FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 663

FusionGeneSummary for ACY1_BAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: ACY1_BAP1
Fusion gene ID: 663
HgeneTgene
Gene symbol

ACY1

BAP1

Gene ID

95

9223

Gene nameaminoacylase 1membrane associated guanylate kinase, WW and PDZ domain containing 1
SynonymsACY-1|ACY1D|HEL-S-5AIP-3|AIP3|BAIAP1|BAP-1|BAP1|MAGI-1|Magi1d|TNRC19|WWP3
Cytomap

3p21.2

3p14.1

Type of geneprotein-codingprotein-coding
Descriptionaminoacylase-1N-acyl-L-amino-acid amidohydrolaseacylaseepididymis secretory protein Li 5membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1BAI1-associated protein 1WW domain-containing protein 3atrophin-1-interacting protein 3membrane-associated guanylate kinase inverted 1trinucleotide repeat-containing gene 19
Modification date2018052320180519
UniProtAcc

Q03154

Q92560

Ensembl transtripts involved in fusion geneENST00000458031, ENST00000494103, 
ENST00000476854, ENST00000476351, 
ENST00000404366, ENST00000468068, 
ENST00000460680, ENST00000296288, 
Fusion gene scores* DoF score2 X 2 X 2=83 X 3 X 2=18
# samples 23
** MAII scorelog2(2/8*10)=1.32192809488736log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ACY1 [Title/Abstract] AND BAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDMESOTCGA-LK-A4O5-01AACY1chr3

52021640

+BAP1chr3

52441476

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000458031ENST00000460680ACY1chr3

52021640

+BAP1chr3

52441476

-
In-frameENST00000458031ENST00000296288ACY1chr3

52021640

+BAP1chr3

52441476

-
In-frameENST00000494103ENST00000460680ACY1chr3

52021640

+BAP1chr3

52441476

-
In-frameENST00000494103ENST00000296288ACY1chr3

52021640

+BAP1chr3

52441476

-
In-frameENST00000476854ENST00000460680ACY1chr3

52021640

+BAP1chr3

52441476

-
In-frameENST00000476854ENST00000296288ACY1chr3

52021640

+BAP1chr3

52441476

-
In-frameENST00000476351ENST00000460680ACY1chr3

52021640

+BAP1chr3

52441476

-
In-frameENST00000476351ENST00000296288ACY1chr3

52021640

+BAP1chr3

52441476

-
In-frameENST00000404366ENST00000460680ACY1chr3

52021640

+BAP1chr3

52441476

-
In-frameENST00000404366ENST00000296288ACY1chr3

52021640

+BAP1chr3

52441476

-
intron-3CDSENST00000468068ENST00000460680ACY1chr3

52021640

+BAP1chr3

52441476

-
intron-3CDSENST00000468068ENST00000296288ACY1chr3

52021640

+BAP1chr3

52441476

-

Top

FusionProtFeatures for ACY1_BAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACY1

Q03154

BAP1

Q92560

Involved in the hydrolysis of N-acylated or N-acetylatedamino acids (except L-aspartate). {ECO:0000269|PubMed:12933810}. Deubiquitinating enzyme that plays a key role inchromatin by mediating deubiquitination of histone H2A and HCFC1.Catalytic component of the PR-DUB complex, a complex thatspecifically mediates deubiquitination of histone H2Amonoubiquitinated at 'Lys-119' (H2AK119ub1). Does notdeubiquitinate monoubiquitinated histone H2B. Acts as a regulatorof cell growth by mediating deubiquitination of HCFC1 N-terminaland C-terminal chains, with some specificity toward 'Lys-48'-linked polyubiquitin chains compared to 'Lys-63'-linkedpolyubiquitin chains. Deubiquitination of HCFC1 does not lead toincrease stability of HCFC1. Interferes with the BRCA1 and BARD1heterodimer activity by inhibiting their ability to mediateubiquitination and autoubiquitination. It however does not mediatedeubiquitination of BRCA1 and BARD1. Able to mediateautodeubiquitination via intramolecular interactions to couteractmonoubiquitination at the nuclear localization signal (NLS),thereby protecting it from cytoplasmic sequestration(PubMed:24703950). Acts as a tumor suppressor.{ECO:0000269|PubMed:12485996, ECO:0000269|PubMed:18757409,ECO:0000269|PubMed:19117993, ECO:0000269|PubMed:19188440,ECO:0000269|PubMed:19815555, ECO:0000269|PubMed:20436459,ECO:0000269|PubMed:24703950, ECO:0000269|PubMed:9528852}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneBAP1chr3:52021640chr3:52441476ENST00000460680-417630_661125730Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ACY1_BAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACY1_ENST00000458031_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_1002aa
MWGCQAPLSRLPASGETPMSQSWLVSPLATRPSFTARCSHSTRHTGWRWCCFMERPLTLTRGSSWAHCSYCHRGATGPWPLTFQLTTRSA
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDTGAAVAFFEETARQLGLGCQKVEVAPGTVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEH
WSHDPFEAFKDSEGYITARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANP
TDAFTVFTSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVATNVIPATMS
ASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQSKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITG
RLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQP
ELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLP
AFLDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKGKGTGKPGALSGSADGQLSVLQPNTINVL
AEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSL
LRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYS
PKELLALLKCVEAEIANTEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRR

>In-frame_ACY1_ENST00000458031_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_984aa
MWGCQAPLSRLPASGETPMSQSWLVSPLATRPSFTARCSHSTRHTGWRWCCFMERPLTLTRGSSWAHCSYCHRGATGPWPLTFQLTTRSA
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDTGAAVAFFEETARQLGLGCQKVEVAPGTVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEH
WSHDPFEAFKDSEGYITARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANP
TDAFTVFTSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVATNVIPATMS
ASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQSKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITG
RLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESK
SASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEED
LAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKGKGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIK
TSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPV
ISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANT

>In-frame_ACY1_ENST00000494103_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_840aa
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDTGAAVAFFEETARQLGLGCQKVEVAPGTVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEH
WSHDPFEAFKDSEGIANPTDAFTVFTSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVN
LTKLEGGVATNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQSKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLS
AVRTMEAFHFVSTVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKV
NRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPG
SSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKGKGTGKPGALS
GSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPS
SPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSR
EKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANTEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRR

>In-frame_ACY1_ENST00000494103_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_822aa
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDTGAAVAFFEETARQLGLGCQKVEVAPGTVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEH
WSHDPFEAFKDSEGIANPTDAFTVFTSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVN
LTKLEGGVATNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQSKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLS
AVRTMEAFHFVSTVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQP
ELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLP
AFLDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKGKGTGKPGALSGSADGQLSVLQPNTINVL
AEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSL
LRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYS
PKELLALLKCVEAEIANTEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRR

>In-frame_ACY1_ENST00000476854_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_847aa
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDTGAAVAFFEETARQLGLGCQKVEVAPGTVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEH
WSHDPFEAFKDSEGYITARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANP
TDAFTVFTSERSPWWVRVTSTGRPGHASRFMEDTAAEKLAFEEQLQSWCQAAGEGVTLEFAQSKGTAIGNAPELAKAHNSHARPEPRHLP
EKQNGLSAVRTMEAFHFVSTVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEA
RLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPK
LVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKGKGT
GKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRS
ANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEV
VEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANTEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVE

>In-frame_ACY1_ENST00000476854_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_829aa
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDTGAAVAFFEETARQLGLGCQKVEVAPGTVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEH
WSHDPFEAFKDSEGYITARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANP
TDAFTVFTSERSPWWVRVTSTGRPGHASRFMEDTAAEKLAFEEQLQSWCQAAGEGVTLEFAQSKGTAIGNAPELAKAHNSHARPEPRHLP
EKQNGLSAVRTMEAFHFVSTVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQ
LIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPT
PIVQRLPAFLDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKGKGTGKPGALSGSADGQLSVLQ
PNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVL
FGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEP
LSGEKYSPKELLALLKCVEAEIANTEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHK

>In-frame_ACY1_ENST00000476351_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_877aa
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDTGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYITARGAQDMKCVSIQYLEAV
RRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFTSERSPWWVRVTSTGRPGHASRFMEDTA
AEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVATNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEF
AQSKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMER
IGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANRAPA
ASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQ
YSDDEDDTEDDEEDDVQNTNSALRTKGKGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQ
PSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPL
ALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANTEACLKEEVEKRKKFKID

>In-frame_ACY1_ENST00000476351_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_859aa
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDTGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYITARGAQDMKCVSIQYLEAV
RRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFTSERSPWWVRVTSTGRPGHASRFMEDTA
AEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVATNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEF
AQSKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMER
IGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCA
QAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQN
TNSALRTKGKGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGS
AFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQG
SQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANTEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISM

>In-frame_ACY1_ENST00000404366_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_912aa
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDTGAAVAFFEETARQLGLGCQKVEVAPGTVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEH
WSHDPFEAFKDSEGYITARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANP
TDAFTVFTSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVATNVIPATMS
ASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQSKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITG
RLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKTEARLHVLKVNRQTVLEALQQLIRVTQP
ELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLP
AFLDNHNTAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKGKGTGKPGALSGSADGQLSVLQPNTINVL
AEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSL
LRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYS
PKELLALLKCVEAEIANTEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRR

