FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6565

FusionGeneSummary for CDK5RAP2_GRIN1

check button Fusion gene summary
Fusion gene informationFusion gene name: CDK5RAP2_GRIN1
Fusion gene ID: 6565
HgeneTgene
Gene symbol

CDK5RAP2

GRIN1

Gene ID

55755

114787

Gene nameCDK5 regulatory subunit associated protein 2G protein regulated inducer of neurite outgrowth 1
SynonymsC48|Cep215|MCPH3GRIN1
Cytomap

9q33.2

5q35.2

Type of geneprotein-codingprotein-coding
DescriptionCDK5 regulatory subunit-associated protein 2CDK5 activator-binding protein C48centrosomal protein 215 kDacentrosominG protein-regulated inducer of neurite outgrowth 1
Modification date2018051920180523
UniProtAcc

Q96SN8

Q05586

Ensembl transtripts involved in fusion geneENST00000360822, ENST00000359309, 
ENST00000349780, ENST00000360190, 
ENST00000480467, 
ENST00000371561, 
ENST00000315048, ENST00000471122, 
ENST00000350902, ENST00000371553, 
ENST00000371546, ENST00000371559, 
ENST00000371555, ENST00000371550, 
ENST00000371560, 
Fusion gene scores* DoF score9 X 8 X 4=2884 X 3 X 4=48
# samples 95
** MAII scorelog2(9/288*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/48*10)=0.0588936890535686
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: CDK5RAP2 [Title/Abstract] AND GRIN1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCDK5RAP2

GO:0000226

microtubule cytoskeleton organization

17959831

HgeneCDK5RAP2

GO:0001578

microtubule bundle formation

19553473

HgeneCDK5RAP2

GO:0045893

positive regulation of transcription, DNA-templated

19282672

HgeneCDK5RAP2

GO:0090266

regulation of mitotic cell cycle spindle assembly checkpoint

19282672


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-HT-7873-01BCDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000360822ENST00000371561CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
In-frameENST00000360822ENST00000315048CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360822ENST00000471122CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360822ENST00000350902CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360822ENST00000371553CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360822ENST00000371546CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360822ENST00000371559CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360822ENST00000371555CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360822ENST00000371550CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360822ENST00000371560CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
In-frameENST00000359309ENST00000371561CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
In-frameENST00000359309ENST00000315048CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000359309ENST00000471122CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000359309ENST00000350902CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000359309ENST00000371553CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000359309ENST00000371546CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000359309ENST00000371559CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000359309ENST00000371555CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000359309ENST00000371550CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000359309ENST00000371560CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
In-frameENST00000349780ENST00000371561CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
In-frameENST00000349780ENST00000315048CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000349780ENST00000471122CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000349780ENST00000350902CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000349780ENST00000371553CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000349780ENST00000371546CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000349780ENST00000371559CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000349780ENST00000371555CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000349780ENST00000371550CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000349780ENST00000371560CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
In-frameENST00000360190ENST00000371561CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
In-frameENST00000360190ENST00000315048CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360190ENST00000471122CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360190ENST00000350902CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360190ENST00000371553CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360190ENST00000371546CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360190ENST00000371559CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360190ENST00000371555CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360190ENST00000371550CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
5CDS-3UTRENST00000360190ENST00000371560CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
intron-3CDSENST00000480467ENST00000371561CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
intron-3CDSENST00000480467ENST00000315048CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
intron-3UTRENST00000480467ENST00000471122CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
intron-3UTRENST00000480467ENST00000350902CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
intron-3UTRENST00000480467ENST00000371553CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
intron-3UTRENST00000480467ENST00000371546CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
intron-3UTRENST00000480467ENST00000371559CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
intron-3UTRENST00000480467ENST00000371555CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
intron-3UTRENST00000480467ENST00000371550CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+
intron-3UTRENST00000480467ENST00000371560CDK5RAP2chr9

123280705

-GRIN1chr9

140036465

+

Top

FusionProtFeatures for CDK5RAP2_GRIN1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDK5RAP2

Q96SN8

GRIN1

Q05586


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneGRIN1chr9:123280705chr9:140036465ENST00000315048+020516_51886923RegionGlycine binding
TgeneGRIN1chr9:123280705chr9:140036465ENST00000315048+020603_62486923RegionPore-forming
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371546+021516_51886960RegionGlycine binding
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371546+021603_62486960RegionPore-forming
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371550+019516_51886902RegionGlycine binding
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371550+019603_62486902RegionPore-forming
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371553+021516_51886944RegionGlycine binding
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371553+021603_62486944RegionPore-forming
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371559+019516_51886886RegionGlycine binding
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371559+019603_62486886RegionPore-forming
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371560+020516_51886907RegionGlycine binding
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371560+020603_62486907RegionPore-forming
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371561+020516_51886939RegionGlycine binding
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371561+020603_62486939RegionPore-forming
TgeneGRIN1chr9:123280705chr9:140036465ENST00000315048+020581_60286923Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000315048+020625_63086923Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000315048+020648_81286923Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000315048+020834_93886923Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371546+021581_60286960Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371546+021625_63086960Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371546+021648_81286960Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371546+021834_93886960Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371550+019581_60286902Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371550+019625_63086902Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371550+019648_81286902Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371550+019834_93886902Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371553+021581_60286944Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371553+021625_63086944Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371553+021648_81286944Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371553+021834_93886944Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371559+019581_60286886Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371559+019625_63086886Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371559+019648_81286886Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371559+019834_93886886Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371560+020581_60286907Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371560+020625_63086907Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371560+020648_81286907Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371560+020834_93886907Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371561+020581_60286939Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371561+020625_63086939Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371561+020648_81286939Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371561+020834_93886939Topological domainCytoplasmic
TgeneGRIN1chr9:123280705chr9:140036465ENST00000315048+020560_58086923TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000315048+020631_64786923TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000315048+020813_83386923TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371546+021560_58086960TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371546+021631_64786960TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371546+021813_83386960TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371550+019560_58086902TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371550+019631_64786902TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371550+019813_83386902TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371553+021560_58086944TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371553+021631_64786944TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371553+021813_83386944TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371559+019560_58086886TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371559+019631_64786886TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371559+019813_83386886TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371560+020560_58086907TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371560+020631_64786907TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371560+020813_83386907TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371561+020560_58086939TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371561+020631_64786939TransmembraneHelical
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371561+020813_83386939TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneGRIN1chr9:123280705chr9:140036465ENST00000315048+02019_55986923Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371546+02119_55986960Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371550+01919_55986902Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371553+02119_55986944Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371559+01919_55986886Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371560+02019_55986907Topological domainExtracellular
TgeneGRIN1chr9:123280705chr9:140036465ENST00000371561+02019_55986939Topological domainExtracellular


