FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6392

FusionGeneSummary for CDC5L_POLH

check button Fusion gene summary
Fusion gene informationFusion gene name: CDC5L_POLH
Fusion gene ID: 6392
HgeneTgene
Gene symbol

CDC5L

POLH

Gene ID

988

5429

Gene namecell division cycle 5 likeDNA polymerase eta
SynonymsCDC5|CDC5-LIKE|CEF1|PCDC5RP|dJ319D22.1RAD30|RAD30A|XP-V|XPV
Cytomap

6p21.1

6p21.1

Type of geneprotein-codingprotein-coding
Descriptioncell division cycle 5-like proteinCDC5 cell division cycle 5-likeCdc5-related proteindJ319D22.1 (CDC5-like protein)pombe cdc5-related proteinDNA polymerase etaRAD30 homolog Apolymerase (DNA directed), etapolymerase (DNA) etaxeroderma pigmentosum variant type protein
Modification date2018052220180523
UniProtAcc

Q99459

Q9Y253

Ensembl transtripts involved in fusion geneENST00000371477, ENST00000372236, 
ENST00000535400, ENST00000372226, 
Fusion gene scores* DoF score9 X 5 X 6=2705 X 5 X 3=75
# samples 95
** MAII scorelog2(9/270*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: CDC5L [Title/Abstract] AND POLH [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneCDC5L

GO:0000398

mRNA splicing, via spliceosome

28076346

HgeneCDC5L

GO:0045944

positive regulation of transcription by RNA polymerase II

11082045

TgenePOLH

GO:0000731

DNA synthesis involved in DNA repair

17563354

TgenePOLH

GO:0010225

response to UV-C

17563354


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-VQ-A922-01ACDC5Lchr6

44376369

+POLHchr6

43568725

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000371477ENST00000372236CDC5Lchr6

44376369

+POLHchr6

43568725

+
In-frameENST00000371477ENST00000535400CDC5Lchr6

44376369

+POLHchr6

43568725

+
In-frameENST00000371477ENST00000372226CDC5Lchr6

44376369

+POLHchr6

43568725

+

Top

FusionProtFeatures for CDC5L_POLH


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CDC5L

Q99459

POLH

Q9Y253

DNA-binding protein involved in cell cycle control. Mayact as a transcription activator. Component of the PRP19-CDC5Lcomplex that forms an integral part of the spliceosome and isrequired for activating pre-mRNA splicing. The PRP19-CDC5L complexmay also play a role in the response to DNA damage (DDR).{ECO:0000269|PubMed:10570151, ECO:0000269|PubMed:11082045,ECO:0000269|PubMed:11101529, ECO:0000269|PubMed:11544257,ECO:0000269|PubMed:12927788, ECO:0000269|PubMed:18583928,ECO:0000269|PubMed:24332808, ECO:0000269|PubMed:9038199,ECO:0000269|PubMed:9468527, ECO:0000269|PubMed:9632794}. DNA polymerase specifically involved in the DNA repairby translesion synthesis (TLS) (PubMed:10385124, PubMed:11743006,PubMed:24449906). Due to low processivity on both damaged andnormal DNA, cooperates with the heterotetrameric (REV3L, REV7,POLD2 and POLD3) POLZ complex for complete bypass of DNA lesions.Inserts one or 2 nucleotide(s) opposite the lesion, the primer isfurther extended by the tetrameric POLZ complex. In the case of1,2-intrastrand d(GpG)-cisplatin cross-link, inserts dCTP oppositethe 3' guanine (PubMed:24449906). Particularly important for therepair of UV-induced pyrimidine dimers (PubMed:10385124,PubMed:11743006). Although inserts the correct base, may causebase transitions and transversions depending upon the context. Mayplay a role in hypermutation at immunoglobulin genes(PubMed:11376341, PubMed:14734526). Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have any lyaseactivity, preventing the release of the 5'-deoxyribose phosphate(5'-dRP) residue. This covalent trapping of the enzyme by the 5'-dRP residue inhibits its DNA synthetic activity during baseexcision repair, thereby avoiding high incidence of mutagenesis(PubMed:14630940). Targets POLI to replication foci(PubMed:12606586). {ECO:0000269|PubMed:10385124,ECO:0000269|PubMed:11376341, ECO:0000269|PubMed:11743006,ECO:0000269|PubMed:12606586, ECO:0000269|PubMed:14630940,ECO:0000269|PubMed:14734526, ECO:0000269|PubMed:24449906}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+816142_245364803Coiled coilOntology_term=ECO:0000255
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+81631_54364803DNA bindingH-T-H motif
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+81682_104364803DNA bindingH-T-H motif
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+8161_56364803DomainHTH myb-type 1
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+81657_108364803DomainHTH myb-type 2
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+816165_271364803MotifNuclear localization signal

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+816676_701364803Coiled coilOntology_term=ECO:0000255
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+816764_802364803Coiled coilOntology_term=ECO:0000255
TgenePOLHchr6:44376369chr6:43568725ENST00000372226+4119_259220415DomainUmuC
TgenePOLHchr6:44376369chr6:43568725ENST00000372236+4119_259220714DomainUmuC


Top

FusionGeneSequence for CDC5L_POLH


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CDC5L_ENST00000371477_chr6_44376369_+_POLH_ENST00000372236_chr6_43568725_+_858aa
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIG
RTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRK
KESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQD
RILQVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIE
HDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMS
HDAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQK
AAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTEPFFKQKSLLLKQKQLNNSSVSSPQQNPWSNCKALPNSLPTEYPGCVP
VCEGVSKLEESSKATPAEMDLAHNSQSMHASSASKSVLEVTQKATPNPSLLAAEDQVPCEKCGSLVPVWDMPEHMDYHFALELQKSFLQP

>In-frame_CDC5L_ENST00000371477_chr6_44376369_+_POLH_ENST00000535400_chr6_43568725_+_858aa
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIG
RTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRK
KESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQD
RILQVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIE
HDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMS
HDAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSLESFFQK
AAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTEPFFKQKSLLLKQKQLNNSSVSSPQQNPWSNCKALPNSLPTEYPGCVP
VCEGVSKLEESSKATPAEMDLAHNSQSMHASSASKSVLEVTQKATPNPSLLAAEDQVPCEKCGSLVPVWDMPEHMDYHFALELQKSFLQP