>In-frame_ACY1_ENST00000404366_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_894aa
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDTGAAVAFFEETARQLGLGCQKVEVAPGTVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEH
WSHDPFEAFKDSEGYITARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANP
TDAFTVFTSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVATNVIPATMS
ASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQSKGTAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSTVPITG
RLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKTEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESK
SASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNTAKSPMQEEED
LAAGVGRSRVPVRPPQQYSDDEDDTEDDEEDDVQNTNSALRTKGKGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIK
TSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPV
ISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACY1_ENST00000458031_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_3006nt
ATGTGGGGCTGCCAGGCCCCCCTGAGCAGACTTCCTGCCTCTGGGGAGACCCCAATGTCACAGTCCTGGCTGGTCTCACCCCTGGCAACT
CGCCCATCTTTTACCGCGAGGTGCTCCCACTCAACCAGGCACACAGGGTGGAGGTGGTGCTGCTTCATGGAAAGGCCTTTAACTCTCACA
CGTGGGAGCAGCTGGGCACACTGCAGCTACTGTCACAGAGGGGCTACCGGGCCGTGGCCCTTGACCTTCCAGCTCACCACGCGCAGCGCC
ATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGAC
TATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTG
ACCGTGTTGACCTGGCCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACAT
TGGAGTCACGACCCCTTTGAGGCCTTCAAGGATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAG
TACCTGGAAGCTGTGAGGAGGCTGAAGGTGGAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGG
GGTCACCAAGGCATGGAGCTGTTCGTGCAGCGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCC
ACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTC
ATGGAGGACACAGCAGCAGAGAAGCTGCACAAGGTTGTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAAC
CCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGAACCTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGC
GCCAGCTTTGACTTCCGTGTGGCACCGGATGTGGACTTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGG
GTCACCCTAGAGTTTGCTCAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAG
CCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGC
CGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGG
GTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGG
ATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCA
GAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCA
AACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCT
CCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCG
GCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTC
CGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTAT
AAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTG
GCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTG
CCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGC
TCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTG
CTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGG
GTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCA
GTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCA
CCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAG
AAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTG
GCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGG

>In-frame_ACY1_ENST00000458031_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_2952nt
ATGTGGGGCTGCCAGGCCCCCCTGAGCAGACTTCCTGCCTCTGGGGAGACCCCAATGTCACAGTCCTGGCTGGTCTCACCCCTGGCAACT
CGCCCATCTTTTACCGCGAGGTGCTCCCACTCAACCAGGCACACAGGGTGGAGGTGGTGCTGCTTCATGGAAAGGCCTTTAACTCTCACA
CGTGGGAGCAGCTGGGCACACTGCAGCTACTGTCACAGAGGGGCTACCGGGCCGTGGCCCTTGACCTTCCAGCTCACCACGCGCAGCGCC
ATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGAC
TATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTG
ACCGTGTTGACCTGGCCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACAT
TGGAGTCACGACCCCTTTGAGGCCTTCAAGGATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAG
TACCTGGAAGCTGTGAGGAGGCTGAAGGTGGAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGG
GGTCACCAAGGCATGGAGCTGTTCGTGCAGCGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCC
ACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTC
ATGGAGGACACAGCAGCAGAGAAGCTGCACAAGGTTGTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAAC
CCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGAACCTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGC
GCCAGCTTTGACTTCCGTGTGGCACCGGATGTGGACTTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGG
GTCACCCTAGAGTTTGCTCAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAG
CCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGC
CGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGG
GTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTA
GAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAG
TCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCG
GCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTT
CACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGAC
CTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAG
GATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAA
CTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAG
ACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCC
TCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCAC
ATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTC
ATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATC
AGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTG
AGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTAT
GAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGC
ACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATC

>In-frame_ACY1_ENST00000494103_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_2520nt
ATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGAC
TATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTG
ACCGTGTTGACCTGGCCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACAT
TGGAGTCACGACCCCTTTGAGGCCTTCAAGGATTCTGAGGGCATAGCCAATCCCACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGT
CCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCAGCAGAGAAGCTGCACAAGGTT
GTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGAAC
CTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTCCGTGTGGCACCGGATGTGGAC
TTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGATATGCG
ATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGT
GCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCC
ATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGG
GAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTG
AACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAG
CTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACA
GATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGC
AGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCC
ATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGAC
TATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGC
GGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCA
ATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAAT
GAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCC
AGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTC
CGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAG
GGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGA
GAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAG
GCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACCCACAAC
TACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGG
CGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAACGCTCTCGCCCCTACAAGGCCAAGCGCCAGTGA

>In-frame_ACY1_ENST00000494103_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_2466nt
ATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGAC
TATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTG
ACCGTGTTGACCTGGCCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACAT
TGGAGTCACGACCCCTTTGAGGCCTTCAAGGATTCTGAGGGCATAGCCAATCCCACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGT
CCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCAGCAGAGAAGCTGCACAAGGTT
GTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGAAC
CTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTCCGTGTGGCACCGGATGTGGAC
TTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGATATGCG
ATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGT
GCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCC
ATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGG
ATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCA
GAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCA
AACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCT
CCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCG
GCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTC
CGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTAT
AAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTG
GCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTG
CCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGC
TCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTG
CTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGG
GTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCA
GTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCA
CCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAG
AAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTG
GCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGG

>In-frame_ACY1_ENST00000476854_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_2541nt
ATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGAC
TATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTG
ACCGTGTTGACCTGGCCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACAT
TGGAGTCACGACCCCTTTGAGGCCTTCAAGGATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAG
TACCTGGAAGCTGTGAGGAGGCTGAAGGTGGAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGG
GGTCACCAAGGCATGGAGCTGTTCGTGCAGCGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCC
ACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTC
ATGGAGGACACAGCAGCAGAGAAGCTGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTT
GCTCAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCT
GAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTG
GATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGT
ATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAGTATGAGGCC
AGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACC
CACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCA
GCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAG
CTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAAT
CACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAG
TACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACA
GGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAA
GAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAG
CCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCA
GCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGC
ATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTG
GCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTC
GTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTG
GCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGAT
GACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAG
CAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAACGCTCTCGCCCC

>In-frame_ACY1_ENST00000476854_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_2487nt
ATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGAC
TATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTG
ACCGTGTTGACCTGGCCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACAT
TGGAGTCACGACCCCTTTGAGGCCTTCAAGGATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAG
TACCTGGAAGCTGTGAGGAGGCTGAAGGTGGAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGG
GGTCACCAAGGCATGGAGCTGTTCGTGCAGCGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCC
ACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTC
ATGGAGGACACAGCAGCAGAGAAGCTGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTT
GCTCAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCT
GAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTG
GATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGT
ATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAG
CTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAG
TCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCA
CAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACT
CCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTG
GGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAAC
ACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAG
CCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCT
GGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGT
GCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTT
TTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTG
CTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGC
AGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCC
TTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAG
GAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATG
CTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAG

>In-frame_ACY1_ENST00000476351_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_2631nt
ATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGAC
TATGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCC
TTTGAGGCCTTCAAGGATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAGTACCTGGAAGCTGTG
AGGAGGCTGAAGGTGGAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGGGGTCACCAAGGCATG
GAGCTGTTCGTGCAGCGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCCACTGATGCCTTCACT
GTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCA
GCAGAGAAGCTGCACAAGGTTGTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAG
GGGTCCGTGACCTCCGTGAACCTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTC
CGTGTGGCACCGGATGTGGACTTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTT
GCTCAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCT
GAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTG
GATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGT
ATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAGTATGAGGCC
AGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACC
CACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCA
GCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAG
CTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAAT
CACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAG
TACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACA
GGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAA
GAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAG
CCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCA
GCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGC
ATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTG
GCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTC
GTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTG
GCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGAT
GACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAG
CAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAACGCTCTCGCCCC

>In-frame_ACY1_ENST00000476351_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_2577nt
ATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGAC
TATGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCC
TTTGAGGCCTTCAAGGATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAGTACCTGGAAGCTGTG
AGGAGGCTGAAGGTGGAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGGGGTCACCAAGGCATG
GAGCTGTTCGTGCAGCGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCCACTGATGCCTTCACT
GTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCA
GCAGAGAAGCTGCACAAGGTTGTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAG
GGGTCCGTGACCTCCGTGAACCTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTC
CGTGTGGCACCGGATGTGGACTTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTT
GCTCAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCT
GAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTG
GATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGT
ATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAG
CTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAG
TCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCA
CAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACT
CCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTG
GGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAAC
ACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAG
CCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCT
GGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGT
GCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTT
TTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTG
CTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGC
AGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCC
TTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAG
GAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATG
CTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAG

>In-frame_ACY1_ENST00000404366_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_2736nt
ATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGAC
TATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTG
ACCGTGTTGACCTGGCCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACAT
TGGAGTCACGACCCCTTTGAGGCCTTCAAGGATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAG
TACCTGGAAGCTGTGAGGAGGCTGAAGGTGGAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGG
GGTCACCAAGGCATGGAGCTGTTCGTGCAGCGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCC
ACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTC
ATGGAGGACACAGCAGCAGAGAAGCTGCACAAGGTTGTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAAC
CCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGAACCTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGC
GCCAGCTTTGACTTCCGTGTGGCACCGGATGTGGACTTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGG
GTCACCCTAGAGTTTGCTCAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAG
CCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGC
CGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGG
GTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGG
ATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCA
GAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCA
AACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCT
CCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCG
GCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTC
CGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTAT
AAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTG
GCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTG
CCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGC
TCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTG
CTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGG
GTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCA
GTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCA
CCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAG
AAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTG
GCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGG

>In-frame_ACY1_ENST00000404366_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_2682nt
ATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGAC
TATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTG
ACCGTGTTGACCTGGCCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACAT
TGGAGTCACGACCCCTTTGAGGCCTTCAAGGATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAG
TACCTGGAAGCTGTGAGGAGGCTGAAGGTGGAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGG
GGTCACCAAGGCATGGAGCTGTTCGTGCAGCGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCC
ACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTC
ATGGAGGACACAGCAGCAGAGAAGCTGCACAAGGTTGTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAAC
CCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGAACCTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGC
GCCAGCTTTGACTTCCGTGTGGCACCGGATGTGGACTTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGG
GTCACCCTAGAGTTTGCTCAGAGCAAAGGATATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAG
CCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGC
CGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGG
GTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTA
GAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAG
TCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCG
GCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTT
CACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGAC
CTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAG
GATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAA
CTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAG
ACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCC
TCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCAC
ATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTC
ATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATC
AGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTG
AGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTAT
GAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGC
ACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACY1_ENST00000458031_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_4512nt
CGGCTGCGGAGTGCGCAGGCGCGCCGAGATGGCCGCGCTCCTGGCCGCCTAGAGCCGGAGCGGCCCGCGGAGCTGCGGAGGCAGCCATGG
TCGGGGCGCTGTGCGGCTGCTGGTTCCGCCTGGGCGGGGCCCGCCCGCTCATCCCGTTGGGCCCGACTGTGGTACAGACCTCCATGAGCC
GGTCCCAGGTAGCCCTGCTGGGCCTGAGTCTGCTGCTCATGCTCCTACTGTATGTGGGGCTGCCAGGCCCCCCTGAGCAGACTTCCTGCC
TCTGGGGAGACCCCAATGTCACAGTCCTGGCTGGTCTCACCCCTGGCAACTCGCCCATCTTTTACCGCGAGGTGCTCCCACTCAACCAGG
CACACAGGGTGGAGGTGGTGCTGCTTCATGGAAAGGCCTTTAACTCTCACACGTGGGAGCAGCTGGGCACACTGCAGCTACTGTCACAGA
GGGGCTACCGGGCCGTGGCCCTTGACCTTCCAGCTCACCACGCGCAGCGCCATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTG
ACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGACTATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAGCCCGC
CAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTGACCGTGTTGACCTGGCCAGGCACCAACCCTACACTCTCC
TCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCCTTTGAGGCCTTCAAGGATTCTGAG
GGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAGTACCTGGAAGCTGTGAGGAGGCTGAAGGTGGAGGGCCAC
CGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGGGGTCACCAAGGCATGGAGCTGTTCGTGCAGCGGCCTGAG
TTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCCACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGTCCC
TGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCAGCAGAGAAGCTGCACAAGGTTGTA
AACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGAACCTG
ACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTCCGTGTGGCACCGGATGTGGACTTC
AAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGATATGCGATT
GGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCA
GTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATT
GACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAG
CCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAAC
CGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTG
CCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGAT
GGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGC
AGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATG
CAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTAT
GAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGT
TCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATT
CCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAG
AGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGC
CCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGT
GATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGT
TCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAG
AAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCT
GAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTAC
GATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGC
CAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAACGCTCTCGCCCCTACAAGGCCAAGCGCCAGTGAGGA
CTGCTGGCCCTGACTCTGCAGCCCACTCTTGCCGTGTGGCCCTCACCAGGGTCCTTCCCTGCCCCACTTCCCCTTTTCCCAGTATTACTG
AATAGTCCCAGCTGGAGAGTCCAGGCCCTGGGAATGGGAGGAACCAGGCCACATTCCTTCCATCGTGCCCTGAGGCCTGACACGGCAGAT
CAGCCCCATAGTGCTCAGGAGGCAGCATCTGGAGTTGGGGCACAGCGAGGTACTGCAGCTTCCTCCACAGCCGGCTGTGGAGCAGCAGGA
CCTGGCCCTTCTGCCTGGGCAGCAGAATATATATTTTACCTATCAGAGACATCTATTTTTCTGGGCTCCAACCCAACATGCCACCATGTT
GACATAAGTTCCTACCTGACTATGCTTTCTCTCCTAGGAGCTGTCCTGGTGGGCCCAGGTCCTTGTATCATGCCACGGTCCCAACTACAG
GGTCCTAGCTGGGGGCCTGGGTGGGCCCTGGGCTCTGGGCCCTGCTGCTCTAGCCCCAGCCACCAGCCTGTCCCTGTTGTAAGGAAGCCA
GGTCTTCTCTCTTCATTCCTCTTAGGAGAGTGCCAAACTCAGGGACCCAGCACTGGGCTGGGTTGGGAGTAGGGTGTCCCAGTGGGGTTG
GGGTGAGCAGGCTGCTGGGATCCCATGGCCTGAGCAGAGCATGTGGGAACTGTTCAGTGGCCTGTGAACTGTCTTCCTTGTTCTAGCCAG
GCTGTTCAAGACTGCTCTCCATAGCAAGGTTCTAGGGCTCTTCGCCTTCAGTGTTGTGGCCCTAGCTATGGGCCTAAATTGGGCTCTAGG
TCTCTGTCCCTGGCGCTTGAGGCTCAGAAGAGCCTCTGTCCAGCCCCTCAGTATTACCATGTCTCCCTCTCAGGGGTAGCAGAGACAGGG
TTGCTTATAGGAAGCTGGCACCACTCAGCTCTTCCTGCTACTCCAGTTTCCTCAGCCTCTGCAAGGCACTCAGGGTGGGGGACAGCAGGA
TCAAGACAACCCGTTGGAGCCCCTGTGTTCCAGAGGACCTGATGCCAAGGGGTAATGGGCCCAGCAGTGCCTCTGGAGCCCAGGCCCCAA
CACAGCCCCATGGCCTCTGCCAGATGGCTTTGAAAAAGGTGATCCAAGCAGGCCCCTTTATCTGTACATAGTGACTGAGTGGGGGGTGCT
GGCAAGTGTGGCAGCTGCCTCTGGGCTGAGCACAGCTTGACCCCTCTAGCCCCTGTAAATACTGGATCAATGAATGAATAAAACTCTCCT

>In-frame_ACY1_ENST00000458031_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_4445nt
CGGCTGCGGAGTGCGCAGGCGCGCCGAGATGGCCGCGCTCCTGGCCGCCTAGAGCCGGAGCGGCCCGCGGAGCTGCGGAGGCAGCCATGG
TCGGGGCGCTGTGCGGCTGCTGGTTCCGCCTGGGCGGGGCCCGCCCGCTCATCCCGTTGGGCCCGACTGTGGTACAGACCTCCATGAGCC
GGTCCCAGGTAGCCCTGCTGGGCCTGAGTCTGCTGCTCATGCTCCTACTGTATGTGGGGCTGCCAGGCCCCCCTGAGCAGACTTCCTGCC
TCTGGGGAGACCCCAATGTCACAGTCCTGGCTGGTCTCACCCCTGGCAACTCGCCCATCTTTTACCGCGAGGTGCTCCCACTCAACCAGG
CACACAGGGTGGAGGTGGTGCTGCTTCATGGAAAGGCCTTTAACTCTCACACGTGGGAGCAGCTGGGCACACTGCAGCTACTGTCACAGA
GGGGCTACCGGGCCGTGGCCCTTGACCTTCCAGCTCACCACGCGCAGCGCCATGACCAGCAAGGGTCCCGAGGAGGAGCACCCATCGGTG
ACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGACTATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAGCCCGC
CAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTGACCGTGTTGACCTGGCCAGGCACCAACCCTACACTCTCC
TCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCCTTTGAGGCCTTCAAGGATTCTGAG
GGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAGTACCTGGAAGCTGTGAGGAGGCTGAAGGTGGAGGGCCAC
CGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGGGGTCACCAAGGCATGGAGCTGTTCGTGCAGCGGCCTGAG
TTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCCACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGTCCC
TGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCAGCAGAGAAGCTGCACAAGGTTGTA
AACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGAACCTG
ACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTCCGTGTGGCACCGGATGTGGACTTC
AAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGATATGCGATT
GGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCA
GTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATT
GACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATC
AAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAG
CTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAAC
AGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCC
AACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCC
TTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGC
CCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAG
GGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCT
GAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCC
ACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCG
CCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTG
CGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTG
CTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTG
GAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCC
AAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAG
TTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCC
AACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAA
CGCTCTCGCCCCTACAAGGCCAAGCGCCAGTGAGGACTGCTGGCCCTGACTCTGCAGCCCACTCTTGCCGTGTGGCCCTCACCAGGGTCC
TTCCCTGCCCCACTTCCCCTTTTCCCAGTATTACTGAATAGTCCCAGCTGGAGAGTCCAGGCCCTGGGAATGGGAGGAACCAGGCCACAT
TCCTTCCATCGTGCCCTGAGGCCTGACACGGCAGATCAGCCCCATAGTGCTCAGGAGGCAGCATCTGGAGTTGGGGCACAGCGAGGTACT
GCAGCTTCCTCCACAGCCGGCTGTGGAGCAGCAGGACCTGGCCCTTCTGCCTGGGCAGCAGAATATATATTTTACCTATCAGAGACATCT
ATTTTTCTGGGCTCCAACCCAACATGCCACCATGTTGACATAAGTTCCTACCTGACTATGCTTTCTCTCCTAGGAGCTGTCCTGGTGGGC
CCAGGTCCTTGTATCATGCCACGGTCCCAACTACAGGGTCCTAGCTGGGGGCCTGGGTGGGCCCTGGGCTCTGGGCCCTGCTGCTCTAGC
CCCAGCCACCAGCCTGTCCCTGTTGTAAGGAAGCCAGGTCTTCTCTCTTCATTCCTCTTAGGAGAGTGCCAAACTCAGGGACCCAGCACT
GGGCTGGGTTGGGAGTAGGGTGTCCCAGTGGGGTTGGGGTGAGCAGGCTGCTGGGATCCCATGGCCTGAGCAGAGCATGTGGGAACTGTT
CAGTGGCCTGTGAACTGTCTTCCTTGTTCTAGCCAGGCTGTTCAAGACTGCTCTCCATAGCAAGGTTCTAGGGCTCTTCGCCTTCAGTGT
TGTGGCCCTAGCTATGGGCCTAAATTGGGCTCTAGGTCTCTGTCCCTGGCGCTTGAGGCTCAGAAGAGCCTCTGTCCAGCCCCTCAGTAT
TACCATGTCTCCCTCTCAGGGGTAGCAGAGACAGGGTTGCTTATAGGAAGCTGGCACCACTCAGCTCTTCCTGCTACTCCAGTTTCCTCA
GCCTCTGCAAGGCACTCAGGGTGGGGGACAGCAGGATCAAGACAACCCGTTGGAGCCCCTGTGTTCCAGAGGACCTGATGCCAAGGGGTA
ATGGGCCCAGCAGTGCCTCTGGAGCCCAGGCCCCAACACAGCCCCATGGCCTCTGCCAGATGGCTTTGAAAAAGGTGATCCAAGCAGGCC
CCTTTATCTGTACATAGTGACTGAGTGGGGGGTGCTGGCAAGTGTGGCAGCTGCCTCTGGGCTGAGCACAGCTTGACCCCTCTAGCCCCT