Top

FusionGeneSequence for CDK5RAP2_GRIN1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDK5RAP2_ENST00000360822_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_1290aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRVYAILVSHPPTPN
DHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERES
KAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNG
THVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRS
TLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAF
IWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGAL

>In-frame_CDK5RAP2_ENST00000360822_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_1274aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRVYAILVSHPPTPN
DHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERES
KAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNG
THVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRS
TLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAF
IWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTQYHPTDITG

>In-frame_CDK5RAP2_ENST00000359309_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_1290aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRVYAILVSHPPTPN
DHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERES
KAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNG
THVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRS
TLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAF
IWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGAL

>In-frame_CDK5RAP2_ENST00000359309_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_1274aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRVYAILVSHPPTPN
DHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERES
KAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNG
THVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRS
TLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAF
IWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTQYHPTDITG

>In-frame_CDK5RAP2_ENST00000349780_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_1290aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRVYAILVSHPPTPN
DHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERES
KAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNG
THVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRS
TLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAF
IWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGAL

>In-frame_CDK5RAP2_ENST00000349780_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_1274aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRVYAILVSHPPTPN
DHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERES
KAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNG
THVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRS
TLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAF
IWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTQYHPTDITG

>In-frame_CDK5RAP2_ENST00000360190_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_1290aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRVYAILVSHPPTPN
DHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERES
KAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNG
THVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRS
TLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAF
IWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGAL

>In-frame_CDK5RAP2_ENST00000360190_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_1274aa
MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERMQQ
EFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGSEIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEK
AFAGTETEKALRLRLESKLSEMKKMHEGDLAMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEK
ERETEAAQMEHQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAKAREALQKAQT
QEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEKDLEEAHREKSKGDCTIRVYAILVSHPPTPN
DHFTPTPVSYTAGFYRIPVLGLTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRLETLLEERES
KAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRKLVQVGIYNG
THVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRS
TLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAF
IWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTQYHPTDITG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDK5RAP2_ENST00000360822_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_3870nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGAGCACCGGGGGTGGACGCGGCGCTTTG
CAAAACCAAAAAGACACAGTGCTGCCGCGACGCGCTATTGAGAGGGAGGAGGGCCAGCTGCAGCTGTGTTCCCGTCATAGGGAGAGCTGA

>In-frame_CDK5RAP2_ENST00000360822_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_3822nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGCAGTACCATCCCACTGATATCACGGGC

>In-frame_CDK5RAP2_ENST00000359309_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_3870nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGAGCACCGGGGGTGGACGCGGCGCTTTG
CAAAACCAAAAAGACACAGTGCTGCCGCGACGCGCTATTGAGAGGGAGGAGGGCCAGCTGCAGCTGTGTTCCCGTCATAGGGAGAGCTGA

>In-frame_CDK5RAP2_ENST00000359309_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_3822nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGCAGTACCATCCCACTGATATCACGGGC

>In-frame_CDK5RAP2_ENST00000349780_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_3870nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGAGCACCGGGGGTGGACGCGGCGCTTTG
CAAAACCAAAAAGACACAGTGCTGCCGCGACGCGCTATTGAGAGGGAGGAGGGCCAGCTGCAGCTGTGTTCCCGTCATAGGGAGAGCTGA

>In-frame_CDK5RAP2_ENST00000349780_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_3822nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGCAGTACCATCCCACTGATATCACGGGC

>In-frame_CDK5RAP2_ENST00000360190_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_3870nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGAGCACCGGGGGTGGACGCGGCGCTTTG
CAAAACCAAAAAGACACAGTGCTGCCGCGACGCGCTATTGAGAGGGAGGAGGGCCAGCTGCAGCTGTGTTCCCGTCATAGGGAGAGCTGA

