FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6445

FusionGeneSummary for CDH1_NPFFR2

check button Fusion gene summary
Fusion gene informationFusion gene name: CDH1_NPFFR2
Fusion gene ID: 6445
HgeneTgene
Gene symbol

CDH1

NPFFR2

Gene ID

51343

10886

Gene namefizzy and cell division cycle 20 related 1neuropeptide FF receptor 2
SynonymsCDC20C|CDH1|FZR|FZR2|HCDH|HCDH1GPR74|HLWAR77|NPFF2|NPGPR
Cytomap

19p13.3

4q13.3

Type of geneprotein-codingprotein-coding
Descriptionfizzy-related protein homologCDC20 homolog 1CDC20-like 1bCDC20-like protein 1cdh1/Hct1 homologfizzy/cell division cycle 20 related 1neuropeptide FF receptor 2G-protein coupled receptor 74G-protein coupled receptor HLWAR77neuropeptide FF 2neuropeptide G-protein coupled receptor
Modification date2018051920180523
UniProtAcc

P12830

Q9Y5X5

Ensembl transtripts involved in fusion geneENST00000261769, ENST00000422392, 
ENST00000562836, 
ENST00000308744, 
ENST00000344413, ENST00000395999, 
ENST00000358749, ENST00000506359, 
Fusion gene scores* DoF score11 X 10 X 4=4402 X 1 X 2=4
# samples 132
** MAII scorelog2(13/440*10)=-1.7589919004962
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context

PubMed: CDH1 [Title/Abstract] AND NPFFR2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCDH1

GO:0031145

anaphase-promoting complex-dependent catabolic process

18662541|21596315

HgeneCDH1

GO:0072425

signal transduction involved in G2 DNA damage checkpoint

18662541

HgeneCDH1

GO:1904668

positive regulation of ubiquitin protein ligase activity

11459826


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AQ-A04L-01BCDH1chr16

68772314

+NPFFR2chr4

73003757

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000261769ENST00000308744CDH1chr16

68772314

+NPFFR2chr4

73003757

+
Frame-shiftENST00000261769ENST00000344413CDH1chr16

68772314

+NPFFR2chr4

73003757

+
In-frameENST00000261769ENST00000395999CDH1chr16

68772314

+NPFFR2chr4

73003757

+
In-frameENST00000261769ENST00000358749CDH1chr16

68772314

+NPFFR2chr4

73003757

+
5CDS-intronENST00000261769ENST00000506359CDH1chr16

68772314

+NPFFR2chr4

73003757

+
In-frameENST00000422392ENST00000308744CDH1chr16

68772314

+NPFFR2chr4

73003757

+
Frame-shiftENST00000422392ENST00000344413CDH1chr16

68772314

+NPFFR2chr4

73003757

+
In-frameENST00000422392ENST00000395999CDH1chr16

68772314

+NPFFR2chr4

73003757

+
In-frameENST00000422392ENST00000358749CDH1chr16

68772314

+NPFFR2chr4

73003757

+
5CDS-intronENST00000422392ENST00000506359CDH1chr16

68772314

+NPFFR2chr4

73003757

+
intron-3CDSENST00000562836ENST00000308744CDH1chr16

68772314

+NPFFR2chr4

73003757

+
intron-3CDSENST00000562836ENST00000344413CDH1chr16

68772314

+NPFFR2chr4

73003757

+
intron-3CDSENST00000562836ENST00000395999CDH1chr16

68772314

+NPFFR2chr4

73003757

+
intron-3CDSENST00000562836ENST00000358749CDH1chr16

68772314

+NPFFR2chr4

73003757

+
intron-intronENST00000562836ENST00000506359CDH1chr16

68772314

+NPFFR2chr4

73003757

+

Top

FusionProtFeatures for CDH1_NPFFR2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDH1