>In-frame_ACY1_ENST00000494103_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_3960nt
CGACATCCGGCCTCGGCCACGTGGTGGGCGGACCGGGGCGGTCCTGAGCCTGCGACCTCGCAGGCGACCTCGCTGGACCCTAAGTCCAGG
CCACAGTCAGGGAAGGGCGCTGAGAGGCGAGCGTGAGCCCAGCGACAGGAGAGTGAGCTCACCACGCGCAGCGCCATGACCAGCAAGGGT
CCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGACTATGGAGCTGCTGTG
GCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTGACCGTGTTGACCTGG
CCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCC
TTTGAGGCCTTCAAGGATTCTGAGGGCATAGCCAATCCCACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGG
GTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCAGCAGAGAAGCTGCACAAGGTTGTAAACTCCATCCTG
GCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGAACCTGACTAAGCTAGAG
GGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTCCGTGTGGCACCGGATGTGGACTTCAAGGCTTTTGAG
GAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGATATGCGATTGGCAATGCCCCG
GAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATG
GAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCC
TGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGGAGCCCTACCACGAC
ATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTA
CTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCC
AAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAG
GCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGG
GTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAA
GACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAG
GAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGG
CAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATC
AAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACG
GCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCC
CACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCT
GTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCC
ATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATG
GTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAAC
TATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATC
TGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGC
ATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAACGCTCTCGCCCCTACAAGGCCAAGCGCCAGTGAGGACTGCTGGCCCTG
ACTCTGCAGCCCACTCTTGCCGTGTGGCCCTCACCAGGGTCCTTCCCTGCCCCACTTCCCCTTTTCCCAGTATTACTGAATAGTCCCAGC
TGGAGAGTCCAGGCCCTGGGAATGGGAGGAACCAGGCCACATTCCTTCCATCGTGCCCTGAGGCCTGACACGGCAGATCAGCCCCATAGT
GCTCAGGAGGCAGCATCTGGAGTTGGGGCACAGCGAGGTACTGCAGCTTCCTCCACAGCCGGCTGTGGAGCAGCAGGACCTGGCCCTTCT
GCCTGGGCAGCAGAATATATATTTTACCTATCAGAGACATCTATTTTTCTGGGCTCCAACCCAACATGCCACCATGTTGACATAAGTTCC
TACCTGACTATGCTTTCTCTCCTAGGAGCTGTCCTGGTGGGCCCAGGTCCTTGTATCATGCCACGGTCCCAACTACAGGGTCCTAGCTGG
GGGCCTGGGTGGGCCCTGGGCTCTGGGCCCTGCTGCTCTAGCCCCAGCCACCAGCCTGTCCCTGTTGTAAGGAAGCCAGGTCTTCTCTCT
TCATTCCTCTTAGGAGAGTGCCAAACTCAGGGACCCAGCACTGGGCTGGGTTGGGAGTAGGGTGTCCCAGTGGGGTTGGGGTGAGCAGGC
TGCTGGGATCCCATGGCCTGAGCAGAGCATGTGGGAACTGTTCAGTGGCCTGTGAACTGTCTTCCTTGTTCTAGCCAGGCTGTTCAAGAC
TGCTCTCCATAGCAAGGTTCTAGGGCTCTTCGCCTTCAGTGTTGTGGCCCTAGCTATGGGCCTAAATTGGGCTCTAGGTCTCTGTCCCTG
GCGCTTGAGGCTCAGAAGAGCCTCTGTCCAGCCCCTCAGTATTACCATGTCTCCCTCTCAGGGGTAGCAGAGACAGGGTTGCTTATAGGA
AGCTGGCACCACTCAGCTCTTCCTGCTACTCCAGTTTCCTCAGCCTCTGCAAGGCACTCAGGGTGGGGGACAGCAGGATCAAGACAACCC
GTTGGAGCCCCTGTGTTCCAGAGGACCTGATGCCAAGGGGTAATGGGCCCAGCAGTGCCTCTGGAGCCCAGGCCCCAACACAGCCCCATG
GCCTCTGCCAGATGGCTTTGAAAAAGGTGATCCAAGCAGGCCCCTTTATCTGTACATAGTGACTGAGTGGGGGGTGCTGGCAAGTGTGGC
AGCTGCCTCTGGGCTGAGCACAGCTTGACCCCTCTAGCCCCTGTAAATACTGGATCAATGAATGAATAAAACTCTCCTAAGAATCTCCTG

>In-frame_ACY1_ENST00000494103_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_3893nt
CGACATCCGGCCTCGGCCACGTGGTGGGCGGACCGGGGCGGTCCTGAGCCTGCGACCTCGCAGGCGACCTCGCTGGACCCTAAGTCCAGG
CCACAGTCAGGGAAGGGCGCTGAGAGGCGAGCGTGAGCCCAGCGACAGGAGAGTGAGCTCACCACGCGCAGCGCCATGACCAGCAAGGGT
CCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGACTATGGAGCTGCTGTG
GCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTGACCGTGTTGACCTGG
CCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCC
TTTGAGGCCTTCAAGGATTCTGAGGGCATAGCCAATCCCACTGATGCCTTCACTGTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGG
GTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCAGCAGAGAAGCTGCACAAGGTTGTAAACTCCATCCTG
GCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGAACCTGACTAAGCTAGAG
GGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTCCGTGTGGCACCGGATGTGGACTTCAAGGCTTTTGAG
GAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGATATGCGATTGGCAATGCCCCG
GAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTAGTGCAGTGCGGACCATG
GAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACCCCATTGACCATGGGCCC
TGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAGGGATCAAGTATGAGGCC
AGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACC
CACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCA
GCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAG
CTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAAT
CACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAG
TACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACA
GGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAA
GAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAG
CCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCA
GCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGC
ATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTG
GCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTC
GTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTG
GCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGAT
GACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAG
CAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAACGCTCTCGCCCC
TACAAGGCCAAGCGCCAGTGAGGACTGCTGGCCCTGACTCTGCAGCCCACTCTTGCCGTGTGGCCCTCACCAGGGTCCTTCCCTGCCCCA
CTTCCCCTTTTCCCAGTATTACTGAATAGTCCCAGCTGGAGAGTCCAGGCCCTGGGAATGGGAGGAACCAGGCCACATTCCTTCCATCGT
GCCCTGAGGCCTGACACGGCAGATCAGCCCCATAGTGCTCAGGAGGCAGCATCTGGAGTTGGGGCACAGCGAGGTACTGCAGCTTCCTCC
ACAGCCGGCTGTGGAGCAGCAGGACCTGGCCCTTCTGCCTGGGCAGCAGAATATATATTTTACCTATCAGAGACATCTATTTTTCTGGGC
TCCAACCCAACATGCCACCATGTTGACATAAGTTCCTACCTGACTATGCTTTCTCTCCTAGGAGCTGTCCTGGTGGGCCCAGGTCCTTGT
ATCATGCCACGGTCCCAACTACAGGGTCCTAGCTGGGGGCCTGGGTGGGCCCTGGGCTCTGGGCCCTGCTGCTCTAGCCCCAGCCACCAG
CCTGTCCCTGTTGTAAGGAAGCCAGGTCTTCTCTCTTCATTCCTCTTAGGAGAGTGCCAAACTCAGGGACCCAGCACTGGGCTGGGTTGG
GAGTAGGGTGTCCCAGTGGGGTTGGGGTGAGCAGGCTGCTGGGATCCCATGGCCTGAGCAGAGCATGTGGGAACTGTTCAGTGGCCTGTG
AACTGTCTTCCTTGTTCTAGCCAGGCTGTTCAAGACTGCTCTCCATAGCAAGGTTCTAGGGCTCTTCGCCTTCAGTGTTGTGGCCCTAGC
TATGGGCCTAAATTGGGCTCTAGGTCTCTGTCCCTGGCGCTTGAGGCTCAGAAGAGCCTCTGTCCAGCCCCTCAGTATTACCATGTCTCC
CTCTCAGGGGTAGCAGAGACAGGGTTGCTTATAGGAAGCTGGCACCACTCAGCTCTTCCTGCTACTCCAGTTTCCTCAGCCTCTGCAAGG
CACTCAGGGTGGGGGACAGCAGGATCAAGACAACCCGTTGGAGCCCCTGTGTTCCAGAGGACCTGATGCCAAGGGGTAATGGGCCCAGCA
GTGCCTCTGGAGCCCAGGCCCCAACACAGCCCCATGGCCTCTGCCAGATGGCTTTGAAAAAGGTGATCCAAGCAGGCCCCTTTATCTGTA
CATAGTGACTGAGTGGGGGGTGCTGGCAAGTGTGGCAGCTGCCTCTGGGCTGAGCACAGCTTGACCCCTCTAGCCCCTGTAAATACTGGA