>In-frame_CDK5RAP2_ENST00000360190_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_3822nt
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGCAGTACCATCCCACTGATATCACGGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDK5RAP2_ENST00000360822_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_5279nt
AGGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGC
GGGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGC
CATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCT
GGATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACAT
GAAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACA
GGAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAG
AGAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCG
AAAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAA
GGCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTT
GGCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCT
TAAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAA
GGAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAG
AGAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAA
GGAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGAC
CCAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAA
GAGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAA
GGACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAA
CGACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTC
GGACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAG
CTGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTC
CAAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCAT
CATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGT
CGGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGC
CCACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGT
GGGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGA
GTTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGG
CACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAA
GATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGA
CCCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTG
CATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCG
GGTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCAT
AAACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAG
CACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCT
GCTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTT
CTCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTT
TGCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGA
CCCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCT
GAGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTT
CATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGG
CATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGA
CAAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCT
GGTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCA
GCTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCAC
ATTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGAGCACCGGGGGTGGACGCGGCGCTTT
GCAAAACCAAAAAGACACAGTGCTGCCGCGACGCGCTATTGAGAGGGAGGAGGGCCAGCTGCAGCTGTGTTCCCGTCATAGGGAGAGCTG
AGACTCCCCGCCCGCCCTCCTCTGCCCCCTCCCCCGCAGACAGACAGACAGACGGACGGGACAGCGGCCCGGCCCACGCAGAGCCCCGGA
GCACCACGGGGTCGGGGGAGGAGCACCCCCAGCCTCCCCCAGGCTGCGCCTGCCCGCCCGCCGGTTGGCCGGCTGGCCGGTCCACCCCGT
CCCGGCCCCGCGCGTGCCCCCAGCGTGGGGCTAACGGGCGCCTTGTCTGTGTATTTCTATTTTGCAGCAGTACCATCCCACTGATATCAC
GGGCCCGCTCAACCTCTCAGATCCCTCGGTCAGCACCGTGGTGTGAGGCCCCCGGAGGCGCCCACCTGCCCAGTTAGCCCGGCCAAGGAC
ACTGATGGGTCCTGCTGCTCGGGAAGGCCTGAGGGAAGCCCACCCGCCCCAGAGACTGCCCACCCTGGGCCTCCCGTCCGTCCGCCCGCC
CACCCCGCTGCCTGGCGGGCAGCCCCTGCTGGACCAAGGTGCGGACCGGAGCGGCTGAGGACGGGGCAGAGCTGAGTCGGCTGGGCAGGG
CCGCAGGGCGCTCCGGCAGAGGCAGGGCCCTGGGGTCTCTGAGCAGTGGGGAGCGGGGGCTAACTGGCCCCAGGCGGAGGGGCTTGGAGC
AGAGACGGCAGCCCCATCCTTCCCGCAGCACCAGCCTGAGCCACAGTGGGGCCCATGGCCCCAGCTGGCTGGGTCGCCCCTCCTCGGGCG
CCTGCGCTCCTCTGCAGCCTGAGCTCCACCCTCCCCTCTTCTTGCGGCACCGCCCACCCACACCCCGTCTGCCCCTTGACCCCACACGCC
GGGGCTGGCCCTGCCCTCCCCCACGGCCGTCCCTGACTTCCCAGCTGGCAGCGCCTCCCGCCGCCTCGGGCCGCCTCCTCCAGACTCGAG
AGGGCTGAGCCCCTCCTCTCCTCGTCCGGCCTGCAGCCCAGAACGGGCCTCCCCGGGGGTCCCCGGACGCTGGCTCGGGACTGTCTTCAA
CCCTGCCCTGCACCTTGGGCACGGGAGAGCGCCACCCGCCCGCCCCCGCCCTCGCTCCGGGTGCGTGACCGGCCCGCCACCTTGTACAGA
ACCAGCACTCCCAGGGCCCGAGCGCGTGCCTTCCCCGTGCGGCCCGTGCGCAGCCGCGCTCTGCCCCTCCGTCCCCAGGGTGCAGGCGCG

>In-frame_CDK5RAP2_ENST00000360822_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_4916nt
AGGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGC
GGGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGC
CATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCT
GGATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACAT
GAAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACA
GGAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAG
AGAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCG
AAAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAA
GGCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTT
GGCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCT
TAAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAA
GGAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAG
AGAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAA
GGAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGAC
CCAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAA
GAGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAA
GGACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAA
CGACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTC
GGACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAG
CTGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTC
CAAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCAT
CATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGT
CGGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGC
CCACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGT
GGGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGA
GTTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGG
CACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAA
GATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGA
CCCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTG
CATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCG
GGTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCAT
AAACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAG
CACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCT
GCTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTT
CTCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTT
TGCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGA
CCCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCT
GAGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTT
CATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGG
CATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGA
CAAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCT
GGTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCA
GCTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCAC
ATTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGCAGTACCATCCCACTGATATCACGGG
CCCGCTCAACCTCTCAGATCCCTCGGTCAGCACCGTGGTGTGAGGCCCCCGGAGGCGCCCACCTGCCCAGTTAGCCCGGCCAAGGACACT
GATGGGTCCTGCTGCTCGGGAAGGCCTGAGGGAAGCCCACCCGCCCCAGAGACTGCCCACCCTGGGCCTCCCGTCCGTCCGCCCGCCCAC
CCCGCTGCCTGGCGGGCAGCCCCTGCTGGACCAAGGTGCGGACCGGAGCGGCTGAGGACGGGGCAGAGCTGAGTCGGCTGGGCAGGGCCG
CAGGGCGCTCCGGCAGAGGCAGGGCCCTGGGGTCTCTGAGCAGTGGGGAGCGGGGGCTAACTGGCCCCAGGCGGAGGGGCTTGGAGCAGA
GACGGCAGCCCCATCCTTCCCGCAGCACCAGCCTGAGCCACAGTGGGGCCCATGGCCCCAGCTGGCTGGGTCGCCCCTCCTCGGGCGCCT
GCGCTCCTCTGCAGCCTGAGCTCCACCCTCCCCTCTTCTTGCGGCACCGCCCACCCACACCCCGTCTGCCCCTTGACCCCACACGCCGGG
GCTGGCCCTGCCCTCCCCCACGGCCGTCCCTGACTTCCCAGCTGGCAGCGCCTCCCGCCGCCTCGGGCCGCCTCCTCCAGACTCGAGAGG
GCTGAGCCCCTCCTCTCCTCGTCCGGCCTGCAGCCCAGAACGGGCCTCCCCGGGGGTCCCCGGACGCTGGCTCGGGACTGTCTTCAACCC
TGCCCTGCACCTTGGGCACGGGAGAGCGCCACCCGCCCGCCCCCGCCCTCGCTCCGGGTGCGTGACCGGCCCGCCACCTTGTACAGAACC
AGCACTCCCAGGGCCCGAGCGCGTGCCTTCCCCGTGCGGCCCGTGCGCAGCCGCGCTCTGCCCCTCCGTCCCCAGGGTGCAGGCGCGCAC