>In-frame_CDC5L_ENST00000371477_chr6_44376369_+_POLH_ENST00000372226_chr6_43568725_+_559aa
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIG
RTAAQCLEHYEFLLDKAAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRK
KESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQD
RILQVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIE
HDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CDC5L_ENST00000371477_chr6_44376369_+_POLH_ENST00000372236_chr6_43568725_+_2574nt
ATGCCTCGAATTATGATCAAGGGGGGCGTATGGAGGAATACCGAGGATGAAATTCTGAAAGCAGCGGTAATGAAATATGGGAAAAATCAG
TGGTCTAGGATTGCCTCATTGCTGCATAGAAAATCAGCAAAGCAGTGCAAAGCCAGATGGTATGAATGGCTGGATCCAAGCATTAAGAAG
ACAGAATGGTCCAGAGAAGAAGAGGAAAAACTCTTGCACTTGGCCAAGTTGATGCCAACTCAGTGGAGGACCATTGCTCCAATCATTGGA
AGAACAGCGGCCCAGTGCTTAGAACACTATGAATTTCTTCTGGATAAAGCTGCCCAAAGAGACAATGAAGAGGAAACAACAGATGATCCA
CGAAAACTTAAACCTGGAGAAATAGATCCAAATCCAGAAACAAAACCAGCGCGGCCTGATCCAATTGATATGGATGAGGATGAACTTGAG
ATGCTTTCTGAAGCCAGAGCCCGCTTGGCTAATACTCAGGGAAAGAAGGCCAAGAGGAAAGCAAGAGAGAAACAATTGGAAGAAGCAAGA
CGTCTTGCTGCCCTCCAAAAAAGAAGAGAACTTCGAGCAGCTGGCATAGAAATTCAGAAGAAAAGAAAAAGGAAGAGAGGAGTTGATTAT
AATGCCGAAATCCCATTTGAAAAAAAGCCTGCCCTTGGTTTTTATGATACTTCTGAGGAAAACTACCAAGCTCTTGACGCAGATTTCAGG
AAATTAAGACAACAGGATCTTGATGGGGAGCTAAGATCTGAAAAAGAAGGAAGAGATAGAAAAAAAGACAAACAGCATTTGAAAAGGAAA
AAAGAATCTGATTTACCATCAGCTATTCTTCAAACTAGTGGTGTTTCTGAATTTACTAAAAAGAGAAGCAAACTAGTACTTCCTGCCCCT
CAGATTTCAGATGCAGAACTCCAGGAAGTTGTAAAAGTAGGCCAAGCGAGTGAAATTGCACGTCAAACTGCCGAGGAATCTGGCATAACA
AATTCTGCTTCCAGTACACTTTTGTCTGAGTACAATGTCACCAACAACAGCGTTGCTCTTAGAACACCACGAACACCAGCTTCCCAGGAC
AGAATTCTGCAGGTCCTGGCAAAACTGGCCTGTGGACTAAACAAGCCCAACCGCCAAACCCTGGTTTCACATGGGTCAGTCCCACAGCTC
TTCAGCCAAATGCCCATTCGCAAAATCCGTAGTCTTGGAGGAAAGCTAGGGGCCTCTGTCATTGAGATCCTAGGGATAGAATACATGGGT
GAACTGACCCAGTTCACTGAATCCCAGCTCCAGAGTCATTTTGGGGAGAAGAATGGGTCTTGGCTATATGCCATGTGCCGAGGGATTGAA
CATGATCCAGTTAAACCCAGGCAACTACCCAAAACCATTGGCTGTAGTAAGAACTTCCCAGGAAAAACAGCTCTTGCTACTCGGGAACAG
GTACAATGGTGGCTGTTGCAATTAGCCCAGGAACTAGAGGAGAGACTGACTAAAGACCGAAATGATAATGACAGGGTAGCCACCCAGCTG
GTTGTGAGCATTCGTGTACAAGGAGACAAACGCCTCAGCAGCCTGCGCCGCTGCTGTGCCCTTACCCGCTATGATGCTCACAAGATGAGC
CATGATGCATTTACTGTCATCAAGAACTGTAATACTTCTGGAATCCAGACAGAATGGTCTCCTCCTCTCACAATGCTTTTCCTCTGTGCT
ACAAAATTTTCTGCCTCTGCCCCTTCATCTTCTACAGACATCACCAGCTTCTTGAGCAGTGACCCAAGTTCTCTGCCAAAGGTGCCAGTT
ACCAGCTCAGAAGCTAAGACCCAGGGAAGTGGCCCAGCGGTGACAGCCACTAAGAAAGCAACCACGTCTCTGGAATCATTCTTCCAAAAA
GCTGCAGAAAGGCAGAAAGTTAAAGAAGCTTCGCTTTCATCTCTTACTGCTCCCACTCAGGCTCCCATGAGCAATTCACCATCCAAGCCC
TCATTACCTTTTCAAACCAGTCAAAGTACAGGAACTGAGCCCTTCTTTAAGCAGAAAAGTCTGCTTCTAAAGCAGAAACAGCTTAATAAT
TCTTCAGTTTCTTCCCCCCAACAAAACCCATGGTCCAACTGTAAAGCATTACCAAACTCTTTACCAACAGAGTATCCAGGGTGTGTCCCT
GTTTGTGAAGGGGTGTCGAAGCTAGAAGAATCCTCTAAAGCAACTCCTGCAGAGATGGATTTGGCCCACAACAGCCAAAGCATGCACGCC
TCTTCAGCTTCCAAATCTGTGCTGGAGGTGACTCAGAAAGCAACCCCAAATCCAAGTCTTCTAGCTGCTGAGGACCAAGTGCCCTGTGAG
AAGTGTGGCTCCCTGGTACCGGTATGGGATATGCCAGAACACATGGACTATCATTTTGCATTGGAGTTGCAGAAATCCTTTTTGCAGCCC
CACTCTTCAAACCCCCAGGTTGTTTCTGCCGTATCTCATCAAGGCAAAAGAAATCCCAAGAGCCCTTTGGCCTGCACTAATAAACGCCCC