>In-frame_ACY1_ENST00000476854_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_3981nt
CGACATCCGGCCTCGGCCACGTGGTGGGCGGACCGGGGCGGTCCTGAGCCTGCGACCTCGCAGGCGACCTCGCTGGACCCTAAGTCCAGG
CCACAGTCAGGGAAGGGCGCTGAGAGGCGAGCGTGAGCCCAGCGACAGGAGAGTGAGCTCACCACGCGCAGCGCCATGACCAGCAAGGGT
CCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGACTATGGAGCTGCTGTG
GCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTGACCGTGTTGACCTGG
CCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCC
TTTGAGGCCTTCAAGGATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAGTACCTGGAAGCTGTG
AGGAGGCTGAAGGTGGAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGGGGTCACCAAGGCATG
GAGCTGTTCGTGCAGCGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCCACTGATGCCTTCACT
GTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCA
GCAGAGAAGCTGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGA
TATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGC
CTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTC
TACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACT
GCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTG
AAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAG
TCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAAC
CACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCT
CCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAG
TCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAG
GATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCA
TTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGAC
CTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAGCCCTCACCCACCCCC
AGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGG
CCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGCATACGCTACAACCGT
GCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGT
GGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGAC
AGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGT
GTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACC
CACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTG
CGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAACGCTCTCGCCCCTACAAGGCCAAGCGC
CAGTGAGGACTGCTGGCCCTGACTCTGCAGCCCACTCTTGCCGTGTGGCCCTCACCAGGGTCCTTCCCTGCCCCACTTCCCCTTTTCCCA
GTATTACTGAATAGTCCCAGCTGGAGAGTCCAGGCCCTGGGAATGGGAGGAACCAGGCCACATTCCTTCCATCGTGCCCTGAGGCCTGAC
ACGGCAGATCAGCCCCATAGTGCTCAGGAGGCAGCATCTGGAGTTGGGGCACAGCGAGGTACTGCAGCTTCCTCCACAGCCGGCTGTGGA
GCAGCAGGACCTGGCCCTTCTGCCTGGGCAGCAGAATATATATTTTACCTATCAGAGACATCTATTTTTCTGGGCTCCAACCCAACATGC
CACCATGTTGACATAAGTTCCTACCTGACTATGCTTTCTCTCCTAGGAGCTGTCCTGGTGGGCCCAGGTCCTTGTATCATGCCACGGTCC
CAACTACAGGGTCCTAGCTGGGGGCCTGGGTGGGCCCTGGGCTCTGGGCCCTGCTGCTCTAGCCCCAGCCACCAGCCTGTCCCTGTTGTA
AGGAAGCCAGGTCTTCTCTCTTCATTCCTCTTAGGAGAGTGCCAAACTCAGGGACCCAGCACTGGGCTGGGTTGGGAGTAGGGTGTCCCA
GTGGGGTTGGGGTGAGCAGGCTGCTGGGATCCCATGGCCTGAGCAGAGCATGTGGGAACTGTTCAGTGGCCTGTGAACTGTCTTCCTTGT
TCTAGCCAGGCTGTTCAAGACTGCTCTCCATAGCAAGGTTCTAGGGCTCTTCGCCTTCAGTGTTGTGGCCCTAGCTATGGGCCTAAATTG
GGCTCTAGGTCTCTGTCCCTGGCGCTTGAGGCTCAGAAGAGCCTCTGTCCAGCCCCTCAGTATTACCATGTCTCCCTCTCAGGGGTAGCA
GAGACAGGGTTGCTTATAGGAAGCTGGCACCACTCAGCTCTTCCTGCTACTCCAGTTTCCTCAGCCTCTGCAAGGCACTCAGGGTGGGGG
ACAGCAGGATCAAGACAACCCGTTGGAGCCCCTGTGTTCCAGAGGACCTGATGCCAAGGGGTAATGGGCCCAGCAGTGCCTCTGGAGCCC
AGGCCCCAACACAGCCCCATGGCCTCTGCCAGATGGCTTTGAAAAAGGTGATCCAAGCAGGCCCCTTTATCTGTACATAGTGACTGAGTG
GGGGGTGCTGGCAAGTGTGGCAGCTGCCTCTGGGCTGAGCACAGCTTGACCCCTCTAGCCCCTGTAAATACTGGATCAATGAATGAATAA

>In-frame_ACY1_ENST00000476854_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_3914nt
CGACATCCGGCCTCGGCCACGTGGTGGGCGGACCGGGGCGGTCCTGAGCCTGCGACCTCGCAGGCGACCTCGCTGGACCCTAAGTCCAGG
CCACAGTCAGGGAAGGGCGCTGAGAGGCGAGCGTGAGCCCAGCGACAGGAGAGTGAGCTCACCACGCGCAGCGCCATGACCAGCAAGGGT
CCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGACTATGGAGCTGCTGTG
GCTTTCTTTGAGGAGACAGCCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTGACCGTGTTGACCTGG
CCAGGCACCAACCCTACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCC
TTTGAGGCCTTCAAGGATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAGTACCTGGAAGCTGTG
AGGAGGCTGAAGGTGGAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGGGGTCACCAAGGCATG
GAGCTGTTCGTGCAGCGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCCACTGATGCCTTCACT
GTCTTTTATAGTGAGCGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCA
GCAGAGAAGCTGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGA
TATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGC
CTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTC
TACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACT
GCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACA
CAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTG
GAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCAC
AGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGG
CTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTT
CCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTT
AGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAAC
GTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTG
GCAGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCA
CTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGAC
AGCCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAG
GATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGC
AGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAA
TACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAG
AGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGC
ATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGAC
CGGCGGAAACGCTCTCGCCCCTACAAGGCCAAGCGCCAGTGAGGACTGCTGGCCCTGACTCTGCAGCCCACTCTTGCCGTGTGGCCCTCA
CCAGGGTCCTTCCCTGCCCCACTTCCCCTTTTCCCAGTATTACTGAATAGTCCCAGCTGGAGAGTCCAGGCCCTGGGAATGGGAGGAACC
AGGCCACATTCCTTCCATCGTGCCCTGAGGCCTGACACGGCAGATCAGCCCCATAGTGCTCAGGAGGCAGCATCTGGAGTTGGGGCACAG
CGAGGTACTGCAGCTTCCTCCACAGCCGGCTGTGGAGCAGCAGGACCTGGCCCTTCTGCCTGGGCAGCAGAATATATATTTTACCTATCA
GAGACATCTATTTTTCTGGGCTCCAACCCAACATGCCACCATGTTGACATAAGTTCCTACCTGACTATGCTTTCTCTCCTAGGAGCTGTC
CTGGTGGGCCCAGGTCCTTGTATCATGCCACGGTCCCAACTACAGGGTCCTAGCTGGGGGCCTGGGTGGGCCCTGGGCTCTGGGCCCTGC
TGCTCTAGCCCCAGCCACCAGCCTGTCCCTGTTGTAAGGAAGCCAGGTCTTCTCTCTTCATTCCTCTTAGGAGAGTGCCAAACTCAGGGA
CCCAGCACTGGGCTGGGTTGGGAGTAGGGTGTCCCAGTGGGGTTGGGGTGAGCAGGCTGCTGGGATCCCATGGCCTGAGCAGAGCATGTG
GGAACTGTTCAGTGGCCTGTGAACTGTCTTCCTTGTTCTAGCCAGGCTGTTCAAGACTGCTCTCCATAGCAAGGTTCTAGGGCTCTTCGC
CTTCAGTGTTGTGGCCCTAGCTATGGGCCTAAATTGGGCTCTAGGTCTCTGTCCCTGGCGCTTGAGGCTCAGAAGAGCCTCTGTCCAGCC
CCTCAGTATTACCATGTCTCCCTCTCAGGGGTAGCAGAGACAGGGTTGCTTATAGGAAGCTGGCACCACTCAGCTCTTCCTGCTACTCCA
GTTTCCTCAGCCTCTGCAAGGCACTCAGGGTGGGGGACAGCAGGATCAAGACAACCCGTTGGAGCCCCTGTGTTCCAGAGGACCTGATGC
CAAGGGGTAATGGGCCCAGCAGTGCCTCTGGAGCCCAGGCCCCAACACAGCCCCATGGCCTCTGCCAGATGGCTTTGAAAAAGGTGATCC
AAGCAGGCCCCTTTATCTGTACATAGTGACTGAGTGGGGGGTGCTGGCAAGTGTGGCAGCTGCCTCTGGGCTGAGCACAGCTTGACCCCT