P12830

NPFFR2

Q9Y5X5

Cadherins are calcium-dependent cell adhesion proteins(PubMed:11976333). They preferentially interact with themselves ina homophilic manner in connecting cells; cadherins may thuscontribute to the sorting of heterogeneous cell types. CDH1 isinvolved in mechanisms regulating cell-cell adhesions, mobilityand proliferation of epithelial cells (PubMed:11976333). Has apotent invasive suppressor role. It is a ligand for integrinalpha-E/beta-7. {ECO:0000269|PubMed:11976333,ECO:0000269|PubMed:16417575}. E-Cad/CTF2 promotes non-amyloidogenic degradation ofAbeta precursors. Has a strong inhibitory effect on APP C99 andC83 production. {ECO:0000269|PubMed:16417575}. Receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide)neuropeptides, also known as morphine-modulating peptides. Canalso be activated by a variety of naturally occurring or syntheticFMRF-amide like ligands. This receptor mediates its action byassociation with G proteins that activate a phosphatidylinositol-calcium second messenger system.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14243_262211523Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14284_319211523Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14341_377211523Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14399_413211523Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14435_522211523Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03169_18499311Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03206_22199311Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03243_26299311Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03284_31999311Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03341_37799311Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03399_41399311Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03435_52299311Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14169_184109421Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14206_221109421Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14243_262109421Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14284_319109421Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14341_377109421Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14399_413109421Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14435_522109421Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25169_184112424Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25206_221112424Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25243_262112424Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25284_319112424Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25341_377112424Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25399_413112424Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25435_522112424Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14222_242211523TransmembraneHelical%3B Name%3D3
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14263_283211523TransmembraneHelical%3B Name%3D4
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14320_340211523TransmembraneHelical%3B Name%3D5
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14378_398211523TransmembraneHelical%3B Name%3D6
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14414_434211523TransmembraneHelical%3B Name%3D7
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03148_16899311TransmembraneHelical%3B Name%3D1
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03185_20599311TransmembraneHelical%3B Name%3D2
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03222_24299311TransmembraneHelical%3B Name%3D3
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03263_28399311TransmembraneHelical%3B Name%3D4
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03320_34099311TransmembraneHelical%3B Name%3D5
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03378_39899311TransmembraneHelical%3B Name%3D6
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+03414_43499311TransmembraneHelical%3B Name%3D7
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14148_168109421TransmembraneHelical%3B Name%3D1
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14185_205109421TransmembraneHelical%3B Name%3D2
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14222_242109421TransmembraneHelical%3B Name%3D3
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14263_283109421TransmembraneHelical%3B Name%3D4
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14320_340109421TransmembraneHelical%3B Name%3D5
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14378_398109421TransmembraneHelical%3B Name%3D6
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+14414_434109421TransmembraneHelical%3B Name%3D7
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25148_168112424TransmembraneHelical%3B Name%3D1
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25185_205112424TransmembraneHelical%3B Name%3D2
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25222_242112424TransmembraneHelical%3B Name%3D3
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25263_283112424TransmembraneHelical%3B Name%3D4
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25320_340112424TransmembraneHelical%3B Name%3D5
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25378_398112424TransmembraneHelical%3B Name%3D6
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+25414_434112424TransmembraneHelical%3B Name%3D7

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216838_85154883Compositional biasNote=Ser-rich
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216155_26254883DomainCadherin 1
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216263_37554883DomainCadherin 2
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216376_48654883DomainCadherin 3
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216487_59354883DomainCadherin 4
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216594_69754883DomainCadherin 5
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216758_76954883RegionNote=Required for binding CTNND1 and PSEN1
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216811_88254883RegionNote=Required for binding alpha%2C beta and gamma catenins
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216155_70954883Topological domainExtracellular
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216731_88254883Topological domainCytoplasmic
HgeneCDH1chr16:68772314chr4:73003757ENST00000261769+216710_73054883TransmembraneHelical
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14169_184211523Topological domainCytoplasmic
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+141_147211523Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14206_221211523Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000344413+031_14799311Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000358749+141_147109421Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000395999+251_147112424Topological domainExtracellular
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14148_168211523TransmembraneHelical%3B Name%3D1
TgeneNPFFR2chr16:68772314chr4:73003757ENST00000308744+14185_205211523TransmembraneHelical%3B Name%3D2


Top

FusionGeneSequence for CDH1_NPFFR2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDH1_ENST00000261769_chr16_68772314_+_NPFFR2_ENST00000308744_chr4_73003757_+_366aa
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQ
CVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLI
VIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGN
SSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT

>In-frame_CDH1_ENST00000261769_chr16_68772314_+_NPFFR2_ENST00000395999_chr4_73003757_+_366aa
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQ
CVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLI
VIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGN
SSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT

>In-frame_CDH1_ENST00000261769_chr16_68772314_+_NPFFR2_ENST00000358749_chr4_73003757_+_366aa
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQ
CVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLI
VIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGN
SSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT

>In-frame_CDH1_ENST00000422392_chr16_68772314_+_NPFFR2_ENST00000308744_chr4_73003757_+_366aa
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQ
CVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLI
VIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGN
SSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT

>In-frame_CDH1_ENST00000422392_chr16_68772314_+_NPFFR2_ENST00000395999_chr4_73003757_+_366aa
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQ
CVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLI
VIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGN
SSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT

>In-frame_CDH1_ENST00000422392_chr16_68772314_+_NPFFR2_ENST00000358749_chr4_73003757_+_366aa
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQ
CVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLI
VIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGN
SSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDH1_ENST00000261769_chr16_68772314_+_NPFFR2_ENST00000308744_chr4_73003757_+_1098nt
ATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCT
GGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGCCATTTGGAAAC
ACGATGTGCAAGATCAGTGGATTGGTCCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAGATAGGTTCCAG
TGTGTGGTCTACCCTTTTAAACCAAAGCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCATCACCATTATG
TCTCCATCTGCAGTAATGTTACATGTGCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTCCAGTCTACTGG
TGCCGGGAAGACTGGCCAAATCAGGAAATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCCTCTCCCTCATT
GTCATCATGTATGGAAGGATTGGAATTTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGTGGCACGTGGTG
TCCAGGAAGAAGCAGAAGATCATTAAGATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGACTCTAATGATG
CTCTCAGACTACGCTGACCTTTCTCCAAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGGCATTCGGCAAC
AGCAGTGTCAATCCCATCATTTATGGTTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGCTCTGCCAAAAA
AGAGCAAAGCCTATGGAAGCTTATGCCCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGGAATCTACATTT
CAAAACCCTCATGGGGAAACCTTGCTTTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAAAAGAAACTACT

>In-frame_CDH1_ENST00000261769_chr16_68772314_+_NPFFR2_ENST00000395999_chr4_73003757_+_1098nt
ATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCT
GGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGCCATTTGGAAAC
ACGATGTGCAAGATCAGTGGATTGGTCCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAGATAGGTTCCAG
TGTGTGGTCTACCCTTTTAAACCAAAGCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCATCACCATTATG
TCTCCATCTGCAGTAATGTTACATGTGCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTCCAGTCTACTGG
TGCCGGGAAGACTGGCCAAATCAGGAAATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCCTCTCCCTCATT
GTCATCATGTATGGAAGGATTGGAATTTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGTGGCACGTGGTG
TCCAGGAAGAAGCAGAAGATCATTAAGATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGACTCTAATGATG
CTCTCAGACTACGCTGACCTTTCTCCAAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGGCATTCGGCAAC
AGCAGTGTCAATCCCATCATTTATGGTTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGCTCTGCCAAAAA
AGAGCAAAGCCTATGGAAGCTTATGCCCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGGAATCTACATTT
CAAAACCCTCATGGGGAAACCTTGCTTTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAAAAGAAACTACT

>In-frame_CDH1_ENST00000261769_chr16_68772314_+_NPFFR2_ENST00000358749_chr4_73003757_+_1098nt
ATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCT
GGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGCCATTTGGAAAC
ACGATGTGCAAGATCAGTGGATTGGTCCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAGATAGGTTCCAG
TGTGTGGTCTACCCTTTTAAACCAAAGCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCATCACCATTATG
TCTCCATCTGCAGTAATGTTACATGTGCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTCCAGTCTACTGG
TGCCGGGAAGACTGGCCAAATCAGGAAATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCCTCTCCCTCATT
GTCATCATGTATGGAAGGATTGGAATTTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGTGGCACGTGGTG
TCCAGGAAGAAGCAGAAGATCATTAAGATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGACTCTAATGATG
CTCTCAGACTACGCTGACCTTTCTCCAAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGGCATTCGGCAAC
AGCAGTGTCAATCCCATCATTTATGGTTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGCTCTGCCAAAAA
AGAGCAAAGCCTATGGAAGCTTATGCCCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGGAATCTACATTT
CAAAACCCTCATGGGGAAACCTTGCTTTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAAAAGAAACTACT

>In-frame_CDH1_ENST00000422392_chr16_68772314_+_NPFFR2_ENST00000308744_chr4_73003757_+_1098nt
ATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCT
GGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGCCATTTGGAAAC
ACGATGTGCAAGATCAGTGGATTGGTCCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAGATAGGTTCCAG
TGTGTGGTCTACCCTTTTAAACCAAAGCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCATCACCATTATG
TCTCCATCTGCAGTAATGTTACATGTGCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTCCAGTCTACTGG
TGCCGGGAAGACTGGCCAAATCAGGAAATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCCTCTCCCTCATT
GTCATCATGTATGGAAGGATTGGAATTTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGTGGCACGTGGTG
TCCAGGAAGAAGCAGAAGATCATTAAGATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGACTCTAATGATG
CTCTCAGACTACGCTGACCTTTCTCCAAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGGCATTCGGCAAC
AGCAGTGTCAATCCCATCATTTATGGTTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGCTCTGCCAAAAA
AGAGCAAAGCCTATGGAAGCTTATGCCCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGGAATCTACATTT
CAAAACCCTCATGGGGAAACCTTGCTTTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAAAAGAAACTACT

>In-frame_CDH1_ENST00000422392_chr16_68772314_+_NPFFR2_ENST00000395999_chr4_73003757_+_1098nt
ATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCT
GGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGCCATTTGGAAAC
ACGATGTGCAAGATCAGTGGATTGGTCCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAGATAGGTTCCAG
TGTGTGGTCTACCCTTTTAAACCAAAGCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCATCACCATTATG
TCTCCATCTGCAGTAATGTTACATGTGCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTCCAGTCTACTGG
TGCCGGGAAGACTGGCCAAATCAGGAAATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCCTCTCCCTCATT
GTCATCATGTATGGAAGGATTGGAATTTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGTGGCACGTGGTG
TCCAGGAAGAAGCAGAAGATCATTAAGATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGACTCTAATGATG
CTCTCAGACTACGCTGACCTTTCTCCAAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGGCATTCGGCAAC
AGCAGTGTCAATCCCATCATTTATGGTTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGCTCTGCCAAAAA
AGAGCAAAGCCTATGGAAGCTTATGCCCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGGAATCTACATTT
CAAAACCCTCATGGGGAAACCTTGCTTTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAAAAGAAACTACT

>In-frame_CDH1_ENST00000422392_chr16_68772314_+_NPFFR2_ENST00000358749_chr4_73003757_+_1098nt
ATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCT
GGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGCCATTTGGAAAC
ACGATGTGCAAGATCAGTGGATTGGTCCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAGATAGGTTCCAG
TGTGTGGTCTACCCTTTTAAACCAAAGCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCATCACCATTATG
TCTCCATCTGCAGTAATGTTACATGTGCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTCCAGTCTACTGG
TGCCGGGAAGACTGGCCAAATCAGGAAATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCCTCTCCCTCATT
GTCATCATGTATGGAAGGATTGGAATTTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGTGGCACGTGGTG
TCCAGGAAGAAGCAGAAGATCATTAAGATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGACTCTAATGATG
CTCTCAGACTACGCTGACCTTTCTCCAAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGGCATTCGGCAAC
AGCAGTGTCAATCCCATCATTTATGGTTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGCTCTGCCAAAAA
AGAGCAAAGCCTATGGAAGCTTATGCCCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGGAATCTACATTT
CAAAACCCTCATGGGGAAACCTTGCTTTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAAAAGAAACTACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDH1_ENST00000261769_chr16_68772314_+_NPFFR2_ENST00000308744_chr4_73003757_+_1544nt
AGCCAATCAGCGGTACGGGGGGCGGTGCCTCCGGGGCTCACCTGGCTGCAGCCACGCACCCCCTCTCAGTGGCGTCGGAACTGCAAAGCA
CCTGTGAGCTTGCGGAAGTCAGTTCAGACTCCAGCCCGCTCCAGCCCGGCCCGACCCGACCGCACCCGGCGCCTGCCCTCGCTCGGCGTC
CCCGGCCAGCCATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGC
CCTGCCACCCTGGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGC
CATTTGGAAACACGATGTGCAAGATCAGTGGATTGGTCCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAG
ATAGGTTCCAGTGTGTGGTCTACCCTTTTAAACCAAAGCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCA
TCACCATTATGTCTCCATCTGCAGTAATGTTACATGTGCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTC
CAGTCTACTGGTGCCGGGAAGACTGGCCAAATCAGGAAATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCC
TCTCCCTCATTGTCATCATGTATGGAAGGATTGGAATTTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGT
GGCACGTGGTGTCCAGGAAGAAGCAGAAGATCATTAAGATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGA
CTCTAATGATGCTCTCAGACTACGCTGACCTTTCTCCAAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGG
CATTCGGCAACAGCAGTGTCAATCCCATCATTTATGGTTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGC
TCTGCCAAAAAAGAGCAAAGCCTATGGAAGCTTATGCCCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGG
AATCTACATTTCAAAACCCTCATGGGGAAACCTTGCTTTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAA
AAGAAACTACTAACAGCAGTGAGATTTAAAAAGAGCTAGTGTGATAATCCTAACTCTACTACGCATTATATATTTAAATCCATTGCTTTT
TGTGGCTTTGCACTTCAAATTTTTCAAAGAATGTTCTAAATAAAACATTTACTGAAAGCCCTCTCTGGCAAAAAAATTAAAAATAAACAA
AAATGGTCATAAGATCATAAACAATCTTATGTTGTATAAAAATACGTAGAGTGACTTAGACATGTTTGCATGAATAAATATATTTCTAGA

>In-frame_CDH1_ENST00000261769_chr16_68772314_+_NPFFR2_ENST00000395999_chr4_73003757_+_1538nt
AGCCAATCAGCGGTACGGGGGGCGGTGCCTCCGGGGCTCACCTGGCTGCAGCCACGCACCCCCTCTCAGTGGCGTCGGAACTGCAAAGCA
CCTGTGAGCTTGCGGAAGTCAGTTCAGACTCCAGCCCGCTCCAGCCCGGCCCGACCCGACCGCACCCGGCGCCTGCCCTCGCTCGGCGTC
CCCGGCCAGCCATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGC
CCTGCCACCCTGGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGC
CATTTGGAAACACGATGTGCAAGATCAGTGGATTGGTCCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAG
ATAGGTTCCAGTGTGTGGTCTACCCTTTTAAACCAAAGCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCA
TCACCATTATGTCTCCATCTGCAGTAATGTTACATGTGCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTC
CAGTCTACTGGTGCCGGGAAGACTGGCCAAATCAGGAAATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCC
TCTCCCTCATTGTCATCATGTATGGAAGGATTGGAATTTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGT
GGCACGTGGTGTCCAGGAAGAAGCAGAAGATCATTAAGATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGA
CTCTAATGATGCTCTCAGACTACGCTGACCTTTCTCCAAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGG
CATTCGGCAACAGCAGTGTCAATCCCATCATTTATGGTTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGC
TCTGCCAAAAAAGAGCAAAGCCTATGGAAGCTTATGCCCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGG
AATCTACATTTCAAAACCCTCATGGGGAAACCTTGCTTTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAA
AAGAAACTACTAACAGCAGTGAGATTTAAAAAGAGCTAGTGTGATAATCCTAACTCTACTACGCATTATATATTTAAATCCATTGCTTTT
TGTGGCTTTGCACTTCAAATTTTTCAAAGAATGTTCTAAATAAAACATTTACTGAAAGCCCTCTCTGGCAAAAAAATTAAAAATAAACAA
AAATGGTCATAAGATCATAAACAATCTTATGTTGTATAAAAATACGTAGAGTGACTTAGACATGTTTGCATGAATAAATATATTTCTAGA