>In-frame_CDK5RAP2_ENST00000359309_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_5279nt
AGGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGC
GGGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGC
CATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCT
GGATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACAT
GAAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACA
GGAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAG
AGAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCG
AAAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAA
GGCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTT
GGCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCT
TAAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAA
GGAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAG
AGAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAA
GGAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGAC
CCAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAA
GAGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAA
GGACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAA
CGACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTC
GGACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAG
CTGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTC
CAAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCAT
CATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGT
CGGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGC
CCACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGT
GGGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGA
GTTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGG
CACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAA
GATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGA
CCCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTG
CATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCG
GGTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCAT
AAACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAG
CACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCT
GCTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTT
CTCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTT
TGCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGA
CCCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCT
GAGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTT
CATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGG
CATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGA
CAAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCT
GGTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCA
GCTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCAC
ATTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGAGCACCGGGGGTGGACGCGGCGCTTT
GCAAAACCAAAAAGACACAGTGCTGCCGCGACGCGCTATTGAGAGGGAGGAGGGCCAGCTGCAGCTGTGTTCCCGTCATAGGGAGAGCTG
AGACTCCCCGCCCGCCCTCCTCTGCCCCCTCCCCCGCAGACAGACAGACAGACGGACGGGACAGCGGCCCGGCCCACGCAGAGCCCCGGA
GCACCACGGGGTCGGGGGAGGAGCACCCCCAGCCTCCCCCAGGCTGCGCCTGCCCGCCCGCCGGTTGGCCGGCTGGCCGGTCCACCCCGT
CCCGGCCCCGCGCGTGCCCCCAGCGTGGGGCTAACGGGCGCCTTGTCTGTGTATTTCTATTTTGCAGCAGTACCATCCCACTGATATCAC
GGGCCCGCTCAACCTCTCAGATCCCTCGGTCAGCACCGTGGTGTGAGGCCCCCGGAGGCGCCCACCTGCCCAGTTAGCCCGGCCAAGGAC
ACTGATGGGTCCTGCTGCTCGGGAAGGCCTGAGGGAAGCCCACCCGCCCCAGAGACTGCCCACCCTGGGCCTCCCGTCCGTCCGCCCGCC
CACCCCGCTGCCTGGCGGGCAGCCCCTGCTGGACCAAGGTGCGGACCGGAGCGGCTGAGGACGGGGCAGAGCTGAGTCGGCTGGGCAGGG
CCGCAGGGCGCTCCGGCAGAGGCAGGGCCCTGGGGTCTCTGAGCAGTGGGGAGCGGGGGCTAACTGGCCCCAGGCGGAGGGGCTTGGAGC
AGAGACGGCAGCCCCATCCTTCCCGCAGCACCAGCCTGAGCCACAGTGGGGCCCATGGCCCCAGCTGGCTGGGTCGCCCCTCCTCGGGCG
CCTGCGCTCCTCTGCAGCCTGAGCTCCACCCTCCCCTCTTCTTGCGGCACCGCCCACCCACACCCCGTCTGCCCCTTGACCCCACACGCC
GGGGCTGGCCCTGCCCTCCCCCACGGCCGTCCCTGACTTCCCAGCTGGCAGCGCCTCCCGCCGCCTCGGGCCGCCTCCTCCAGACTCGAG
AGGGCTGAGCCCCTCCTCTCCTCGTCCGGCCTGCAGCCCAGAACGGGCCTCCCCGGGGGTCCCCGGACGCTGGCTCGGGACTGTCTTCAA
CCCTGCCCTGCACCTTGGGCACGGGAGAGCGCCACCCGCCCGCCCCCGCCCTCGCTCCGGGTGCGTGACCGGCCCGCCACCTTGTACAGA
ACCAGCACTCCCAGGGCCCGAGCGCGTGCCTTCCCCGTGCGGCCCGTGCGCAGCCGCGCTCTGCCCCTCCGTCCCCAGGGTGCAGGCGCG

>In-frame_CDK5RAP2_ENST00000359309_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_4916nt
AGGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGC
GGGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGC
CATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCT
GGATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACAT
GAAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACA
GGAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAG
AGAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCG
AAAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAA
GGCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTT
GGCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCT
TAAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAA
GGAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAG
AGAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAA
GGAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGAC
CCAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAA
GAGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAA
GGACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAA
CGACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTC
GGACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAG
CTGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTC
CAAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCAT
CATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGT
CGGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGC
CCACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGT
GGGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGA
GTTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGG
CACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAA
GATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGA
CCCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTG
CATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCG
GGTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCAT
AAACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAG
CACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCT
GCTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTT
CTCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTT
TGCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGA
CCCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCT
GAGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTT
CATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGG
CATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGA
CAAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCT
GGTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCA
GCTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCAC
ATTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGCAGTACCATCCCACTGATATCACGGG
CCCGCTCAACCTCTCAGATCCCTCGGTCAGCACCGTGGTGTGAGGCCCCCGGAGGCGCCCACCTGCCCAGTTAGCCCGGCCAAGGACACT
GATGGGTCCTGCTGCTCGGGAAGGCCTGAGGGAAGCCCACCCGCCCCAGAGACTGCCCACCCTGGGCCTCCCGTCCGTCCGCCCGCCCAC
CCCGCTGCCTGGCGGGCAGCCCCTGCTGGACCAAGGTGCGGACCGGAGCGGCTGAGGACGGGGCAGAGCTGAGTCGGCTGGGCAGGGCCG
CAGGGCGCTCCGGCAGAGGCAGGGCCCTGGGGTCTCTGAGCAGTGGGGAGCGGGGGCTAACTGGCCCCAGGCGGAGGGGCTTGGAGCAGA
GACGGCAGCCCCATCCTTCCCGCAGCACCAGCCTGAGCCACAGTGGGGCCCATGGCCCCAGCTGGCTGGGTCGCCCCTCCTCGGGCGCCT
GCGCTCCTCTGCAGCCTGAGCTCCACCCTCCCCTCTTCTTGCGGCACCGCCCACCCACACCCCGTCTGCCCCTTGACCCCACACGCCGGG
GCTGGCCCTGCCCTCCCCCACGGCCGTCCCTGACTTCCCAGCTGGCAGCGCCTCCCGCCGCCTCGGGCCGCCTCCTCCAGACTCGAGAGG
GCTGAGCCCCTCCTCTCCTCGTCCGGCCTGCAGCCCAGAACGGGCCTCCCCGGGGGTCCCCGGACGCTGGCTCGGGACTGTCTTCAACCC
TGCCCTGCACCTTGGGCACGGGAGAGCGCCACCCGCCCGCCCCCGCCCTCGCTCCGGGTGCGTGACCGGCCCGCCACCTTGTACAGAACC
AGCACTCCCAGGGCCCGAGCGCGTGCCTTCCCCGTGCGGCCCGTGCGCAGCCGCGCTCTGCCCCTCCGTCCCCAGGGTGCAGGCGCGCAC