>In-frame_ACY1_ENST00000476351_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_4071nt
CGACATCCGGCCTCGGCCACGTGGTGGGCGGACCGGGGCGGTCCTGAGCCTGCGACCTCGCAGGCGACCTCGCTGGACCCTAAGTCCAGG
CCACAGTCAGGGAAGGGCGCTGAGAGGCGAGCGTGAGCCCAGCGACAGGAGAGTGAGCTCACCACGCGCAGCGCCATGACCAGCAAGGGT
CCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGACTATGGCACCAACCCT
ACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCCTTTGAGGCCTTCAAG
GATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAGTACCTGGAAGCTGTGAGGAGGCTGAAGGTG
GAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGGGGTCACCAAGGCATGGAGCTGTTCGTGCAG
CGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCCACTGATGCCTTCACTGTCTTTTATAGTGAG
CGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCAGCAGAGAAGCTGCAC
AAGGTTGTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAGGGGTCCGTGACCTCC
GTGAACCTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTCCGTGTGGCACCGGAT
GTGGACTTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGA
TATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGC
CTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTC
TACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACT
GCAGGGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTG
AAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAG
TCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAAC
CACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCT
CCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAG
TCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAG
GATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCA
TTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGAC
CTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAGCCCTCACCCACCCCC
AGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGG
CCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGCATACGCTACAACCGT
GCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGT
GGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGAC
AGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGT
GTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACC
CACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTG
CGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAACGCTCTCGCCCCTACAAGGCCAAGCGC
CAGTGAGGACTGCTGGCCCTGACTCTGCAGCCCACTCTTGCCGTGTGGCCCTCACCAGGGTCCTTCCCTGCCCCACTTCCCCTTTTCCCA
GTATTACTGAATAGTCCCAGCTGGAGAGTCCAGGCCCTGGGAATGGGAGGAACCAGGCCACATTCCTTCCATCGTGCCCTGAGGCCTGAC
ACGGCAGATCAGCCCCATAGTGCTCAGGAGGCAGCATCTGGAGTTGGGGCACAGCGAGGTACTGCAGCTTCCTCCACAGCCGGCTGTGGA
GCAGCAGGACCTGGCCCTTCTGCCTGGGCAGCAGAATATATATTTTACCTATCAGAGACATCTATTTTTCTGGGCTCCAACCCAACATGC
CACCATGTTGACATAAGTTCCTACCTGACTATGCTTTCTCTCCTAGGAGCTGTCCTGGTGGGCCCAGGTCCTTGTATCATGCCACGGTCC
CAACTACAGGGTCCTAGCTGGGGGCCTGGGTGGGCCCTGGGCTCTGGGCCCTGCTGCTCTAGCCCCAGCCACCAGCCTGTCCCTGTTGTA
AGGAAGCCAGGTCTTCTCTCTTCATTCCTCTTAGGAGAGTGCCAAACTCAGGGACCCAGCACTGGGCTGGGTTGGGAGTAGGGTGTCCCA
GTGGGGTTGGGGTGAGCAGGCTGCTGGGATCCCATGGCCTGAGCAGAGCATGTGGGAACTGTTCAGTGGCCTGTGAACTGTCTTCCTTGT
TCTAGCCAGGCTGTTCAAGACTGCTCTCCATAGCAAGGTTCTAGGGCTCTTCGCCTTCAGTGTTGTGGCCCTAGCTATGGGCCTAAATTG
GGCTCTAGGTCTCTGTCCCTGGCGCTTGAGGCTCAGAAGAGCCTCTGTCCAGCCCCTCAGTATTACCATGTCTCCCTCTCAGGGGTAGCA
GAGACAGGGTTGCTTATAGGAAGCTGGCACCACTCAGCTCTTCCTGCTACTCCAGTTTCCTCAGCCTCTGCAAGGCACTCAGGGTGGGGG
ACAGCAGGATCAAGACAACCCGTTGGAGCCCCTGTGTTCCAGAGGACCTGATGCCAAGGGGTAATGGGCCCAGCAGTGCCTCTGGAGCCC
AGGCCCCAACACAGCCCCATGGCCTCTGCCAGATGGCTTTGAAAAAGGTGATCCAAGCAGGCCCCTTTATCTGTACATAGTGACTGAGTG
GGGGGTGCTGGCAAGTGTGGCAGCTGCCTCTGGGCTGAGCACAGCTTGACCCCTCTAGCCCCTGTAAATACTGGATCAATGAATGAATAA

>In-frame_ACY1_ENST00000476351_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_4004nt
CGACATCCGGCCTCGGCCACGTGGTGGGCGGACCGGGGCGGTCCTGAGCCTGCGACCTCGCAGGCGACCTCGCTGGACCCTAAGTCCAGG
CCACAGTCAGGGAAGGGCGCTGAGAGGCGAGCGTGAGCCCAGCGACAGGAGAGTGAGCTCACCACGCGCAGCGCCATGACCAGCAAGGGT
CCCGAGGAGGAGCACCCATCGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGACTATGGCACCAACCCT
ACACTCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCCTTTGAGGCCTTCAAG
GATTCTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAGTACCTGGAAGCTGTGAGGAGGCTGAAGGTG
GAGGGCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGGGGTCACCAAGGCATGGAGCTGTTCGTGCAG
CGGCCTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCCACTGATGCCTTCACTGTCTTTTATAGTGAG
CGGAGTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCAGCAGAGAAGCTGCAC
AAGGTTGTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAGGGGTCCGTGACCTCC
GTGAACCTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTCCGTGTGGCACCGGAT
GTGGACTTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGA
TATGCGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGC
CTTAGTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTC
TACCCCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACT
GCAGGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACA
CAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTG
GAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCAC
AGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGG
CTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTT
CCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTT
AGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAAC
GTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTG
GCAGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCA
CTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGAC
AGCCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAG
GATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGC
AGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAA
TACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAG
AGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGC
ATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGAC
CGGCGGAAACGCTCTCGCCCCTACAAGGCCAAGCGCCAGTGAGGACTGCTGGCCCTGACTCTGCAGCCCACTCTTGCCGTGTGGCCCTCA
CCAGGGTCCTTCCCTGCCCCACTTCCCCTTTTCCCAGTATTACTGAATAGTCCCAGCTGGAGAGTCCAGGCCCTGGGAATGGGAGGAACC
AGGCCACATTCCTTCCATCGTGCCCTGAGGCCTGACACGGCAGATCAGCCCCATAGTGCTCAGGAGGCAGCATCTGGAGTTGGGGCACAG
CGAGGTACTGCAGCTTCCTCCACAGCCGGCTGTGGAGCAGCAGGACCTGGCCCTTCTGCCTGGGCAGCAGAATATATATTTTACCTATCA
GAGACATCTATTTTTCTGGGCTCCAACCCAACATGCCACCATGTTGACATAAGTTCCTACCTGACTATGCTTTCTCTCCTAGGAGCTGTC
CTGGTGGGCCCAGGTCCTTGTATCATGCCACGGTCCCAACTACAGGGTCCTAGCTGGGGGCCTGGGTGGGCCCTGGGCTCTGGGCCCTGC
TGCTCTAGCCCCAGCCACCAGCCTGTCCCTGTTGTAAGGAAGCCAGGTCTTCTCTCTTCATTCCTCTTAGGAGAGTGCCAAACTCAGGGA
CCCAGCACTGGGCTGGGTTGGGAGTAGGGTGTCCCAGTGGGGTTGGGGTGAGCAGGCTGCTGGGATCCCATGGCCTGAGCAGAGCATGTG
GGAACTGTTCAGTGGCCTGTGAACTGTCTTCCTTGTTCTAGCCAGGCTGTTCAAGACTGCTCTCCATAGCAAGGTTCTAGGGCTCTTCGC
CTTCAGTGTTGTGGCCCTAGCTATGGGCCTAAATTGGGCTCTAGGTCTCTGTCCCTGGCGCTTGAGGCTCAGAAGAGCCTCTGTCCAGCC
CCTCAGTATTACCATGTCTCCCTCTCAGGGGTAGCAGAGACAGGGTTGCTTATAGGAAGCTGGCACCACTCAGCTCTTCCTGCTACTCCA
GTTTCCTCAGCCTCTGCAAGGCACTCAGGGTGGGGGACAGCAGGATCAAGACAACCCGTTGGAGCCCCTGTGTTCCAGAGGACCTGATGC
CAAGGGGTAATGGGCCCAGCAGTGCCTCTGGAGCCCAGGCCCCAACACAGCCCCATGGCCTCTGCCAGATGGCTTTGAAAAAGGTGATCC
AAGCAGGCCCCTTTATCTGTACATAGTGACTGAGTGGGGGGTGCTGGCAAGTGTGGCAGCTGCCTCTGGGCTGAGCACAGCTTGACCCCT