>In-frame_CDH1_ENST00000261769_chr16_68772314_+_NPFFR2_ENST00000358749_chr4_73003757_+_1538nt
AGCCAATCAGCGGTACGGGGGGCGGTGCCTCCGGGGCTCACCTGGCTGCAGCCACGCACCCCCTCTCAGTGGCGTCGGAACTGCAAAGCA
CCTGTGAGCTTGCGGAAGTCAGTTCAGACTCCAGCCCGCTCCAGCCCGGCCCGACCCGACCGCACCCGGCGCCTGCCCTCGCTCGGCGTC
CCCGGCCAGCCATGGGCCCTTGGAGCCGCAGCCTCTCGGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGC
CCTGCCACCCTGGCTTTGACGCCGAGAGCTACACGTTCACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGC
CATTTGGAAACACGATGTGCAAGATCAGTGGATTGGTCCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAG
ATAGGTTCCAGTGTGTGGTCTACCCTTTTAAACCAAAGCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCA
TCACCATTATGTCTCCATCTGCAGTAATGTTACATGTGCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTC
CAGTCTACTGGTGCCGGGAAGACTGGCCAAATCAGGAAATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCC
TCTCCCTCATTGTCATCATGTATGGAAGGATTGGAATTTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGT
GGCACGTGGTGTCCAGGAAGAAGCAGAAGATCATTAAGATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGA
CTCTAATGATGCTCTCAGACTACGCTGACCTTTCTCCAAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGG
CATTCGGCAACAGCAGTGTCAATCCCATCATTTATGGTTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGC
TCTGCCAAAAAAGAGCAAAGCCTATGGAAGCTTATGCCCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGG
AATCTACATTTCAAAACCCTCATGGGGAAACCTTGCTTTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAA
AAGAAACTACTAACAGCAGTGAGATTTAAAAAGAGCTAGTGTGATAATCCTAACTCTACTACGCATTATATATTTAAATCCATTGCTTTT
TGTGGCTTTGCACTTCAAATTTTTCAAAGAATGTTCTAAATAAAACATTTACTGAAAGCCCTCTCTGGCAAAAAAATTAAAAATAAACAA
AAATGGTCATAAGATCATAAACAATCTTATGTTGTATAAAAATACGTAGAGTGACTTAGACATGTTTGCATGAATAAATATATTTCTAGA

>In-frame_CDH1_ENST00000422392_chr16_68772314_+_NPFFR2_ENST00000308744_chr4_73003757_+_1417nt
GCTCCAGCCCGGCCCGACCCGACCGCACCCGGCGCCTGCCCTCGCTCGGCGTCCCCGGCCAGCCATGGGCCCTTGGAGCCGCAGCCTCTC
GGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCTGGCTTTGACGCCGAGAGCTACACGTT
CACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGCCATTTGGAAACACGATGTGCAAGATCAGTGGATTGGT
CCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAGATAGGTTCCAGTGTGTGGTCTACCCTTTTAAACCAAA
GCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCATCACCATTATGTCTCCATCTGCAGTAATGTTACATGT
GCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTCCAGTCTACTGGTGCCGGGAAGACTGGCCAAATCAGGA
AATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCCTCTCCCTCATTGTCATCATGTATGGAAGGATTGGAAT
TTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGTGGCACGTGGTGTCCAGGAAGAAGCAGAAGATCATTAA
GATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGACTCTAATGATGCTCTCAGACTACGCTGACCTTTCTCC
AAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGGCATTCGGCAACAGCAGTGTCAATCCCATCATTTATGG
TTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGCTCTGCCAAAAAAGAGCAAAGCCTATGGAAGCTTATGC
CCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGGAATCTACATTTCAAAACCCTCATGGGGAAACCTTGCT
TTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAAAAGAAACTACTAACAGCAGTGAGATTTAAAAAGAGCT
AGTGTGATAATCCTAACTCTACTACGCATTATATATTTAAATCCATTGCTTTTTGTGGCTTTGCACTTCAAATTTTTCAAAGAATGTTCT
AAATAAAACATTTACTGAAAGCCCTCTCTGGCAAAAAAATTAAAAATAAACAAAAATGGTCATAAGATCATAAACAATCTTATGTTGTAT

>In-frame_CDH1_ENST00000422392_chr16_68772314_+_NPFFR2_ENST00000395999_chr4_73003757_+_1411nt
GCTCCAGCCCGGCCCGACCCGACCGCACCCGGCGCCTGCCCTCGCTCGGCGTCCCCGGCCAGCCATGGGCCCTTGGAGCCGCAGCCTCTC
GGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCTGGCTTTGACGCCGAGAGCTACACGTT
CACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGCCATTTGGAAACACGATGTGCAAGATCAGTGGATTGGT
CCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAGATAGGTTCCAGTGTGTGGTCTACCCTTTTAAACCAAA
GCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCATCACCATTATGTCTCCATCTGCAGTAATGTTACATGT
GCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTCCAGTCTACTGGTGCCGGGAAGACTGGCCAAATCAGGA
AATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCCTCTCCCTCATTGTCATCATGTATGGAAGGATTGGAAT
TTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGTGGCACGTGGTGTCCAGGAAGAAGCAGAAGATCATTAA
GATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGACTCTAATGATGCTCTCAGACTACGCTGACCTTTCTCC
AAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGGCATTCGGCAACAGCAGTGTCAATCCCATCATTTATGG
TTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGCTCTGCCAAAAAAGAGCAAAGCCTATGGAAGCTTATGC
CCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGGAATCTACATTTCAAAACCCTCATGGGGAAACCTTGCT
TTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAAAAGAAACTACTAACAGCAGTGAGATTTAAAAAGAGCT
AGTGTGATAATCCTAACTCTACTACGCATTATATATTTAAATCCATTGCTTTTTGTGGCTTTGCACTTCAAATTTTTCAAAGAATGTTCT
AAATAAAACATTTACTGAAAGCCCTCTCTGGCAAAAAAATTAAAAATAAACAAAAATGGTCATAAGATCATAAACAATCTTATGTTGTAT