>In-frame_CDK5RAP2_ENST00000349780_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_5278nt
GGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGCG
GGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGCC
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGAGCACCGGGGGTGGACGCGGCGCTTTG
CAAAACCAAAAAGACACAGTGCTGCCGCGACGCGCTATTGAGAGGGAGGAGGGCCAGCTGCAGCTGTGTTCCCGTCATAGGGAGAGCTGA
GACTCCCCGCCCGCCCTCCTCTGCCCCCTCCCCCGCAGACAGACAGACAGACGGACGGGACAGCGGCCCGGCCCACGCAGAGCCCCGGAG
CACCACGGGGTCGGGGGAGGAGCACCCCCAGCCTCCCCCAGGCTGCGCCTGCCCGCCCGCCGGTTGGCCGGCTGGCCGGTCCACCCCGTC
CCGGCCCCGCGCGTGCCCCCAGCGTGGGGCTAACGGGCGCCTTGTCTGTGTATTTCTATTTTGCAGCAGTACCATCCCACTGATATCACG
GGCCCGCTCAACCTCTCAGATCCCTCGGTCAGCACCGTGGTGTGAGGCCCCCGGAGGCGCCCACCTGCCCAGTTAGCCCGGCCAAGGACA
CTGATGGGTCCTGCTGCTCGGGAAGGCCTGAGGGAAGCCCACCCGCCCCAGAGACTGCCCACCCTGGGCCTCCCGTCCGTCCGCCCGCCC
ACCCCGCTGCCTGGCGGGCAGCCCCTGCTGGACCAAGGTGCGGACCGGAGCGGCTGAGGACGGGGCAGAGCTGAGTCGGCTGGGCAGGGC
CGCAGGGCGCTCCGGCAGAGGCAGGGCCCTGGGGTCTCTGAGCAGTGGGGAGCGGGGGCTAACTGGCCCCAGGCGGAGGGGCTTGGAGCA
GAGACGGCAGCCCCATCCTTCCCGCAGCACCAGCCTGAGCCACAGTGGGGCCCATGGCCCCAGCTGGCTGGGTCGCCCCTCCTCGGGCGC
CTGCGCTCCTCTGCAGCCTGAGCTCCACCCTCCCCTCTTCTTGCGGCACCGCCCACCCACACCCCGTCTGCCCCTTGACCCCACACGCCG
GGGCTGGCCCTGCCCTCCCCCACGGCCGTCCCTGACTTCCCAGCTGGCAGCGCCTCCCGCCGCCTCGGGCCGCCTCCTCCAGACTCGAGA
GGGCTGAGCCCCTCCTCTCCTCGTCCGGCCTGCAGCCCAGAACGGGCCTCCCCGGGGGTCCCCGGACGCTGGCTCGGGACTGTCTTCAAC
CCTGCCCTGCACCTTGGGCACGGGAGAGCGCCACCCGCCCGCCCCCGCCCTCGCTCCGGGTGCGTGACCGGCCCGCCACCTTGTACAGAA
CCAGCACTCCCAGGGCCCGAGCGCGTGCCTTCCCCGTGCGGCCCGTGCGCAGCCGCGCTCTGCCCCTCCGTCCCCAGGGTGCAGGCGCGC

>In-frame_CDK5RAP2_ENST00000349780_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_4915nt
GGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGCG
GGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGCC
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGCAGTACCATCCCACTGATATCACGGGC
CCGCTCAACCTCTCAGATCCCTCGGTCAGCACCGTGGTGTGAGGCCCCCGGAGGCGCCCACCTGCCCAGTTAGCCCGGCCAAGGACACTG
ATGGGTCCTGCTGCTCGGGAAGGCCTGAGGGAAGCCCACCCGCCCCAGAGACTGCCCACCCTGGGCCTCCCGTCCGTCCGCCCGCCCACC
CCGCTGCCTGGCGGGCAGCCCCTGCTGGACCAAGGTGCGGACCGGAGCGGCTGAGGACGGGGCAGAGCTGAGTCGGCTGGGCAGGGCCGC
AGGGCGCTCCGGCAGAGGCAGGGCCCTGGGGTCTCTGAGCAGTGGGGAGCGGGGGCTAACTGGCCCCAGGCGGAGGGGCTTGGAGCAGAG
ACGGCAGCCCCATCCTTCCCGCAGCACCAGCCTGAGCCACAGTGGGGCCCATGGCCCCAGCTGGCTGGGTCGCCCCTCCTCGGGCGCCTG
CGCTCCTCTGCAGCCTGAGCTCCACCCTCCCCTCTTCTTGCGGCACCGCCCACCCACACCCCGTCTGCCCCTTGACCCCACACGCCGGGG
CTGGCCCTGCCCTCCCCCACGGCCGTCCCTGACTTCCCAGCTGGCAGCGCCTCCCGCCGCCTCGGGCCGCCTCCTCCAGACTCGAGAGGG
CTGAGCCCCTCCTCTCCTCGTCCGGCCTGCAGCCCAGAACGGGCCTCCCCGGGGGTCCCCGGACGCTGGCTCGGGACTGTCTTCAACCCT
GCCCTGCACCTTGGGCACGGGAGAGCGCCACCCGCCCGCCCCCGCCCTCGCTCCGGGTGCGTGACCGGCCCGCCACCTTGTACAGAACCA
GCACTCCCAGGGCCCGAGCGCGTGCCTTCCCCGTGCGGCCCGTGCGCAGCCGCGCTCTGCCCCTCCGTCCCCAGGGTGCAGGCGCGCACC