>In-frame_ACY1_ENST00000404366_chr3_52021640_+_BAP1_ENST00000460680_chr3_52441476_-_4157nt
CGTGGTGGGCGGACCGGGGCGGTCCTGAGCCTGCGACCTCGCAGGCGACCTCGCTGGACCCTAAGTCCAGGCCACAGTCAGGGAAGGGCG
CTGAGAGGCGAGCGTGAGCCCAGCGACAGGAGAGTGAGCTCACCACGCGCAGCGCCATGACCAGCAAGGGTCCCGAGGAGGAGCACCCAT
CGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGACTATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAG
CCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTGACCGTGTTGACCTGGCCAGGCACCAACCCTACAC
TCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCCTTTGAGGCCTTCAAGGATT
CTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAGTACCTGGAAGCTGTGAGGAGGCTGAAGGTGGAGG
GCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGGGGTCACCAAGGCATGGAGCTGTTCGTGCAGCGGC
CTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCCACTGATGCCTTCACTGTCTTTTATAGTGAGCGGA
GTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCAGCAGAGAAGCTGCACAAGG
TTGTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGA
ACCTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTCCGTGTGGCACCGGATGTGG
ACTTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGATATG
CGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTA
GTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACC
CCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAG
GGGAGCCCTACCACGACATCCGCTTCAACCTGATGGCAGTGGTGCCCGACCGCAGGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGG
TGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGCCAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCAC
AGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAGCAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACA
CAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCCCTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAG
GCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGCCGGCCTTTCTAGACAATCACAATTATGCCAAGTCCC
CCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAGTCCGCCCACCCCAGCAGTACTCAGATGATGAGGATG
ACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGTATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGA
GCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCTTGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCT
CAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAGTGCCCACACACTCGCAGCCCTCACCCACCCCCAGCA
ATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGCGCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCT
CCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCCTGCTGCGTGTTGACTGCATACGCTACAACCGTGCTG
TCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATGGGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGA
AGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCCCAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCA
GAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACTCACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGG
AGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGAAGAAGTTCAAGATTGATGACCAGAGAAGGACCCACA
ACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGCTGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGC
GGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGCGGAAACGCTCTCGCCCCTACAAGGCCAAGCGCCAGT
GAGGACTGCTGGCCCTGACTCTGCAGCCCACTCTTGCCGTGTGGCCCTCACCAGGGTCCTTCCCTGCCCCACTTCCCCTTTTCCCAGTAT
TACTGAATAGTCCCAGCTGGAGAGTCCAGGCCCTGGGAATGGGAGGAACCAGGCCACATTCCTTCCATCGTGCCCTGAGGCCTGACACGG
CAGATCAGCCCCATAGTGCTCAGGAGGCAGCATCTGGAGTTGGGGCACAGCGAGGTACTGCAGCTTCCTCCACAGCCGGCTGTGGAGCAG
CAGGACCTGGCCCTTCTGCCTGGGCAGCAGAATATATATTTTACCTATCAGAGACATCTATTTTTCTGGGCTCCAACCCAACATGCCACC
ATGTTGACATAAGTTCCTACCTGACTATGCTTTCTCTCCTAGGAGCTGTCCTGGTGGGCCCAGGTCCTTGTATCATGCCACGGTCCCAAC
TACAGGGTCCTAGCTGGGGGCCTGGGTGGGCCCTGGGCTCTGGGCCCTGCTGCTCTAGCCCCAGCCACCAGCCTGTCCCTGTTGTAAGGA
AGCCAGGTCTTCTCTCTTCATTCCTCTTAGGAGAGTGCCAAACTCAGGGACCCAGCACTGGGCTGGGTTGGGAGTAGGGTGTCCCAGTGG
GGTTGGGGTGAGCAGGCTGCTGGGATCCCATGGCCTGAGCAGAGCATGTGGGAACTGTTCAGTGGCCTGTGAACTGTCTTCCTTGTTCTA
GCCAGGCTGTTCAAGACTGCTCTCCATAGCAAGGTTCTAGGGCTCTTCGCCTTCAGTGTTGTGGCCCTAGCTATGGGCCTAAATTGGGCT
CTAGGTCTCTGTCCCTGGCGCTTGAGGCTCAGAAGAGCCTCTGTCCAGCCCCTCAGTATTACCATGTCTCCCTCTCAGGGGTAGCAGAGA
CAGGGTTGCTTATAGGAAGCTGGCACCACTCAGCTCTTCCTGCTACTCCAGTTTCCTCAGCCTCTGCAAGGCACTCAGGGTGGGGGACAG
CAGGATCAAGACAACCCGTTGGAGCCCCTGTGTTCCAGAGGACCTGATGCCAAGGGGTAATGGGCCCAGCAGTGCCTCTGGAGCCCAGGC
CCCAACACAGCCCCATGGCCTCTGCCAGATGGCTTTGAAAAAGGTGATCCAAGCAGGCCCCTTTATCTGTACATAGTGACTGAGTGGGGG
GTGCTGGCAAGTGTGGCAGCTGCCTCTGGGCTGAGCACAGCTTGACCCCTCTAGCCCCTGTAAATACTGGATCAATGAATGAATAAAACT