>In-frame_CDH1_ENST00000422392_chr16_68772314_+_NPFFR2_ENST00000358749_chr4_73003757_+_1411nt
GCTCCAGCCCGGCCCGACCCGACCGCACCCGGCGCCTGCCCTCGCTCGGCGTCCCCGGCCAGCCATGGGCCCTTGGAGCCGCAGCCTCTC
GGCGCTGCTGCTGCTGCTGCAGGTCTCCTCTTGGCTCTGCCAGGAGCCGGAGCCCTGCCACCCTGGCTTTGACGCCGAGAGCTACACGTT
CACGGTGCCCCGGCGCCACCTGGAGAGAGGCCGCGTCCTGGGCAGAGGATGGCCATTTGGAAACACGATGTGCAAGATCAGTGGATTGGT
CCAGGGAATATCTGTCGCAGCTTCAGTCTTTACGTTAGTTGCAATTGCTGTAGATAGGTTCCAGTGTGTGGTCTACCCTTTTAAACCAAA
GCTCACTATCAAGACAGCGTTTGTCATTATTATGATCATCTGGGTCCTAGCCATCACCATTATGTCTCCATCTGCAGTAATGTTACATGT
GCAAGAAGAAAAATATTACCGAGTGAGACTCAACTCCCAGAATAAAACCAGTCCAGTCTACTGGTGCCGGGAAGACTGGCCAAATCAGGA
AATGAGGAAGATCTACACCACTGTGCTGTTTGCCAACATCTACCTGGCTCCCCTCTCCCTCATTGTCATCATGTATGGAAGGATTGGAAT
TTCACTCTTCAGGGCTGCAGTTCCTCACACAGGCAGGAAGAACCAGGAGCAGTGGCACGTGGTGTCCAGGAAGAAGCAGAAGATCATTAA
GATGCTCCTGATTGTGGCCCTGCTTTTTATTCTCTCATGGCTGCCCCTGTGGACTCTAATGATGCTCTCAGACTACGCTGACCTTTCTCC
AAATGAACTGCAGATCATCAACATCTACATCTACCCTTTTGCACACTGGCTGGCATTCGGCAACAGCAGTGTCAATCCCATCATTTATGG
TTTCTTCAACGAGAATTTCCGCCGTGGTTTCCAAGAAGCTTTCCAGCTCCAGCTCTGCCAAAAAAGAGCAAAGCCTATGGAAGCTTATGC
CCTAAAAGCTAAAAGCCATGTGCTCATAAACACATCTAATCAGCTTGTCCAGGAATCTACATTTCAAAACCCTCATGGGGAAACCTTGCT
TTATAGGAAAAGTGCTGAAAAACCCCAACAGGAATTAGTGATGGAAGAATTAAAAGAAACTACTAACAGCAGTGAGATTTAAAAAGAGCT
AGTGTGATAATCCTAACTCTACTACGCATTATATATTTAAATCCATTGCTTTTTGTGGCTTTGCACTTCAAATTTTTCAAAGAATGTTCT
AAATAAAACATTTACTGAAAGCCCTCTCTGGCAAAAAAATTAAAAATAAACAAAAATGGTCATAAGATCATAAACAATCTTATGTTGTAT