>In-frame_CDK5RAP2_ENST00000360190_chr9_123280705_-_GRIN1_ENST00000371561_chr9_140036465_+_5278nt
GGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGCG
GGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGCC
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGAGCACCGGGGGTGGACGCGGCGCTTTG
CAAAACCAAAAAGACACAGTGCTGCCGCGACGCGCTATTGAGAGGGAGGAGGGCCAGCTGCAGCTGTGTTCCCGTCATAGGGAGAGCTGA
GACTCCCCGCCCGCCCTCCTCTGCCCCCTCCCCCGCAGACAGACAGACAGACGGACGGGACAGCGGCCCGGCCCACGCAGAGCCCCGGAG
CACCACGGGGTCGGGGGAGGAGCACCCCCAGCCTCCCCCAGGCTGCGCCTGCCCGCCCGCCGGTTGGCCGGCTGGCCGGTCCACCCCGTC
CCGGCCCCGCGCGTGCCCCCAGCGTGGGGCTAACGGGCGCCTTGTCTGTGTATTTCTATTTTGCAGCAGTACCATCCCACTGATATCACG
GGCCCGCTCAACCTCTCAGATCCCTCGGTCAGCACCGTGGTGTGAGGCCCCCGGAGGCGCCCACCTGCCCAGTTAGCCCGGCCAAGGACA
CTGATGGGTCCTGCTGCTCGGGAAGGCCTGAGGGAAGCCCACCCGCCCCAGAGACTGCCCACCCTGGGCCTCCCGTCCGTCCGCCCGCCC
ACCCCGCTGCCTGGCGGGCAGCCCCTGCTGGACCAAGGTGCGGACCGGAGCGGCTGAGGACGGGGCAGAGCTGAGTCGGCTGGGCAGGGC
CGCAGGGCGCTCCGGCAGAGGCAGGGCCCTGGGGTCTCTGAGCAGTGGGGAGCGGGGGCTAACTGGCCCCAGGCGGAGGGGCTTGGAGCA
GAGACGGCAGCCCCATCCTTCCCGCAGCACCAGCCTGAGCCACAGTGGGGCCCATGGCCCCAGCTGGCTGGGTCGCCCCTCCTCGGGCGC
CTGCGCTCCTCTGCAGCCTGAGCTCCACCCTCCCCTCTTCTTGCGGCACCGCCCACCCACACCCCGTCTGCCCCTTGACCCCACACGCCG
GGGCTGGCCCTGCCCTCCCCCACGGCCGTCCCTGACTTCCCAGCTGGCAGCGCCTCCCGCCGCCTCGGGCCGCCTCCTCCAGACTCGAGA
GGGCTGAGCCCCTCCTCTCCTCGTCCGGCCTGCAGCCCAGAACGGGCCTCCCCGGGGGTCCCCGGACGCTGGCTCGGGACTGTCTTCAAC
CCTGCCCTGCACCTTGGGCACGGGAGAGCGCCACCCGCCCGCCCCCGCCCTCGCTCCGGGTGCGTGACCGGCCCGCCACCTTGTACAGAA
CCAGCACTCCCAGGGCCCGAGCGCGTGCCTTCCCCGTGCGGCCCGTGCGCAGCCGCGCTCTGCCCCTCCGTCCCCAGGGTGCAGGCGCGC