>In-frame_CDC5L_ENST00000371477_chr6_44376369_+_POLH_ENST00000535400_chr6_43568725_+_2574nt
ATGCCTCGAATTATGATCAAGGGGGGCGTATGGAGGAATACCGAGGATGAAATTCTGAAAGCAGCGGTAATGAAATATGGGAAAAATCAG
TGGTCTAGGATTGCCTCATTGCTGCATAGAAAATCAGCAAAGCAGTGCAAAGCCAGATGGTATGAATGGCTGGATCCAAGCATTAAGAAG
ACAGAATGGTCCAGAGAAGAAGAGGAAAAACTCTTGCACTTGGCCAAGTTGATGCCAACTCAGTGGAGGACCATTGCTCCAATCATTGGA
AGAACAGCGGCCCAGTGCTTAGAACACTATGAATTTCTTCTGGATAAAGCTGCCCAAAGAGACAATGAAGAGGAAACAACAGATGATCCA
CGAAAACTTAAACCTGGAGAAATAGATCCAAATCCAGAAACAAAACCAGCGCGGCCTGATCCAATTGATATGGATGAGGATGAACTTGAG
ATGCTTTCTGAAGCCAGAGCCCGCTTGGCTAATACTCAGGGAAAGAAGGCCAAGAGGAAAGCAAGAGAGAAACAATTGGAAGAAGCAAGA
CGTCTTGCTGCCCTCCAAAAAAGAAGAGAACTTCGAGCAGCTGGCATAGAAATTCAGAAGAAAAGAAAAAGGAAGAGAGGAGTTGATTAT
AATGCCGAAATCCCATTTGAAAAAAAGCCTGCCCTTGGTTTTTATGATACTTCTGAGGAAAACTACCAAGCTCTTGACGCAGATTTCAGG
AAATTAAGACAACAGGATCTTGATGGGGAGCTAAGATCTGAAAAAGAAGGAAGAGATAGAAAAAAAGACAAACAGCATTTGAAAAGGAAA
AAAGAATCTGATTTACCATCAGCTATTCTTCAAACTAGTGGTGTTTCTGAATTTACTAAAAAGAGAAGCAAACTAGTACTTCCTGCCCCT
CAGATTTCAGATGCAGAACTCCAGGAAGTTGTAAAAGTAGGCCAAGCGAGTGAAATTGCACGTCAAACTGCCGAGGAATCTGGCATAACA
AATTCTGCTTCCAGTACACTTTTGTCTGAGTACAATGTCACCAACAACAGCGTTGCTCTTAGAACACCACGAACACCAGCTTCCCAGGAC
AGAATTCTGCAGGTCCTGGCAAAACTGGCCTGTGGACTAAACAAGCCCAACCGCCAAACCCTGGTTTCACATGGGTCAGTCCCACAGCTC
TTCAGCCAAATGCCCATTCGCAAAATCCGTAGTCTTGGAGGAAAGCTAGGGGCCTCTGTCATTGAGATCCTAGGGATAGAATACATGGGT
GAACTGACCCAGTTCACTGAATCCCAGCTCCAGAGTCATTTTGGGGAGAAGAATGGGTCTTGGCTATATGCCATGTGCCGAGGGATTGAA
CATGATCCAGTTAAACCCAGGCAACTACCCAAAACCATTGGCTGTAGTAAGAACTTCCCAGGAAAAACAGCTCTTGCTACTCGGGAACAG
GTACAATGGTGGCTGTTGCAATTAGCCCAGGAACTAGAGGAGAGACTGACTAAAGACCGAAATGATAATGACAGGGTAGCCACCCAGCTG
GTTGTGAGCATTCGTGTACAAGGAGACAAACGCCTCAGCAGCCTGCGCCGCTGCTGTGCCCTTACCCGCTATGATGCTCACAAGATGAGC
CATGATGCATTTACTGTCATCAAGAACTGTAATACTTCTGGAATCCAGACAGAATGGTCTCCTCCTCTCACAATGCTTTTCCTCTGTGCT
ACAAAATTTTCTGCCTCTGCCCCTTCATCTTCTACAGACATCACCAGCTTCTTGAGCAGTGACCCAAGTTCTCTGCCAAAGGTGCCAGTT
ACCAGCTCAGAAGCTAAGACCCAGGGAAGTGGCCCAGCGGTGACAGCCACTAAGAAAGCAACCACGTCTCTGGAATCATTCTTCCAAAAA
GCTGCAGAAAGGCAGAAAGTTAAAGAAGCTTCGCTTTCATCTCTTACTGCTCCCACTCAGGCTCCCATGAGCAATTCACCATCCAAGCCC
TCATTACCTTTTCAAACCAGTCAAAGTACAGGAACTGAGCCCTTCTTTAAGCAGAAAAGTCTGCTTCTAAAGCAGAAACAGCTTAATAAT
TCTTCAGTTTCTTCCCCCCAACAAAACCCATGGTCCAACTGTAAAGCATTACCAAACTCTTTACCAACAGAGTATCCAGGGTGTGTCCCT
GTTTGTGAAGGGGTGTCGAAGCTAGAAGAATCCTCTAAAGCAACTCCTGCAGAGATGGATTTGGCCCACAACAGCCAAAGCATGCACGCC
TCTTCAGCTTCCAAATCTGTGCTGGAGGTGACTCAGAAAGCAACCCCAAATCCAAGTCTTCTAGCTGCTGAGGACCAAGTGCCCTGTGAG
AAGTGTGGCTCCCTGGTACCGGTATGGGATATGCCAGAACACATGGACTATCATTTTGCATTGGAGTTGCAGAAATCCTTTTTGCAGCCC
CACTCTTCAAACCCCCAGGTTGTTTCTGCCGTATCTCATCAAGGCAAAAGAAATCCCAAGAGCCCTTTGGCCTGCACTAATAAACGCCCC