Top

FusionGenePPI for CDH1_NPFFR2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDH1CTNND1, CBLL1, HDAC1, HDAC2, CTNNB1, MET, SRC, VCL, ITGAE, CTNNA1, JUP, CSE1L, ACTG1, ACTN1, GNA13, CDH1, CDH3, GNA12, AJAP1, CA9, FYN, FER, YES1, RAB8B, PKP4, EGFR, MYO7A, VEZT, MAGI1, ARPC2, PSEN1, EZR, IQGAP1, MDM2, ADAM9, CREBBP, EP300, USP9X, NKD2, CDC42, NDRG1, PPP1CA, SMAD7, RAD17, ACTN4, HSP90AA1, HSPD1, HSPA8, POLR2E, XRCC5, KRT1, KRT9, LMNA, ACADVL, IGHA1, TGM2, HSPA5, HSPA9, KRT18, KRT8, SET, ANP32B, C1QBP, NIPSNAP1, GBAS, CRYAB, CFTR, GMNN, AP2M1, PIP5K1C, UCHL3, PTEN, CDC27, RNF2, ECT2, KLF4, E2F1, SKP2, DDR1, DDR2, ILK, MYO6, CASP3, FGFR1, GSK3B, NFE2L2, KEAP1, BRCA1, ADCY9, ADD1, ADD3, AIM1, ALDOA, ANK3, ANXA1, ANXA2, ANXA4, ARHGAP1, ARHGAP5, ARHGDIB, ARVCF, ATIC, ATP2B1, ATP2B4, BCL2L2, BMPR2, DST, BSG, CALD1, CAPG, CAPS, CAPZA1, CAST, CAPZB, CBL, SCARB1, SEPT7, CLIC1, CNN2, CNN3, COL17A1, CRK, CRKL, CSNK1A1, CSNK1D, CTNNA2, CTSB, CXADR, DAG1, DBN1, DDX3X, DDX6, DLG1, DSC3, DSG2, DVL3, EEF1A1, EEF1D, EEF1G, EEF2, EIF2S3, EPHA2, EIF4B, EIF4G1, EIF4G2, EIF5, EIF5A, EMD, MARK2, CTTN, ENO1, EPB41, EPB41L1, EPS15, ERBB2, ERBB3, EVPL, FASN, FLNA, FLNB, FTH1, GAB1, GM2A, GOLGA2, GOLGA3, GOLGB1, SFN, GSPT1, HCFC1, HDLBP, HLA-C, HNRNPK, AGFG1, HSPA1A, HSP90AB1, DNAJB1, IDH1, IGBP1, IGF2R, IL6ST, INPPL1, EIF3E, IRAK1, ITGA6, ITGB1, IVL, KCNN4, KIF5B, KTN1, LAD1, LASP1, LBR, LDHA, ABLIM1, LLGL1, LMO7, LPP, MARCKS, MAP4, MARK3, CD99, MLLT4, MRE11A, MYO1B, MYH9, NCK1, SEPT2, NF2, NFKBIE, NHS, NOTCH1, NOTCH2, NOTCH3, PRDX1, PAK2, PCBP1, PCBP2, PCDH1, PCMT1, PFKP, PFN1, PI4KA, PKM, PKP2, PLCB3, PLEC, PLSCR1, PPL, PKN2, PSMB6, TWF1, PTPN1, PTPRJ, PVRL1, PVRL2, PXN, RAB1A, RAN, RANBP1, RANGAP1, RARS, RDX, RPL6, RPL7A, RPL15, RPL23A, RPL24, RPL29, RPL34, RPL36AL, RPL37, RPL36A, RPS2, RPS26, S100A11, S100P, SDCBP, SH3GL1, SHB, SLC1A5, SLC3A2, SLC9A1, SLC12A2, SNAP25, FSCN1, SNX1, SNX2, SPAG1, SPRR3, SPTAN1, SPTBN1, SPTBN2, SSFA2, STAT1, STAT2, STIM1, CDKL5, STX4, SVIL, ADAM17, TJP1, TLN1, TMPO, TP53BP2, TPD52, TPD52L2, TRIP6, TTK, TTN, UBC, UTRN, VASP, EIF4H, YWHAB, YWHAE, YWHAZ, TRIM25, ZNF185, SLC30A1, ZYX, LUZP1, DDX39B, NUP214, PICALM, HIST1H3A, TAGLN2, STK24, NCK2, PPFIBP1, RUVBL1, USO1, NUMB, SNAP23, SCEL, SYNJ1, SYNJ2, H1FX, MPZL1, RPL14, GPRC5A, SYT7, USP8, SLC16A3, PDLIM1, CCNB2, LRRFIP1, VAPB, VAPA, RAB11B, DLG5, NUMBL, PDLIM7, TRIP11, VAMP3, SNAP29, SLC9A3R2, SLC9A3R1, ARHGAP29, TJP2, SLC4A7, BAG3, H2AFY, PRDX6, N4BP1, CLINT1, BZW1, USP6NL, ARHGAP32, SLK, PHACTR2, ZFYVE16, CKAP5, IST1, RB1CC1, GOLGA5, USP15, CCS, ABI1, WASF2, TXNDC9, INADL, FLOT1, PLIN3, PAK4, TUBB4B, GNB2L1, YAP1, PGRMC2, SEC24B, BAIAP2, NOP56, NEBL, SORBS1, AHSA1, PAICS, PDLIM5, YKT6, CCT8, NUDC, GIPC1, SEPT9, FRS2, PPP1R13L, RAB10, EHD1, EBNA1BP2, GCN1L1, CDC42EP1, NUDT5, PKP3, AKAP2, PACSIN2, ATXN2L, LYPLA2, PARK7, STK38, PDAP1, EXOC3, TWF2, PUF60, COBLL1, AAK1, PLEKHA6, ABLIM3, EPN2, MAPRE1, SHANK2, LIMCH1, DAAM1, PDXDC1, SWAP70, ERC1, SIPA1L3, EPB41L3, GGA3, MPRIP, EFR3A, LPHN2, EHBP1, ESYT1, DOCK9, ARHGEF12, LARP1, PPP1R13B, SRGAP2, MACF1, SCRIB, CDC42EP4, CD2AP, ARFIP2, TRIM29, TMEM2, ZDHHC5