>In-frame_CDK5RAP2_ENST00000360190_chr9_123280705_-_GRIN1_ENST00000315048_chr9_140036465_+_4915nt
GGAAGAAGCGCCGGGAAAGATGGCGGCGTCTGTGGTTTGAATTCCAGCGGCGCCGCCAGAGTCTGAACAAGAGCTGGGGTGGAGGGGGCG
GGGACCTGGGGAGCCCGGCGGGTCGCTATCGCGGGGGGTACTAGTGGCGCCGCCGCCACAGACACCAACGCTGTCGCCACCTCTGTAGCC
ATGATGGACTTGGTGTTGGAAGAGGACGTCACCGTCCCTGGGACGCTCAGCGGCTGCAGTGGCCTTGTTCCCAGTGTACCAGATGACCTG
GATGGCATCAACCCCAATGCTGGGTTGGGAAATGGTCTGCTCCCAAATGTGTCAGAAGAAACAGTGTCTCCCACCAGAGCACGGAACATG
AAGGACTTTGAAAATCAAATCACTGAATTGAAGAAAGAAAACTTTAACCTAAAGCTCCGCATCTATTTCCTTGAGGAAAGAATGCAACAG
GAATTTCATGGCCCCACTGAACATATCTACAAAACTAACATTGAGCTCAAGGTGGAAGTAGAAAGTCTGAAGCGGGAACTCCAGGAGAGA
GAGCAGCTGCTCATCAAAGCCTCCAAAGCAGTTGAGAGCTTAGCTGAAGCAGGTGGCTCTGAAATCCAGCGGGTGAAAGAAGATGCTCGA
AAGAAGGTGCAGCAGGTGGAAGATCTCCTAACTAAAAGAATACTCCTTTTGGAAAAGGATGTGACAGCCGCCCAGGCAGAACTGGAAAAG
GCCTTTGCAGGGACAGAGACGGAGAAGGCTCTTCGGTTGCGTTTGGAAAGCAAGCTTTCAGAGATGAAGAAGATGCACGAGGGGGACTTG
GCGATGGCTCTGGTCCTGGATGAGAAAGACAGACTGATTGAGGAGTTGAAGCTGTCTTTGAAGAGCAAAGAAGCTTTAATTCAGTGCCTT
AAAGAGGAGAAATCTCAGATGGCATGTCCTGATGAGAATGTGTCATCTGGAGAGCTCCGAGGACTTTGTGCTGCTCCAAGGGAAGAAAAG
GAGAGAGAAACTGAGGCTGCACAAATGGAGCATCAGAAGGAGAGAAACAGCTTTGAAGAGAGGATCCAGGCACTTGAAGAGGACCTGAGA
GAGAAGGAAAGAGAAATTGCTACAGAGAAGAAAAATAGTCTAAAGAGGGATAAAGCCATTCAGGGTTTAACCATGGCATTAAAATCAAAG
GAAAAAAAGGTTGAAGAACTTAACTCTGAAATTGAAAAGCTCAGTGCTGCCTTTGCTAAAGCCAGAGAGGCCCTACAGAAAGCACAGACC
CAGGAATTTCAGGGGTCTGAAGACTATGAGACTGCTCTATCAGGAAAGGAAGCCCTTTCGGCTGCGCTGCGCTCACAAAACCTCACCAAG
AGTACAGAGAACCACAGACTGCGTAGAAGCATTAAGAAGATCACCCAGGAGCTGAGTGACTTGCAGCAGGAGAGGGAGAGACTGGAGAAG
GACCTGGAGGAAGCCCATCGAGAGAAGAGCAAAGGAGACTGCACCATCCGTGTCTACGCCATCCTAGTTAGCCATCCACCTACCCCCAAC
GACCACTTCACTCCCACCCCTGTCTCCTACACAGCCGGCTTCTACCGCATACCCGTGCTGGGGCTGACCACCCGCATGTCCATCTACTCG
GACAAGAGCATCCACCTGAGCTTCCTGCGCACCGTGCCGCCCTACTCCCACCAGTCCAGCGTGTGGTTTGAGATGATGCGTGTCTACAGC
TGGAACCACATCATCCTGCTGGTCAGCGACGACCACGAGGGCCGGGCGGCTCAGAAACGCCTGGAGACGCTGCTGGAGGAGCGTGAGTCC
AAGGCAGAGAAGGTGCTGCAGTTTGACCCAGGGACCAAGAACGTGACGGCCCTGCTGATGGAGGCGAAAGAGCTGGAGGCCCGGGTCATC
ATCCTTTCTGCCAGCGAGGACGATGCTGCCACTGTATACCGCGCAGCCGCGATGCTGAACATGACGGGCTCCGGGTACGTGTGGCTGGTC
GGCGAGCGCGAGATCTCGGGGAACGCCCTGCGCTACGCCCCAGACGGCATCCTCGGGCTGCAGCTCATCAACGGCAAGAACGAGTCGGCC
CACATCAGCGACGCCGTGGGCGTGGTGGCCCAGGCCGTGCACGAGCTCCTCGAGAAGGAGAACATCACCGACCCGCCGCGGGGCTGCGTG
GGCAACACCAACATCTGGAAGACCGGGCCGCTCTTCAAGAGAGTGCTGATGTCTTCCAAGTATGCGGATGGGGTGACTGGTCGCGTGGAG
TTCAATGAGGATGGGGACCGGAAGTTCGCCAACTACAGCATCATGAACCTGCAGAACCGCAAGCTGGTGCAAGTGGGCATCTACAATGGC
ACCCACGTCATCCCTAATGACAGGAAGATCATCTGGCCAGGCGGAGAGACAGAGAAGCCTCGAGGGTACCAGATGTCCACCAGACTGAAG
ATTGTGACGATCCACCAGGAGCCCTTCGTGTACGTCAAGCCCACGCTGAGTGATGGGACATGCAAGGAGGAGTTCACAGTCAACGGCGAC
CCAGTCAAGAAGGTGATCTGCACCGGGCCCAACGACACGTCGCCGGGCAGCCCCCGCCACACGGTGCCTCAGTGTTGCTACGGCTTTTGC
ATCGACCTGCTCATCAAGCTGGCACGGACCATGAACTTCACCTACGAGGTGCACCTGGTGGCAGATGGCAAGTTCGGCACACAGGAGCGG
GTGAACAACAGCAACAAGAAGGAGTGGAATGGGATGATGGGCGAGCTGCTCAGCGGGCAGGCAGACATGATCGTGGCGCCGCTAACCATA
AACAACGAGCGCGCGCAGTACATCGAGTTTTCCAAGCCCTTCAAGTACCAGGGCCTGACTATTCTGGTCAAGAAGGAGATTCCCCGGAGC
ACGCTGGACTCGTTCATGCAGCCGTTCCAGAGCACACTGTGGCTGCTGGTGGGGCTGTCGGTGCACGTGGTGGCCGTGATGCTGTACCTG
CTGGACCGCTTCAGCCCCTTCGGCCGGTTCAAGGTGAACAGCGAGGAGGAGGAGGAGGACGCACTGACCCTGTCCTCGGCCATGTGGTTC
TCCTGGGGCGTCCTGCTCAACTCCGGCATCGGGGAAGGCGCCCCCAGAAGCTTCTCAGCGCGCATCCTGGGCATGGTGTGGGCCGGCTTT
GCCATGATCATCGTGGCCTCCTACACCGCCAACCTGGCGGCCTTCCTGGTGCTGGACCGGCCGGAGGAGCGCATCACGGGCATCAACGAC
CCTCGGCTGAGGAACCCCTCGGACAAGTTTATCTACGCCACGGTGAAGCAGAGCTCCGTGGATATCTACTTCCGGCGCCAGGTGGAGCTG
AGCACCATGTACCGGCATATGGAGAAGCACAACTACGAGAGTGCGGCGGAGGCCATCCAGGCCGTGAGAGACAACAAGCTGCATGCCTTC
ATCTGGGACTCGGCGGTGCTGGAGTTCGAGGCCTCGCAGAAGTGCGACCTGGTGACGACTGGAGAGCTGTTTTTCCGCTCGGGCTTCGGC
ATAGGCATGCGCAAAGACAGCCCCTGGAAGCAGAACGTCTCCCTGTCCATCCTCAAGTCCCACGAGAATGGCTTCATGGAAGACCTGGAC
AAGACGTGGGTTCGGTATCAGGAATGTGACTCGCGCAGCAACGCCCCTGCGACCCTTACTTTTGAGAACATGGCCGGGGTCTTCATGCTG
GTAGCTGGGGGCATCGTGGCCGGGATCTTCCTGATTTTCATCGAGATTGCCTACAAGCGGCACAAGGATGCTCGCCGGAAGCAGATGCAG
CTGGCCTTTGCCGCCGTTAACGTGTGGCGGAAGAACCTGCAGGATAGAAAGAGTGGTAGAGCAGAGCCTGACCCTAAAAAGAAAGCCACA
TTTAGGGCTATCACCTCCACCCTGGCTTCCAGCTTCAAGAGGCGTAGGTCCTCCAAAGACACGCAGTACCATCCCACTGATATCACGGGC
CCGCTCAACCTCTCAGATCCCTCGGTCAGCACCGTGGTGTGAGGCCCCCGGAGGCGCCCACCTGCCCAGTTAGCCCGGCCAAGGACACTG
ATGGGTCCTGCTGCTCGGGAAGGCCTGAGGGAAGCCCACCCGCCCCAGAGACTGCCCACCCTGGGCCTCCCGTCCGTCCGCCCGCCCACC
CCGCTGCCTGGCGGGCAGCCCCTGCTGGACCAAGGTGCGGACCGGAGCGGCTGAGGACGGGGCAGAGCTGAGTCGGCTGGGCAGGGCCGC
AGGGCGCTCCGGCAGAGGCAGGGCCCTGGGGTCTCTGAGCAGTGGGGAGCGGGGGCTAACTGGCCCCAGGCGGAGGGGCTTGGAGCAGAG
ACGGCAGCCCCATCCTTCCCGCAGCACCAGCCTGAGCCACAGTGGGGCCCATGGCCCCAGCTGGCTGGGTCGCCCCTCCTCGGGCGCCTG
CGCTCCTCTGCAGCCTGAGCTCCACCCTCCCCTCTTCTTGCGGCACCGCCCACCCACACCCCGTCTGCCCCTTGACCCCACACGCCGGGG
CTGGCCCTGCCCTCCCCCACGGCCGTCCCTGACTTCCCAGCTGGCAGCGCCTCCCGCCGCCTCGGGCCGCCTCCTCCAGACTCGAGAGGG
CTGAGCCCCTCCTCTCCTCGTCCGGCCTGCAGCCCAGAACGGGCCTCCCCGGGGGTCCCCGGACGCTGGCTCGGGACTGTCTTCAACCCT
GCCCTGCACCTTGGGCACGGGAGAGCGCCACCCGCCCGCCCCCGCCCTCGCTCCGGGTGCGTGACCGGCCCGCCACCTTGTACAGAACCA
GCACTCCCAGGGCCCGAGCGCGTGCCTTCCCCGTGCGGCCCGTGCGCAGCCGCGCTCTGCCCCTCCGTCCCCAGGGTGCAGGCGCGCACC