>In-frame_CDC5L_ENST00000371477_chr6_44376369_+_POLH_ENST00000372226_chr6_43568725_+_1677nt
ATGCCTCGAATTATGATCAAGGGGGGCGTATGGAGGAATACCGAGGATGAAATTCTGAAAGCAGCGGTAATGAAATATGGGAAAAATCAG
TGGTCTAGGATTGCCTCATTGCTGCATAGAAAATCAGCAAAGCAGTGCAAAGCCAGATGGTATGAATGGCTGGATCCAAGCATTAAGAAG
ACAGAATGGTCCAGAGAAGAAGAGGAAAAACTCTTGCACTTGGCCAAGTTGATGCCAACTCAGTGGAGGACCATTGCTCCAATCATTGGA
AGAACAGCGGCCCAGTGCTTAGAACACTATGAATTTCTTCTGGATAAAGCTGCCCAAAGAGACAATGAAGAGGAAACAACAGATGATCCA
CGAAAACTTAAACCTGGAGAAATAGATCCAAATCCAGAAACAAAACCAGCGCGGCCTGATCCAATTGATATGGATGAGGATGAACTTGAG
ATGCTTTCTGAAGCCAGAGCCCGCTTGGCTAATACTCAGGGAAAGAAGGCCAAGAGGAAAGCAAGAGAGAAACAATTGGAAGAAGCAAGA
CGTCTTGCTGCCCTCCAAAAAAGAAGAGAACTTCGAGCAGCTGGCATAGAAATTCAGAAGAAAAGAAAAAGGAAGAGAGGAGTTGATTAT
AATGCCGAAATCCCATTTGAAAAAAAGCCTGCCCTTGGTTTTTATGATACTTCTGAGGAAAACTACCAAGCTCTTGACGCAGATTTCAGG
AAATTAAGACAACAGGATCTTGATGGGGAGCTAAGATCTGAAAAAGAAGGAAGAGATAGAAAAAAAGACAAACAGCATTTGAAAAGGAAA
AAAGAATCTGATTTACCATCAGCTATTCTTCAAACTAGTGGTGTTTCTGAATTTACTAAAAAGAGAAGCAAACTAGTACTTCCTGCCCCT
CAGATTTCAGATGCAGAACTCCAGGAAGTTGTAAAAGTAGGCCAAGCGAGTGAAATTGCACGTCAAACTGCCGAGGAATCTGGCATAACA
AATTCTGCTTCCAGTACACTTTTGTCTGAGTACAATGTCACCAACAACAGCGTTGCTCTTAGAACACCACGAACACCAGCTTCCCAGGAC
AGAATTCTGCAGGTCCTGGCAAAACTGGCCTGTGGACTAAACAAGCCCAACCGCCAAACCCTGGTTTCACATGGGTCAGTCCCACAGCTC
TTCAGCCAAATGCCCATTCGCAAAATCCGTAGTCTTGGAGGAAAGCTAGGGGCCTCTGTCATTGAGATCCTAGGGATAGAATACATGGGT
GAACTGACCCAGTTCACTGAATCCCAGCTCCAGAGTCATTTTGGGGAGAAGAATGGGTCTTGGCTATATGCCATGTGCCGAGGGATTGAA
CATGATCCAGTTAAACCCAGGCAACTACCCAAAACCATTGGCTGTAGTAAGAACTTCCCAGGAAAAACAGCTCTTGCTACTCGGGAACAG
GTACAATGGTGGCTGTTGCAATTAGCCCAGGAACTAGAGGAGAGACTGACTAAAGACCGAAATGATAATGACAGGGTAGCCACCCAGCTG
GTTGTGAGCATTCGTGTACAAGGAGACAAACGCCTCAGCAGCCTGCGCCGCTGCTGTGCCCTTACCCGCTATGATGCTCACAAGATGAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_CDC5L_ENST00000371477_chr6_44376369_+_POLH_ENST00000372236_chr6_43568725_+_3976nt
TTTCTTCCATTCTGTTTTGGACATGCGCGGGGCGTAAGGCGCTTTGGCCAGAGTGGTTTGATGGTTTTGTGTTAGTCTTCCTGCAGCTGA
GCTTCCACAAGACACTTTTTCCCTTTCAGCCACCCAATATCTCGCGAGACTTGCTATTCTGCGCCCCCTCCCACCTTGCGCTTGCGCAGA
TCTTCAAAGCAGAAGGTCGCGCTTGGAGGAAGTGGCGGCTTTGAGTCCGGTGGCCCAATCGCTGTTACTACTTCTCTGAAGCTCCTCTCG
GCTGCTTGCCGAGACACCCTGCCGCCAAGATGCCTCGAATTATGATCAAGGGGGGCGTATGGAGGAATACCGAGGATGAAATTCTGAAAG
CAGCGGTAATGAAATATGGGAAAAATCAGTGGTCTAGGATTGCCTCATTGCTGCATAGAAAATCAGCAAAGCAGTGCAAAGCCAGATGGT
ATGAATGGCTGGATCCAAGCATTAAGAAGACAGAATGGTCCAGAGAAGAAGAGGAAAAACTCTTGCACTTGGCCAAGTTGATGCCAACTC
AGTGGAGGACCATTGCTCCAATCATTGGAAGAACAGCGGCCCAGTGCTTAGAACACTATGAATTTCTTCTGGATAAAGCTGCCCAAAGAG
ACAATGAAGAGGAAACAACAGATGATCCACGAAAACTTAAACCTGGAGAAATAGATCCAAATCCAGAAACAAAACCAGCGCGGCCTGATC
CAATTGATATGGATGAGGATGAACTTGAGATGCTTTCTGAAGCCAGAGCCCGCTTGGCTAATACTCAGGGAAAGAAGGCCAAGAGGAAAG
CAAGAGAGAAACAATTGGAAGAAGCAAGACGTCTTGCTGCCCTCCAAAAAAGAAGAGAACTTCGAGCAGCTGGCATAGAAATTCAGAAGA
AAAGAAAAAGGAAGAGAGGAGTTGATTATAATGCCGAAATCCCATTTGAAAAAAAGCCTGCCCTTGGTTTTTATGATACTTCTGAGGAAA
ACTACCAAGCTCTTGACGCAGATTTCAGGAAATTAAGACAACAGGATCTTGATGGGGAGCTAAGATCTGAAAAAGAAGGAAGAGATAGAA
