGCTTAGGTT
AGAGGACAAGGAAATAAATAAAAAACGGTCATCAACTCTGGACTGCAAGTATAAATTTGAGAGCTGTAGCAAGGAGGACTTTAGAGCCTC
TTCCTCTACTCTTAGGAGACAGCCTGTAGACATGACATATAGTGCCTTACCTGAAAGCAAGCCCATTATGACAAGCTCAGAGGCTTTTGA
ACCTCCAAAATATTTAATGCTTGGTCAACAGGCAGTAGGTGGAGTTCCCATTCAGCCTTCCGTAAGGACTCAGATGTGGCTTACAGAGCA
GCTGCGGACAAATCCTTTGGAAGGTAGAAATACAGAGGATTCTTACAGTTTAGCTCCTTGGCAACAGCAGCAAATTGAAGACTTTCGACA
AGGAAGTGAAACACCAATGCAGGTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGTAAGTGGGAATCAAT
GTTGAAAATAAAAGAAGGACTTCTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTGCATGAGAGGATAAG
GGATAATGAATTACGGGCTCAACATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTGCAGCCACAATATGA
GAACACTTCACTCCAGACACCATTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTTGCATCTACTGAGAA
AGAAGTTTTACAGCTTAATGAGTTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAAAAACTTAAAACTAG
AGATCGATACATCAGTAGTCTGAAAAAGAAATGCCAGAAGGAATCTGAACAAAACAAAGAAAAGCAGAGAAGAATTGAGACCTTGGAAAA
GTATCTGGCTGATCTTCCAACTCTAGATGATGTACAGAGTCAGAGTCTACAGCTGCAGATTCTGGAAGAAAAAAATAAGAATTTACAAGA
GGCTTTGATAGATACAGAAAAAAAACTTGAAGAGATCAAAAAGCAGTGTCAAGATAAAGAGACACAGTTAATATGCCAGAAAAAGAAAGA
AAAGGAGTTAGTAACTACCGTTCAGAGTACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCT
GCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGT
AGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCC
CAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTA
TTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTG
TGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGAT
AGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTG
GATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCT
TGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCC
TGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTT
ATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGA
TGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACT
TGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAA
GGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCT
CACTCACAGTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTG
AAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTG

>In-frame_CEP85L_ENST00000368491_chr6_118802942_-_ROS1_ENST00000368507_chr6_117641193_-_3826nt
GGGAGGGCGTGAGGGATTACCCAAGGGAGGGGCGAGTATCGCAAAATAGGCCAAGTCGCTGCCCTCTACTCAACTCGCAGGGCGGGAGGA
TGGAGACAGAGGGATGCGGCGGGAGGGCGGGACAGCCCAGTCGCCGCCAAGGAGGCGAAGCGGGGTCGGGGTAGCTCACCCGCCCCCCGC
AGTCCCCGCCCCCCGCAGTCCCCGCCCCGCGCGGCGCCGCGCACGCCTGAAGTCATTGCCCGAGGCCCCGCCCCCTCGCGGCCCCAGCCC
CGGCTCTGGCTCTGCCGGCGGAGGGGGCGGAGAGAACCCGCAGCTGCAACTTCGCCTGGAGCCTTTGAGCCTGGGCTCAGCCGGGGATCT
AGCAGCCGTCACCGCCGAGTCGCCGCTTCCCCGGCGCGGGCCTCAGCCCAGCCGGCTTGGCCATGGCAGGCGCCGGCAGTGCGGCGAATC
TGGCCCCTGCGCTCCCCGCCCGTAGCTGAGCAGCCGTTAACCAGCCATCCCGCCTTTCCTCCTGCCCGTGTCGCCGAGGCCCACGCTCCG
CGCAAGTTTCCGCCGCCGAAGAAGCAGGAGGACGGACGTGAGGAGTCGGGCGTCCCTGGCCCACCCGGCCCTCTCGCCCGCGATGTGGGG
GCGCTTCCTGGCTCCGGAGGCCAGCGGCCGGGATAGCCCCGGCGGAGCCCGCAGCTTCCCTGCCGGCCCAGATTATTCATCAGCATGGCT
ACCTGCTAATGAATCATTGTGGCAGGCCACAACTGTTCCATCTAACCATCGAAATAACCATATCAGGAGACACAGTATAGCTTCTGACAG
TGGAGACACTGGCATTGGAACTTCCTGTTCTGATAGCGTGGAAGATCATTCAACTTCAAGTGGCACATTATCTTTTAAGCCTAGTCAATC
ATTGATTACTCTTCCTACTGCCCATGTGATGCCGTCTAATTCCAGCGCTTCAATTTCCAAACTTAGGGAATCATTGACACCAGATGGCTC
AAAATGGAGTACAAGCCTCATGCAAACATTGGGAAACCACAGTAGGGGGGAGCAGGACTCTTCCCTAGACATGAAGGACTTCCGGCCACT
TCGGAAATGGTCATCTTTATCCAAACTCACTGCCCCGGATAACTGTGGCCAGGGTGGCACTGTATGCAGAGAAGAGTCAAGGAATGGTTT
GGAGAAGATAGGGAAGGCTAAGGCTTTAACATCACAACTGAGGACAATTGGGCCTAGCTGTTTACATGATAGTATGGAGATGCTTAGGTT
AGAGGACAAGGAAATAAATAAAAAACGGTCATCAACTCTGGACTGCAAGTATAAATTTGAGAGCTGTAGCAAGGAGGACTTTAGAGCCTC
TTCCTCTACTCTTAGGAGACAGCCTGTAGACATGACATATAGTGCCTTACCTGAAAGCAAGCCCATTATGACAAGCTCAGAGGCTTTTGA
ACCTCCAAAATATTTAATGCTTGGTCAACAGGCAGTAGGTGGAGTTCCCATTCAGCCTTCCGTAAGGACTCAGATGTGGCTTACAGAGCA
GCTGCGGACAAATCCTTTGGAAGGTAGAAATACAGAGGATTCTTACAGTTTAGCTCCTTGGCAACAGCAGCAAATTGAAGACTTTCGACA
AGGAAGTGAAACACCAATGCAGGTTTTGACTGGATCATCTCGTCAAAGTTATTCACCTGGCTATCAGGATTTCAGTAAGTGGGAATCAAT
GTTGAAAATAAAAGAAGGACTTCTAAGGCAGAAAGAAATTGTAATCGATCGGCAGAAGCAACAAATTACCCACCTGCATGAGAGGATAAG
GGATAATGAATTACGGGCTCAACATGCCATGTTAGGACATTATGTAAATTGTGAGGATTCTTATGTGGCTAGTTTGCAGCCACAATATGA
GAACACTTCACTCCAGACACCATTTTCAGAGGAATCAGTTTCCCATTCCCAACAAGGGGAATTTGAGCAAAAGCTTGCATCTACTGAGAA
AGAAGTTTTACAGCTTAATGAGTTTCTCAAACAAAGACTAAGCCTATTTAGTGAAGAGAAGAAGAAACTAGAGGAAAAACTTAAAACTAG
AGATCGATACATCAGTAGTCTGAAAAAGAAATGCCAGAAGGAATCTGAACAAAACAAAGAAAAGCAGAGAAGAATTGAGACCTTGGAAAA
GTATCTGGCTGATCTTCCAACTCTAGATGATGTACAGAGTCAGAGTCTACAGCTGCAGATTCTGGAAGAAAAAAATAAGAATTTACAAGA
GGCTTTGATAGATACAGAAAAAAAACTTGAAGAGATCAAAAAGCAGTGTCAAGATAAAGAGACACAGTTAATATGCCAGAAAAAGAAAGA
AAAGGAGTTAGTAACTACCGTTCAGAGTACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCT
GCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGT
AGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCC
CAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTA
TTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTG
TGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGAT
AGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTG
GATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCT
TGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCC
TGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTT
ATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGA
TGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACT
TGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAA
GGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCT
CACTCACAGTGGATATGGAGATGGGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTG
AAAGAAAACTCTGCTAGAATGATAAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTG


Top

FusionGenePPI for CEP85L_ROS1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CEP85LMARK2, ITSN1, CEP128, CNTRL, KLHL40, PHKG2, PIGTROS1PTPN6, PTPN11, VAV3, IKBKG, GRB2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CEP85L_ROS1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CEP85L_ROS1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneROS1C0007131Non-Small Cell Lung Carcinoma4CTD_human
TgeneROS1C0017638Glioma1CTD_human
TgeneROS1C0025202melanoma1CTD_human
TgeneROS1C0152013Adenocarcinoma of lung (disorder)1CTD_human