Top

FusionGenePPI for CDK5RAP2_GRIN1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDK5RAP2STARD9, MAGEH1, PTN, SENP2, ZPR1, C14orf1, HAP1, KAT5, LUC7L2, CRMP1, RBM48, EEF1G, CDK5R1, CDK5, ABCA2, STK36, TUBGCP6, TUBGCP5, TUBGCP2, TUBGCP3, NME7, MZT2A, MZT2B, TUBG1, PCNT, AKAP9, TSNAX, TRIM37, PCBD1, MAPRE1, FBXO25, PRKACA, PRKACB, SUZ12, SOCS6, MLF1, PRPS1, PRKAR2B, CARD9, DTNBP1, FGL2, C17orf59, CEP68, MUS81, PTTG1, PLK4, CEP192, CEP152, RPGRIP1L, DYNLL1, FGFR1OP, USP43, CHMP4B, SSH3, TPTE2, C1orf87, LPXN, PDE4DIP, IKBIP, LINC01587, FAM81B, SSX2, RALBP1, C6orf141GRIN1ND2, CACNG2, GRIN3B, GRIN2A, GRIN2B, GRIN3A, LNX1, SPTAN1, FYN, CAMK2G, PRKCA, CANX


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000349780-123858_1964371894NCKAP5L
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000359309-123758_1964371853NCKAP5L
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000360190-123758_1964371815NCKAP5L
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000360822-123758_1964371862NCKAP5L


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000349780-12381726_17684371894CDK5R1
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000359309-12371726_17684371853CDK5R1
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000360190-12371726_17684371815CDK5R1
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000360822-12371726_17684371862CDK5R1
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000349780-1238926_12084371894MAPRE1
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000359309-1237926_12084371853MAPRE1
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000360190-1237926_12084371815MAPRE1
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000360822-1237926_12084371862MAPRE1
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000349780-12381726_18934371894PCNT and AKAP9
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000359309-12371726_18934371853PCNT and AKAP9
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000360190-12371726_18934371815PCNT and AKAP9
HgeneCDK5RAP2chr9:123280705chr9:140036465ENST00000360822-12371726_18934371862PCNT and AKAP9


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDK5RAP2_GRIN1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneGRIN1Q05586DB00289AtomoxetineGlutamate receptor ionotropic, NMDA 1small moleculeapproved
TgeneGRIN1Q05586DB00454PethidineGlutamate receptor ionotropic, NMDA 1small moleculeapproved
TgeneGRIN1Q05586DB01173OrphenadrineGlutamate receptor ionotropic, NMDA 1small moleculeapproved
TgeneGRIN1Q05586DB00659AcamprosateGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational
TgeneGRIN1Q05586DB00996GabapentinGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational
TgeneGRIN1Q05586DB01043MemantineGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational
TgeneGRIN1Q05586DB01174PhenobarbitalGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational
TgeneGRIN1Q05586DB04896MilnacipranGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational
TgeneGRIN1Q05586DB06151AcetylcysteineGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational
TgeneGRIN1Q05586DB06738KetobemidoneGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational
TgeneGRIN1Q05586DB09481Magnesium carbonateGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational
TgeneGRIN1Q05586DB01708PrasteroneGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational|nutraceutical
TgeneGRIN1Q05586DB00312PentobarbitalGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational|vet_approved
TgeneGRIN1Q05586DB08954IfenprodilGlutamate receptor ionotropic, NMDA 1small moleculeapproved|investigational|withdrawn
TgeneGRIN1Q05586DB00142Glutamic AcidGlutamate receptor ionotropic, NMDA 1small moleculeapproved|nutraceutical
TgeneGRIN1Q05586DB00418SecobarbitalGlutamate receptor ionotropic, NMDA 1small moleculeapproved|vet_approved

Top

RelatedDiseases for CDK5RAP2_GRIN1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneGRIN1C0001973Alcoholic Intoxication, Chronic3PSYGENET
TgeneGRIN1C0005586Bipolar Disorder2PSYGENET
TgeneGRIN1C0236736Cocaine-Related Disorders2CTD_human
TgeneGRIN1C0020429Hyperalgesia1CTD_human
TgeneGRIN1C0030193Pain1CTD_human
TgeneGRIN1C0033975Psychotic Disorders1CTD_human
TgeneGRIN1C0040997Trigeminal Neuralgia1CTD_human
TgeneGRIN1C3280282MENTAL RETARDATION, AUTOSOMAL DOMINANT 81UNIPROT