AAAAAGACAAACAGCATTTGAAAAGGAAAAAAGAATCTGATTTACCATCAGCTATTCTTCAAACTAGTGGTGTTTCTGAATTTACTAAAA
AGAGAAGCAAACTAGTACTTCCTGCCCCTCAGATTTCAGATGCAGAACTCCAGGAAGTTGTAAAAGTAGGCCAAGCGAGTGAAATTGCAC
GTCAAACTGCCGAGGAATCTGGCATAACAAATTCTGCTTCCAGTACACTTTTGTCTGAGTACAATGTCACCAACAACAGCGTTGCTCTTA
GAACACCACGAACACCAGCTTCCCAGGACAGAATTCTGCAGGTCCTGGCAAAACTGGCCTGTGGACTAAACAAGCCCAACCGCCAAACCC
TGGTTTCACATGGGTCAGTCCCACAGCTCTTCAGCCAAATGCCCATTCGCAAAATCCGTAGTCTTGGAGGAAAGCTAGGGGCCTCTGTCA
TTGAGATCCTAGGGATAGAATACATGGGTGAACTGACCCAGTTCACTGAATCCCAGCTCCAGAGTCATTTTGGGGAGAAGAATGGGTCTT
GGCTATATGCCATGTGCCGAGGGATTGAACATGATCCAGTTAAACCCAGGCAACTACCCAAAACCATTGGCTGTAGTAAGAACTTCCCAG
GAAAAACAGCTCTTGCTACTCGGGAACAGGTACAATGGTGGCTGTTGCAATTAGCCCAGGAACTAGAGGAGAGACTGACTAAAGACCGAA
ATGATAATGACAGGGTAGCCACCCAGCTGGTTGTGAGCATTCGTGTACAAGGAGACAAACGCCTCAGCAGCCTGCGCCGCTGCTGTGCCC
TTACCCGCTATGATGCTCACAAGATGAGCCATGATGCATTTACTGTCATCAAGAACTGTAATACTTCTGGAATCCAGACAGAATGGTCTC
CTCCTCTCACAATGCTTTTCCTCTGTGCTACAAAATTTTCTGCCTCTGCCCCTTCATCTTCTACAGACATCACCAGCTTCTTGAGCAGTG
ACCCAAGTTCTCTGCCAAAGGTGCCAGTTACCAGCTCAGAAGCTAAGACCCAGGGAAGTGGCCCAGCGGTGACAGCCACTAAGAAAGCAA
CCACGTCTCTGGAATCATTCTTCCAAAAAGCTGCAGAAAGGCAGAAAGTTAAAGAAGCTTCGCTTTCATCTCTTACTGCTCCCACTCAGG
CTCCCATGAGCAATTCACCATCCAAGCCCTCATTACCTTTTCAAACCAGTCAAAGTACAGGAACTGAGCCCTTCTTTAAGCAGAAAAGTC
TGCTTCTAAAGCAGAAACAGCTTAATAATTCTTCAGTTTCTTCCCCCCAACAAAACCCATGGTCCAACTGTAAAGCATTACCAAACTCTT
TACCAACAGAGTATCCAGGGTGTGTCCCTGTTTGTGAAGGGGTGTCGAAGCTAGAAGAATCCTCTAAAGCAACTCCTGCAGAGATGGATT
TGGCCCACAACAGCCAAAGCATGCACGCCTCTTCAGCTTCCAAATCTGTGCTGGAGGTGACTCAGAAAGCAACCCCAAATCCAAGTCTTC
TAGCTGCTGAGGACCAAGTGCCCTGTGAGAAGTGTGGCTCCCTGGTACCGGTATGGGATATGCCAGAACACATGGACTATCATTTTGCAT
TGGAGTTGCAGAAATCCTTTTTGCAGCCCCACTCTTCAAACCCCCAGGTTGTTTCTGCCGTATCTCATCAAGGCAAAAGAAATCCCAAGA
GCCCTTTGGCCTGCACTAATAAACGCCCCAGGCCTGAGGGCATGCAAACATTGGAATCATTTTTTAAGCCATTAACACATTAGTGCTGCC
CTCAGGCTTGCCTGTAGGATTTAATATTTTTTATCTTTACAGATCTTTATCTTTAATATTTTATCTTTACAGATTTCCCTGAGAAAGGGA
ATTATGAAATTTTTAATACAAAAAATAATCCATTTAGGTGCTGAGTTACGGTCCCATCTCTTCACAGGCATGGATTCTAATCCCACTGCT
GACAGAGATGTAAAAATTCATCCTACCAGAGTTTTTAATCTTTAGCATTTAGGGAGGCAGTGTCATAAAGTAAAAAGTGTGTGGGCCTTG
GAGTCTAAGAGACGTGGTTGCAAACTTAGCTCTGGTTATTGCAATGAGGGCCTTGAACAAGTCATTTTCTTCACATTCTCATCTGTAAAA
TGGAGATAATACCTTACAGATTATTGCAGATTAATAACAATGTATTCAAATTATGTAACTCGGCCGGGTACAATGGCTCACGCCTGTAAT
CCTAACACTTTGGGAGGCCGAGGCAGACAGATCACCTGAGGTCAGGAGTTTGAGACCAGCCTGGCCAACATGGCAAAACCATCTCTACTA
AAAATAGAAAAATTAGCCAGGCACGTTCCAGGCACCTGTGATCCCAGCTACTTAGAGGCTGAGGCAGAAGAATTGCTTTAACCTTGGAGG
CGGAGGTTGCATTGAGCTGAGATCATGCTAGTGCGCTCCAGCCTGGGCAACAGAGCGAGACTTCATCTCAGAAAATAAAAAATAGGGGCC
AGGCACAGTGGCTCATACCTGTAATGCCAGCACTTTGGGAGGCCAAGGCGGGCAGATCACGAGGTCAGGAGTTTCAGACCAATATGGTGA
AACCCCATCTCTACTAAAATTACAAAAAAAATTATCCAGGCGTGGTGGTGCACGCCTGTAATCCCAGCTACTCAGGAGGCTAAGGCAGGA
GAATCACTTGAACCCAGGAGGCAGAGGTTGGAGTGAGCTGAGATCGCGCCACCGCACTCCAGCCTGGGCAACAGAGCGAGACTCCATCTC
AAACAAAAACAAGAACAAAAACAAACATAAAGTTGGCACAGAAAAGGGACCAAGTTTAAAAAAGGGTTTTAAATGTAATGAGACTTGCAT