>In-frame_ACY1_ENST00000404366_chr3_52021640_+_BAP1_ENST00000296288_chr3_52441476_-_4090nt
CGTGGTGGGCGGACCGGGGCGGTCCTGAGCCTGCGACCTCGCAGGCGACCTCGCTGGACCCTAAGTCCAGGCCACAGTCAGGGAAGGGCG
CTGAGAGGCGAGCGTGAGCCCAGCGACAGGAGAGTGAGCTCACCACGCGCAGCGCCATGACCAGCAAGGGTCCCGAGGAGGAGCACCCAT
CGGTGACGCTCTTCCGCCAGTACCTGCGTATCCGCACTGTCCAGCCCAAGCCTGACTATGGAGCTGCTGTGGCTTTCTTTGAGGAGACAG
CCCGCCAGCTGGGCCTGGGCTGTCAGAAAGTAGAGGTGGCACCTGGCTATGTGGTGACCGTGTTGACCTGGCCAGGCACCAACCCTACAC
TCTCCTCCATCTTGCTCAACTCCCACACGGATGTGGTGCCTGTCTTCAAGGAACATTGGAGTCACGACCCCTTTGAGGCCTTCAAGGATT
CTGAGGGCTACATCTATGCCAGGGGTGCCCAGGACATGAAGTGCGTCAGCATCCAGTACCTGGAAGCTGTGAGGAGGCTGAAGGTGGAGG
GCCACCGGTTCCCCAGAACCATCCACATGACCTTTGTGCCTGATGAGGAGGTTGGGGGTCACCAAGGCATGGAGCTGTTCGTGCAGCGGC
CTGAGTTCCACGCCCTGAGGGCAGGCTTTGCCCTGGATGAGGGCATAGCCAATCCCACTGATGCCTTCACTGTCTTTTATAGTGAGCGGA
GTCCCTGGTGGGTGCGGGTTACCAGCACTGGGAGGCCAGGCCATGCCTCACGCTTCATGGAGGACACAGCAGCAGAGAAGCTGCACAAGG
TTGTAAACTCCATCCTGGCATTCCGGGAGAAGGAATGGCAGAGGCTGCAGTCAAACCCCCACCTGAAAGAGGGGTCCGTGACCTCCGTGA
ACCTGACTAAGCTAGAGGGTGGCGTGGCCTATAACGTGATACCTGCCACCATGAGCGCCAGCTTTGACTTCCGTGTGGCACCGGATGTGG
ACTTCAAGGCTTTTGAGGAGCAGCTGCAGAGCTGGTGCCAGGCAGCTGGCGAGGGGGTCACCCTAGAGTTTGCTCAGAGCAAAGGATATG
CGATTGGCAATGCCCCGGAGTTGGCCAAGGCCCATAATAGCCATGCCAGGCCCGAGCCACGCCACCTCCCTGAGAAGCAGAATGGCCTTA
GTGCAGTGCGGACCATGGAGGCGTTCCACTTTGTCAGCTATGTGCCTATCACAGGCCGGCTCTTTGAGCTGGATGGGCTGAAGGTCTACC
CCATTGACCATGGGCCCTGGGGGGAGGACGAGGAGTGGACAGACAAGGCCCGGCGGGTCATCATGGAGCGTATCGGCCTCGCCACTGCAG
GGATCAAGTATGAGGCCAGGCTGCATGTGCTGAAGGTGAACCGTCAGACAGTACTAGAGGCTCTGCAGCAGCTGATAAGAGTAACACAGC
CAGAGCTGATTCAGACCCACAAGTCTCAAGAGTCACAGCTGCCTGAGGAGTCCAAGTCAGCCAGCAACAAGTCCCCGCTGGTGCTGGAAG
CAAACAGGGCCCCTGCAGCCTCTGAGGGCAACCACACAGATGGTGCAGAGGAGGCGGCTGGTTCATGCGCACAAGCCCCATCCCACAGCC
CTCCCAACAAACCCAAGCTAGTGGTGAAGCCTCCAGGCAGCAGCCTCAATGGGGTTCACCCCAACCCCACTCCCATTGTCCAGCGGCTGC
CGGCCTTTCTAGACAATCACAATTATGCCAAGTCCCCCATGCAGGAGGAAGAAGACCTGGCGGCAGGTGTGGGCCGCAGCCGAGTTCCAG
TCCGCCCACCCCAGCAGTACTCAGATGATGAGGATGACTATGAGGATGACGAGGAGGATGACGTGCAGAACACCAACTCTGCCCTTAGGT
ATAAGGGGAAGGGAACAGGGAAGCCAGGGGCATTGAGCGGTTCTGCTGATGGGCAACTGTCAGTGCTGCAGCCCAACACCATCAACGTCT
TGGCTGAGAAGCTCAAAGAGTCCCAGAAGGACCTCTCAATTCCTCTGTCCATCAAGACTAGCAGCGGGGCTGGGAGTCCGGCTGTGGCAG
TGCCCACACACTCGCAGCCCTCACCCACCCCCAGCAATGAGAGTACAGACACGGCCTCTGAGATCGGCAGTGCTTTCAACTCGCCACTGC
GCTCGCCTATCCGCTCAGCCAACCCGACGCGGCCCTCCAGCCCTGTCACCTCCCACATCTCCAAGGTGCTTTTTGGAGAGGATGACAGCC
TGCTGCGTGTTGACTGCATACGCTACAACCGTGCTGTCCGTGATCTGGGTCCTGTCATCAGCACAGGCCTGCTGCACCTGGCTGAGGATG
GGGTGCTGAGTCCCCTGGCGCTGACAGAGGGTGGGAAGGGTTCCTCGCCCTCCATCAGACCAATCCAAGGCAGCCAGGGGTCCAGCAGCC
CAGTGGAGAAGGAGGTCGTGGAAGCCACGGACAGCAGAGAGAAGACGGGGATGGTGAGGCCTGGCGAGCCCTTGAGTGGGGAGAAATACT
CACCCAAGGAGCTGCTGGCACTGCTGAAGTGTGTGGAGGCTGAGATTGCAAACTATGAGGCGTGCCTCAAGGAGGAGGTAGAGAAGAGGA
AGAAGTTCAAGATTGATGACCAGAGAAGGACCCACAACTACGATGAGTTCATCTGCACCTTTATCTCCATGCTGGCTCAGGAAGGCATGC
TGGCCAACCTAGTGGAGCAGAACATCTCCGTGCGGCGGCGCCAAGGGGTCAGCATCGGCCGGCTCCACAAGCAGCGGAAGCCTGACCGGC
GGAAACGCTCTCGCCCCTACAAGGCCAAGCGCCAGTGAGGACTGCTGGCCCTGACTCTGCAGCCCACTCTTGCCGTGTGGCCCTCACCAG
GGTCCTTCCCTGCCCCACTTCCCCTTTTCCCAGTATTACTGAATAGTCCCAGCTGGAGAGTCCAGGCCCTGGGAATGGGAGGAACCAGGC
CACATTCCTTCCATCGTGCCCTGAGGCCTGACACGGCAGATCAGCCCCATAGTGCTCAGGAGGCAGCATCTGGAGTTGGGGCACAGCGAG
GTACTGCAGCTTCCTCCACAGCCGGCTGTGGAGCAGCAGGACCTGGCCCTTCTGCCTGGGCAGCAGAATATATATTTTACCTATCAGAGA
CATCTATTTTTCTGGGCTCCAACCCAACATGCCACCATGTTGACATAAGTTCCTACCTGACTATGCTTTCTCTCCTAGGAGCTGTCCTGG
TGGGCCCAGGTCCTTGTATCATGCCACGGTCCCAACTACAGGGTCCTAGCTGGGGGCCTGGGTGGGCCCTGGGCTCTGGGCCCTGCTGCT
CTAGCCCCAGCCACCAGCCTGTCCCTGTTGTAAGGAAGCCAGGTCTTCTCTCTTCATTCCTCTTAGGAGAGTGCCAAACTCAGGGACCCA
GCACTGGGCTGGGTTGGGAGTAGGGTGTCCCAGTGGGGTTGGGGTGAGCAGGCTGCTGGGATCCCATGGCCTGAGCAGAGCATGTGGGAA
CTGTTCAGTGGCCTGTGAACTGTCTTCCTTGTTCTAGCCAGGCTGTTCAAGACTGCTCTCCATAGCAAGGTTCTAGGGCTCTTCGCCTTC
AGTGTTGTGGCCCTAGCTATGGGCCTAAATTGGGCTCTAGGTCTCTGTCCCTGGCGCTTGAGGCTCAGAAGAGCCTCTGTCCAGCCCCTC
AGTATTACCATGTCTCCCTCTCAGGGGTAGCAGAGACAGGGTTGCTTATAGGAAGCTGGCACCACTCAGCTCTTCCTGCTACTCCAGTTT
CCTCAGCCTCTGCAAGGCACTCAGGGTGGGGGACAGCAGGATCAAGACAACCCGTTGGAGCCCCTGTGTTCCAGAGGACCTGATGCCAAG
GGGTAATGGGCCCAGCAGTGCCTCTGGAGCCCAGGCCCCAACACAGCCCCATGGCCTCTGCCAGATGGCTTTGAAAAAGGTGATCCAAGC
AGGCCCCTTTATCTGTACATAGTGACTGAGTGGGGGGTGCTGGCAAGTGTGGCAGCTGCCTCTGGGCTGAGCACAGCTTGACCCCTCTAG


Top

FusionGenePPI for ACY1_BAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACY1TTC1, ACY1, TERF1, POT1, APP, NPM1, NUDT1, ARL6IP4, PHOSPHO1, SEC13, PPME1, BOLL, ICOS, PECR, RNF166, GLO1, HYI, PDRG1, SOD1, BPNT1, AP4M1, GSTP1, TRIM33BAP1HCFC1, FOXK2, IPO5, PPM1G, RBBP7, OGT, HAT1, EIF4EBP3, PSME3, CBX1, CBX3, AHCYL2, ANKRD17, ANAPC7, ASXL2, UBE2O, IPO4, ASXL1, KDM1B, FOXK1, HSPA2, PTEN, HIST2H2AC, ZC3H13, PRDM10, HSPA9, ZNF131, HSPA1A, EFNA2, ELF2, YY1, BRCA1, TRIM63, USP21, USP15, USP28, USP2, HIST2H2AA3, INO80, UBC, MAP3K1, BAG4, BCAR3, CASP8, ESR1, IGF1R, NBN, PTPRJ, RB1CC1, XRCC3, SMS, TSNAX, KIAA1107, ENTHD2, MCRS1, ASXL3, HIST1H2AB, KLF5, GOPC, CAMK2D, LINC00598


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneBAP1chr3:52021640chr3:52441476ENST00000460680-417596_721125730BRCA1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACY1_BAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneACY1Q03154DB06151AcetylcysteineAminoacylase-1small moleculeapproved|investigational

Top

RelatedDiseases for ACY1_BAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneACY1C1835922Aminoacylase 1 deficiency2CTD_human;ORPHANET;UNIPROT
HgeneACY1C0007134Renal Cell Carcinoma1CTD_human
HgeneACY1C0032927Precancerous Conditions1CTD_human
TgeneBAP1C0007134Renal Cell Carcinoma4CTD_human
TgeneBAP1C0025500Mesothelioma4CTD_human
TgeneBAP1C0345967Malignant mesothelioma4CTD_human
TgeneBAP1C0220633Uveal melanoma3CTD_human;HPO
TgeneBAP1C0038356Stomach Neoplasms2CTD_human
TgeneBAP1C0151779Cutaneous Melanoma2CTD_human
TgeneBAP1C0206698Cholangiocarcinoma2CTD_human
TgeneBAP1C1458155Mammary Neoplasms2CTD_human
TgeneBAP1C0005695Bladder Neoplasm1CTD_human
TgeneBAP1C0005967Bone neoplasms1CTD_human
TgeneBAP1C0007117Basal cell carcinoma1CTD_human
TgeneBAP1C0009375Colonic Neoplasms1CTD_human
TgeneBAP1C0018671Head and Neck Neoplasms1CTD_human
TgeneBAP1C0022665Kidney Neoplasm1CTD_human
TgeneBAP1C0023418leukemia1CTD_human
TgeneBAP1C0023798Lipoma1CTD_human
TgeneBAP1C0023903Liver neoplasms1CTD_human
TgeneBAP1C0024121Lung Neoplasms1CTD_human
TgeneBAP1C0025286Meningioma1CTD_human;HPO
TgeneBAP1C0030297Pancreatic Neoplasm1CTD_human
TgeneBAP1C0030421Paraganglioma1CTD_human
TgeneBAP1C0033578Prostatic Neoplasms1CTD_human
TgeneBAP1C0039590Testicular Neoplasms1CTD_human
TgeneBAP1C0040100Thymoma1CTD_human
TgeneBAP1C0042138Uterine Neoplasms1CTD_human
TgeneBAP1C0085136Central Nervous System Neoplasms1CTD_human
TgeneBAP1C0152013Adenocarcinoma of lung (disorder)1CTD_human;HPO
TgeneBAP1C0206686Adrenocortical carcinoma1CTD_human
TgeneBAP1C0206694Mucoepidermoid Carcinoma1CTD_human
TgeneBAP1C0206739Epithelioid and spindle cell nevus1CTD_human
TgeneBAP1C0206754Neuroendocrine Tumors1CTD_human
TgeneBAP1C0206769Nevi and Melanomas1CTD_human
TgeneBAP1C0919267ovarian neoplasm1CTD_human
TgeneBAP1C2931822Nasopharyngeal carcinoma1CTD_human