, KANK2, TMEM87A, CHMP2B, NGDN, TBC1D10B, GORASP2, GIGYF2, RAI14, GAPVD1, SERBP1, TES, RSL1D1, ELP4, COPG2, SND1, SNX5, ARFIP1, ARHGEF16, BZW2, DBNL, STXBP6, TMOD3, OLA1, SH3KBP1, EHD4, MINK1, ASAP1, F11R, GLOD4, SH3GLB1, HN1, PPME1, SNX9, LIMA1, ISYNA1, CHMP5, LSR, WWOX, ANLN, XRN1, PLEKHA5, DHX29, EPB41L4B, CC2D1A, EPS8L1, FNBP1L, SSH3, EPN3, UACA, ARGLU1, TMEM51, STEAP3, ABCF3, LRRC59, LRRC16A, FERMT1, TBC1D22B, NLRP2, DENND4C, SCYL2, PARVA, C1orf106, PAG1, UBAP2, ZC3H15, UNC45A, ERBB2IP, NSFL1C, BAIAP2L1, UBFD1, KIAA1217, PARD3, ZC3HAV1, SH3GLB2, PAK6, CIAPIN1, PLSCR3, CAMK1D, RTN4, CORO1B, TTC7A, NHSL1, SCYL1, NDRG2, ESYT2, MKL2, KIDINS220, MAVS, CASKIN2, CGN, LRRC7, ARHGAP21, KIAA1462, SHROOM3, SH3RF1, ARHGAP23, KIAA1522, KIAA1524, KIAA1598, EPS15L1, PLEKHA1, PLEKHA2, ACBD3, EPS8L2, KLC2, FAM129B, RAPH1, PHACTR4, AHNAK, EFHD2, CLMN, PEAK1, POF1B, VCPIP1, PLEKHO2, SRCIN1, SLC38A1, PVRL4, DIAPH3, CDCA3, FAM110A, TBC1D10A, EIF2A, ELMOD3, ARFGAP2, LZTS2, FAM126A, C1orf198, MICALL1, KIAA1671, TNKS1BP1, TANC1, NAV2, CCDC120, PHLDB2, HN1L, SPECC1, ARHGAP18, SYAP1, GPRIN1, FMNL2, ELFN2, VASN, ZG16B, CANT1, USP43, CCDC43, CHMP4B, SIRPA, MPP7, PLEKHA7, SLC2A14, GCOM1, TMEM199, WIPF2, VSIG10L, PROM2, MB21D2, SH3D19, DAB2IP, MARVELD2, FAM84B, FAM91A1, SPRED1, FAM171B, PPP1R18, TUBB, FAM83B, EHBP1L1, LRRC57, MAGI3, PPP1R37, FAM126B, SH3PXD2B, FAM83H, CCDC85C, FMN1, PALM3, MACC1, SBSN, GOLGA8B, FAM110C, C6orf132, RELL1, OCLN, STX5, C1orf116, ARPIN, KDF1, C1orf35, TENM3, CCSER2, CTNNA3, PCDHGC3NPFFR2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDH1_NPFFR2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDH1_NPFFR2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneCDH1C0038356Stomach Neoplasms6CTD_human
HgeneCDH1C1458155Mammary Neoplasms4CTD_human
HgeneCDH1C0005695Bladder Neoplasm2CTD_human
HgeneCDH1C0009404Colorectal Neoplasms2CTD_human
HgeneCDH1C0023904Liver Neoplasms, Experimental2CTD_human
HgeneCDH1C0027626Neoplasm Invasiveness2CTD_human
HgeneCDH1C0027627Neoplasm Metastasis2CTD_human
HgeneCDH1C0033578Prostatic Neoplasms2CTD_human
HgeneCDH1C0206692Carcinoma, Lobular2CTD_human
HgeneCDH1C1134719Invasive Ductal Breast Carcinoma2CTD_human
HgeneCDH1C1708349Hereditary Diffuse Gastric Cancer2ORPHANET;UNIPROT
HgeneCDH1C2931456Prostate cancer, familial2CTD_human
HgeneCDH1C0007137Squamous cell carcinoma1CTD_human
HgeneCDH1C0007621Neoplastic Cell Transformation1CTD_human
HgeneCDH1C0009324Ulcerative Colitis1CTD_human
HgeneCDH1C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneCDH1C0014170Endometrial Neoplasms1CTD_human
HgeneCDH1C0024667Animal Mammary Neoplasms1CTD_human
HgeneCDH1C0024668Mammary Neoplasms, Experimental1CTD_human
HgeneCDH1C0025500Mesothelioma1CTD_human
HgeneCDH1C0026936Mycoplasma Infections1CTD_human
HgeneCDH1C0027746Nerve Degeneration1CTD_human
HgeneCDH1C0030297Pancreatic Neoplasm1CTD_human
HgeneCDH1C0032927Precancerous Conditions1CTD_human
HgeneCDH1C0036095Salivary Gland Neoplasms1CTD_human
HgeneCDH1C0079487Helicobacter Infections1CTD_human
HgeneCDH1C0282612Prostatic Intraepithelial Neoplasias1CTD_human
HgeneCDH1C0919267ovarian neoplasm1CTD_human