>In-frame_CDC5L_ENST00000371477_chr6_44376369_+_POLH_ENST00000535400_chr6_43568725_+_3160nt
TTTCTTCCATTCTGTTTTGGACATGCGCGGGGCGTAAGGCGCTTTGGCCAGAGTGGTTTGATGGTTTTGTGTTAGTCTTCCTGCAGCTGA
GCTTCCACAAGACACTTTTTCCCTTTCAGCCACCCAATATCTCGCGAGACTTGCTATTCTGCGCCCCCTCCCACCTTGCGCTTGCGCAGA
TCTTCAAAGCAGAAGGTCGCGCTTGGAGGAAGTGGCGGCTTTGAGTCCGGTGGCCCAATCGCTGTTACTACTTCTCTGAAGCTCCTCTCG
GCTGCTTGCCGAGACACCCTGCCGCCAAGATGCCTCGAATTATGATCAAGGGGGGCGTATGGAGGAATACCGAGGATGAAATTCTGAAAG
CAGCGGTAATGAAATATGGGAAAAATCAGTGGTCTAGGATTGCCTCATTGCTGCATAGAAAATCAGCAAAGCAGTGCAAAGCCAGATGGT
ATGAATGGCTGGATCCAAGCATTAAGAAGACAGAATGGTCCAGAGAAGAAGAGGAAAAACTCTTGCACTTGGCCAAGTTGATGCCAACTC
AGTGGAGGACCATTGCTCCAATCATTGGAAGAACAGCGGCCCAGTGCTTAGAACACTATGAATTTCTTCTGGATAAAGCTGCCCAAAGAG
ACAATGAAGAGGAAACAACAGATGATCCACGAAAACTTAAACCTGGAGAAATAGATCCAAATCCAGAAACAAAACCAGCGCGGCCTGATC
CAATTGATATGGATGAGGATGAACTTGAGATGCTTTCTGAAGCCAGAGCCCGCTTGGCTAATACTCAGGGAAAGAAGGCCAAGAGGAAAG
CAAGAGAGAAACAATTGGAAGAAGCAAGACGTCTTGCTGCCCTCCAAAAAAGAAGAGAACTTCGAGCAGCTGGCATAGAAATTCAGAAGA
AAAGAAAAAGGAAGAGAGGAGTTGATTATAATGCCGAAATCCCATTTGAAAAAAAGCCTGCCCTTGGTTTTTATGATACTTCTGAGGAAA
ACTACCAAGCTCTTGACGCAGATTTCAGGAAATTAAGACAACAGGATCTTGATGGGGAGCTAAGATCTGAAAAAGAAGGAAGAGATAGAA
AAAAAGACAAACAGCATTTGAAAAGGAAAAAAGAATCTGATTTACCATCAGCTATTCTTCAAACTAGTGGTGTTTCTGAATTTACTAAAA
AGAGAAGCAAACTAGTACTTCCTGCCCCTCAGATTTCAGATGCAGAACTCCAGGAAGTTGTAAAAGTAGGCCAAGCGAGTGAAATTGCAC
GTCAAACTGCCGAGGAATCTGGCATAACAAATTCTGCTTCCAGTACACTTTTGTCTGAGTACAATGTCACCAACAACAGCGTTGCTCTTA
GAACACCACGAACACCAGCTTCCCAGGACAGAATTCTGCAGGTCCTGGCAAAACTGGCCTGTGGACTAAACAAGCCCAACCGCCAAACCC
TGGTTTCACATGGGTCAGTCCCACAGCTCTTCAGCCAAATGCCCATTCGCAAAATCCGTAGTCTTGGAGGAAAGCTAGGGGCCTCTGTCA
TTGAGATCCTAGGGATAGAATACATGGGTGAACTGACCCAGTTCACTGAATCCCAGCTCCAGAGTCATTTTGGGGAGAAGAATGGGTCTT
GGCTATATGCCATGTGCCGAGGGATTGAACATGATCCAGTTAAACCCAGGCAACTACCCAAAACCATTGGCTGTAGTAAGAACTTCCCAG
GAAAAACAGCTCTTGCTACTCGGGAACAGGTACAATGGTGGCTGTTGCAATTAGCCCAGGAACTAGAGGAGAGACTGACTAAAGACCGAA
ATGATAATGACAGGGTAGCCACCCAGCTGGTTGTGAGCATTCGTGTACAAGGAGACAAACGCCTCAGCAGCCTGCGCCGCTGCTGTGCCC
TTACCCGCTATGATGCTCACAAGATGAGCCATGATGCATTTACTGTCATCAAGAACTGTAATACTTCTGGAATCCAGACAGAATGGTCTC
CTCCTCTCACAATGCTTTTCCTCTGTGCTACAAAATTTTCTGCCTCTGCCCCTTCATCTTCTACAGACATCACCAGCTTCTTGAGCAGTG
ACCCAAGTTCTCTGCCAAAGGTGCCAGTTACCAGCTCAGAAGCTAAGACCCAGGGAAGTGGCCCAGCGGTGACAGCCACTAAGAAAGCAA
CCACGTCTCTGGAATCATTCTTCCAAAAAGCTGCAGAAAGGCAGAAAGTTAAAGAAGCTTCGCTTTCATCTCTTACTGCTCCCACTCAGG
CTCCCATGAGCAATTCACCATCCAAGCCCTCATTACCTTTTCAAACCAGTCAAAGTACAGGAACTGAGCCCTTCTTTAAGCAGAAAAGTC
TGCTTCTAAAGCAGAAACAGCTTAATAATTCTTCAGTTTCTTCCCCCCAACAAAACCCATGGTCCAACTGTAAAGCATTACCAAACTCTT
TACCAACAGAGTATCCAGGGTGTGTCCCTGTTTGTGAAGGGGTGTCGAAGCTAGAAGAATCCTCTAAAGCAACTCCTGCAGAGATGGATT
TGGCCCACAACAGCCAAAGCATGCACGCCTCTTCAGCTTCCAAATCTGTGCTGGAGGTGACTCAGAAAGCAACCCCAAATCCAAGTCTTC
TAGCTGCTGAGGACCAAGTGCCCTGTGAGAAGTGTGGCTCCCTGGTACCGGTATGGGATATGCCAGAACACATGGACTATCATTTTGCAT
TGGAGTTGCAGAAATCCTTTTTGCAGCCCCACTCTTCAAACCCCCAGGTTGTTTCTGCCGTATCTCATCAAGGCAAAAGAAATCCCAAGA
GCCCTTTGGCCTGCACTAATAAACGCCCCAGGCCTGAGGGCATGCAAACATTGGAATCATTTTTTAAGCCATTAACACATTAGTGCTGCC
CTCAGGCTTGCCTGTAGGATTTAATATTTTTTATCTTTACAGATCTTTATCTTTAATATTTTATCTTTACAGATTTCCCTGAGAAAGGGA
ATTATGAAATTTTTAATACAAAAAATAATCCATTTAGGTGCTGAGTTACGGTCCCATCTCTTCACAGGCTGGTCTTGAACTCTTGATCTC
AAGTGATCCACCCGCCCTGGCCTCCCAAAGTGCTGGGATTACAGGCCTGAGCCACCAGGCCAGCCCCAACTTCTACTTTTTATTTTATTT

>In-frame_CDC5L_ENST00000371477_chr6_44376369_+_POLH_ENST00000372226_chr6_43568725_+_3905nt
TTTCTTCCATTCTGTTTTGGACATGCGCGGGGCGTAAGGCGCTTTGGCCAGAGTGGTTTGATGGTTTTGTGTTAGTCTTCCTGCAGCTGA
GCTTCCACAAGACACTTTTTCCCTTTCAGCCACCCAATATCTCGCGAGACTTGCTATTCTGCGCCCCCTCCCACCTTGCGCTTGCGCAGA
TCTTCAAAGCAGAAGGTCGCGCTTGGAGGAAGTGGCGGCTTTGAGTCCGGTGGCCCAATCGCTGTTACTACTTCTCTGAAGCTCCTCTCG
GCTGCTTGCCGAGACACCCTGCCGCCAAGATGCCTCGAATTATGATCAAGGGGGGCGTATGGAGGAATACCGAGGATGAAATTCTGAAAG
CAGCGGTAATGAAATATGGGAAAAATCAGTGGTCTAGGATTGCCTCATTGCTGCATAGAAAATCAGCAAAGCAGTGCAAAGCCAGATGGT
ATGAATGGCTGGATCCAAGCATTAAGAAGACAGAATGGTCCAGAGAAGAAGAGGAAAAACTCTTGCACTTGGCCAAGTTGATGCCAACTC
AGTGGAGGACCATTGCTCCAATCATTGGAAGAACAGCGGCCCAGTGCTTAGAACACTATGAATTTCTTCTGGATAAAGCTGCCCAAAGAG
ACAATGAAGAGGAAACAACAGATGATCCACGAAAACTTAAACCTGGAGAAATAGATCCAAATCCAGAAACAAAACCAGCGCGGCCTGATC
CAATTGATATGGATGAGGATGAACTTGAGATGCTTTCTGAAGCCAGAGCCCGCTTGGCTAATACTCAGGGAAAGAAGGCCAAGAGGAAAG
CAAGAGAGAAACAATTGGAAGAAGCAAGACGTCTTGCTGCCCTCCAAAAAAGAAGAGAACTTCGAGCAGCTGGCATAGAAATTCAGAAGA
AAAGAAAAAGGAAGAGAGGAGTTGATTATAATGCCGAAATCCCATTTGAAAAAAAGCCTGCCCTTGGTTTTTATGATACTTCTGAGGAAA
ACTACCAAGCTCTTGACGCAGATTTCAGGAAATTAAGACAACAGGATCTTGATGGGGAGCTAAGATCTGAAAAAGAAGGAAGAGATAGAA
AAAAAGACAAACAGCATTTGAAAAGGAAAAAAGAATCTGATTTACCATCAGCTATTCTTCAAACTAGTGGTGTTTCTGAATTTACTAAAA
AGAGAAGCAAACTAGTACTTCCTGCCCCTCAGATTTCAGATGCAGAACTCCAGGAAGTTGTAAAAGTAGGCCAAGCGAGTGAAATTGCAC
GTCAAACTGCCGAGGAATCTGGCATAACAAATTCTGCTTCCAGTACACTTTTGTCTGAGTACAATGTCACCAACAACAGCGTTGCTCTTA
GAACACCACGAACACCAGCTTCCCAGGACAGAATTCTGCAGGTCCTGGCAAAACTGGCCTGTGGACTAAACAAGCCCAACCGCCAAACCC
TGGTTTCACATGGGTCAGTCCCACAGCTCTTCAGCCAAATGCCCATTCGCAAAATCCGTAGTCTTGGAGGAAAGCTAGGGGCCTCTGTCA
TTGAGATCCTAGGGATAGAATACATGGGTGAACTGACCCAGTTCACTGAATCCCAGCTCCAGAGTCATTTTGGGGAGAAGAATGGGTCTT
GGCTATATGCCATGTGCCGAGGGATTGAACATGATCCAGTTAAACCCAGGCAACTACCCAAAACCATTGGCTGTAGTAAGAACTTCCCAG
GAAAAACAGCTCTTGCTACTCGGGAACAGGTACAATGGTGGCTGTTGCAATTAGCCCAGGAACTAGAGGAGAGACTGACTAAAGACCGAA
ATGATAATGACAGGGTAGCCACCCAGCTGGTTGTGAGCATTCGTGTACAAGGAGACAAACGCCTCAGCAGCCTGCGCCGCTGCTGTGCCC
TTACCCGCTATGATGCTCACAAGATGAGCCATGATGCATTTACTGTCATCAAGAACTGTAATACTTCTGGAATCCAGACAGAATGACATC
ACCAGCTTCTTGAGCAGTGACCCAAGTTCTCTGCCAAAGGTGCCAGTTACCAGCTCAGAAGCTAAGACCCAGGGAAGTGGCCCAGCGGTG
ACAGCCACTAAGAAAGCAACCACGTCTCTGGAATCATTCTTCCAAAAAGCTGCAGAAAGGCAGAAAGTTAAAGAAGCTTCGCTTTCATCT
CTTACTGCTCCCACTCAGGCTCCCATGAGCAATTCACCATCCAAGCCCTCATTACCTTTTCAAACCAGTCAAAGTACAGGAACTGAGCCC
TTCTTTAAGCAGAAAAGTCTGCTTCTAAAGCAGAAACAGCTTAATAATTCTTCAGTTTCTTCCCCCCAACAAAACCCATGGTCCAACTGT
AAAGCATTACCAAACTCTTTACCAACAGAGTATCCAGGGTGTGTCCCTGTTTGTGAAGGGGTGTCGAAGCTAGAAGAATCCTCTAAAGCA
ACTCCTGCAGAGATGGATTTGGCCCACAACAGCCAAAGCATGCACGCCTCTTCAGCTTCCAAATCTGTGCTGGAGGTGACTCAGAAAGCA
ACCCCAAATCCAAGTCTTCTAGCTGCTGAGGACCAAGTGCCCTGTGAGAAGTGTGGCTCCCTGGTACCGGTATGGGATATGCCAGAACAC
ATGGACTATCATTTTGCATTGGAGTTGCAGAAATCCTTTTTGCAGCCCCACTCTTCAAACCCCCAGGTTGTTTCTGCCGTATCTCATCAA
GGCAAAAGAAATCCCAAGAGCCCTTTGGCCTGCACTAATAAACGCCCCAGGCCTGAGGGCATGCAAACATTGGAATCATTTTTTAAGCCA
TTAACACATTAGTGCTGCCCTCAGGCTTGCCTGTAGGATTTAATATTTTTTATCTTTACAGATCTTTATCTTTAATATTTTATCTTTACA
GATTTCCCTGAGAAAGGGAATTATGAAATTTTTAATACAAAAAATAATCCATTTAGGTGCTGAGTTACGGTCCCATCTCTTCACAGGCAT
GGATTCTAATCCCACTGCTGACAGAGATGTAAAAATTCATCCTACCAGAGTTTTTAATCTTTAGCATTTAGGGAGGCAGTGTCATAAAGT
AAAAAGTGTGTGGGCCTTGGAGTCTAAGAGACGTGGTTGCAAACTTAGCTCTGGTTATTGCAATGAGGGCCTTGAACAAGTCATTTTCTT
CACATTCTCATCTGTAAAATGGAGATAATACCTTACAGATTATTGCAGATTAATAACAATGTATTCAAATTATGTAACTCGGCCGGGTAC
AATGGCTCACGCCTGTAATCCTAACACTTTGGGAGGCCGAGGCAGACAGATCACCTGAGGTCAGGAGTTTGAGACCAGCCTGGCCAACAT
GGCAAAACCATCTCTACTAAAAATAGAAAAATTAGCCAGGCACGTTCCAGGCACCTGTGATCCCAGCTACTTAGAGGCTGAGGCAGAAGA
ATTGCTTTAACCTTGGAGGCGGAGGTTGCATTGAGCTGAGATCATGCTAGTGCGCTCCAGCCTGGGCAACAGAGCGAGACTTCATCTCAG
AAAATAAAAAATAGGGGCCAGGCACAGTGGCTCATACCTGTAATGCCAGCACTTTGGGAGGCCAAGGCGGGCAGATCACGAGGTCAGGAG
TTTCAGACCAATATGGTGAAACCCCATCTCTACTAAAATTACAAAAAAAATTATCCAGGCGTGGTGGTGCACGCCTGTAATCCCAGCTAC
TCAGGAGGCTAAGGCAGGAGAATCACTTGAACCCAGGAGGCAGAGGTTGGAGTGAGCTGAGATCGCGCCACCGCACTCCAGCCTGGGCAA
CAGAGCGAGACTCCATCTCAAACAAAAACAAGAACAAAAACAAACATAAAGTTGGCACAGAAAAGGGACCAAGTTTAAAAAAGGGTTTTA


Top

FusionGenePPI for CDC5L_POLH


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CDC5LTTF2, PLRG1, CDK2, SF3B1, SF3B2, SF3A1, SF3B4, SNRPD1, SNRPD2, SNRPD3, SNRPA, SRSF2, SRRM1, ILF2, SNRPA1, SRSF1, RBMX, SFPQ, TOP2A, PPM1D, PRKDC, PPP1CA, CWC15, PRPF19, RPL12, RPS16, RPS25, HSPA8, BZW1, DYNC1H1, GCN1L1, SCAF8, SFI1, RPL13, BCAS2, PMS1, ZNF35, PCBD2, ZSCAN1, SRRM2, CTNNBL1, TADA2A, SNW1, PRPF3, HDAC5, YWHAG, CALM1, KIF3C, MYT1L, SPTBN1, YWHAQ, KDM1A, HOOK1, MACF1, PDE4DIP, KALRN, TRAK1, SH3BP5, EXOC1, WWC1, TRIO, DST, GLTSCR1L, ZNF451, SYNE1, AKAP9, CCDC136, YWHAZ, SFR1, KIF5B, DIXDC1, PPFIA2, AKAP6, PPP1R13B, GSE1, EXOC7, KANSL1, DISC1, TRAF3IP1, HDGF, SF3A2, RNU1-1, RNU2-1, RNU4-1, RNU6-1, SNRNP200, PSMA2, HNRNPA1, CUL3, CUL1, CAND1, ATR, WRN, KIAA0907, CDC5L, U2AF2, USB1, EFTUD2, PRPF8, U2AF1, EIF4A3, SRSF5, DHX15, HNRNPR, SAP18, WDR18, TRA2A, UTP14A, ZC3H18, VTN, TPBG, RPS3, RPS11, SEPT7, SON, TRIM55, SUB1, HSPA1L, RPS4X, MDC1, PAXIP1, MAGOH, ORC1, MCM3, ORC2, MCM4, MCM10, MCM5, ORC5, CDKN2A, CDT1, CDKN1A, KRT18, EMID1, GRB14, LMO2, SMARCD1, TARDBP, RPA3, RPA2, RPA1, WWOX, TCP1, ERG, CSNK2A2, LIN28A, STAU1, FUS, GOLGA2, GOLGA8EP, GOLGA8F, CUL7, OBSL1, EED, DHX8, TSSC4, NMNAT1, EAPP, PPIE, WDR83, CCDC94, RBM4B, HNRNPM, LGALS3, NTRK1, DDX47, PDIA5, DHX9, EIF2S2, FTSJ3, ISY1-RAB43, ISY1, MRPL40, NOP2, RBM39, RPL39, RPL9, RPN1, SF3B3, SRP14, SRP72, SCARNA22, CDC25B, LOC102724594, CHERP, SF3A3, DDX42, HNRNPK, TRUB1, CSTF3, ELAVL1, XRN2, U2SURP, PRPF6, HNRNPA2B1, HNRNPC, HNRNPF, HNRNPH1, HNRNPU, NONO, GEMIN4, PCBP1, SF3B6, CPSF3, EXOSC10, CPSF2, LUC7L, RBM4, SMN1, SMN2, SNRNP70, CPSF7, RBM17, HNRNPLL, SNRNP40, RBM7, USP39, NUDT21, SREK1, SNRPE, ILF3, PCBP2, PRCC, PTBP1, PTBP2, SRSF4, SRSF7, GEMIN6, PRPF4B, SART1, NOLC1, PTBP3, PSMC3, ACTB, SMC4, DNM1L, TUBB, ACTR2, RAD50, TRAP1, TUBA4A, PSMC6, DDX39A, CDK9, PAK4, TUBB4B, NDC80, TUBGCP3, DCTN2, CCT7, CCT4, CCT2, EXOC5, KHDRBS1, CCT8, NUDC, SEPT9, TUBGCP2, RUVBL2, SUGT1, EHD1, KIF2C, CHEK1, DDX19B, PSMC1, RBM45, COPA, COPB1, CSE1L, AP1B1, SPATA5, DFNA5, DIAPH1, DYNC1LI2, DNM2, DSP, FASN, LRWD1, FEN1, COPG1, RALY, CCT5, CNOT1, MDN1, SMCHD1, NCAPH, ORC6, ORC3, KIF4A, HSPA12A, INTS1, PHGDH, VPS33B, COPG2, ZNF638, FHOD1, RACGAP1, MSH6, PARVB, HDLBP, HELLS, EHD4, DNAJA1, HSPA5, HSPB1, HSP90AA1, HSP90AB1, HSPD1, ARCN1, KIF11, KPNB1, KPNA2, LIMS1, LMNA, MRE11A, MSH2, MYH9, NBN, DRG1, NSF, ORC4, UCHL5, DDX41, GULP1, RTCB, PFKM, PFKP, PLEC, PLK1, PNN, POLD1, ANLN, PPP2R1A, RIF1, FANCI, DDX19A, ABCF3, WDR33, CDKN2AIP, KIF21A, FERMT1, LRRC40, SCYL2, NSUN5, IPO9, ENAH, PARVA, EXOC2, PKN2, UNC45A, MAP2K7, RAD18, SMARCAD1, PSMC2, PSMC4, PSMC5, PSMD1, PSMD2, PSMD3, PSMD11, PSMD12, PSMD13, TWF1, SHROOM3, CHD8, RANBP2, RANGAP1, RBBP5, RBBP7, UPF1, RFC2, RFC3, RFC4, RFC5, EXOC4, ANAPC1, EPS8L2, FAM129B, INTS3, HLTF, SPTAN1, SRP54, SRP68, BUB1, BUB1B, TLN1, TMPO, HSP90B1, CCT3, TUBG1, UBE2N, VIM, AHNAK, DDX39B, CDC73, UBA5, MYO15B, SYMPK, SEH1L, CAPG, SMC1A, UBL4A, ARID1A, CAPZA1, PICALM, EPPK1, NUF2, MAD1L1, SMARCA5, API5, RUVBL1, CDC23, IQGAP1, CCNB1, HIP1R, UBE2M, BTAF1, CCT6A, SMC3, ARHGEF1, DEPDC7, ARHGEF2, BUB3, PDLIM7, TRIP13, ROCK2, CHD1L, NUP155, CKAP5, NCAPD2, OXSR1, CDC27, MVP, TUBA1B, WRNIP1, DDX5, UBE2D1, FAM120C, HUWE1, ACTR1A, AKAP8, SEC23A, MYBBP1A, DDX17, IPO7, SMC2, STAG2, BRD8, MORF4L1, COPS5, FAF1, MED12L, ARF5, RAVER1, EIF4A1, MAGEE2, PARP1, PARP4, CTNNA1, CTNND1, DDB1, DDX6, DTYMK, ECT2, EIF2D, EIF4A2, MARK2, ZBTB7C, ERCC1, FANCD2, CCZ1B, SUMO1, TPX2, SETX, EPB41L3, STAB1, MTCL1, CLASP1, USP24, BRD4, SCRIB, SKIV2L2, EDC4, NIPBL, GAPDH, TANC2, SENP3, ERAL1, INTS6, TUBGCP4, ARFIP1, UBE2S, GNAS, GNB3, GOLGB1, BRD7, TMOD3, CARD10, UBN1, ANAPC2, SNX12, NRG1, ANXA11, HSPA6, ITPK1, ARF4, TNPO1, IPO5, LMO7, MPP2, NF1, VPS36, SSUH2, DYNC1LI1, PCNT, ANAPC7, ZC3HC1, CCZ1, PELO, ERCC6L, ARGLU1, THAP1, NAT10, LRRC1, HAUS7, INTS8, RNF130, RNF17, YLPM1, CASC5, NUP107, XPO5, RBBP4, RNF2, BRD2, RXRB, BID, MAP2K4, SHC1, VPS33A, SMARCA2, SMARCA4, SMARCC2, SNX2, TRIM21, SUPV3L1, TNFAIP2, TOP1, TPR, UMPS, VPS51, YWHAE, DOCK5, TRMT1L, DOCK8, LAS1L, TLN2, STK24, TUBA1C, PPFIA1, IKBKAP, TNKS1BP1, USO1, GMPS, CDC16, PSTPIP2, MAP7, USP10, DDX21, AURKB, COPB2, LENG9, GTPBP1, SEC24C, CLINT1, NUP93, MELK, DDX46, CDC20, POU5F1, ZNF746, PPP4C, KIAA1143, SYF2, CD44, DVL3, ELAVL2, NCL, CYLD, CD2BP2, G3BP1, BRCA1POLHPCNA, REV1, RAD18, TUBA1B, TUBB, UBE2B, UBC, RCHY1, MYC, POLI, HSP90AA1, MDM2, SPRTN, MLH1, APP, BRCA1, FANCD2, TRAIP, LGR4, NXF1, PALB2, BRCA2, PCBP1, USP7, CENPF, PLD1, DHX16, PACSIN3, SIRT7, GTPBP2, CASC5, FRYL, POLD2, LSM5, POTEI, ACTBL2, ACTB, TUBA4A, AHNAK, WBP2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+816501_659364803DAPK3
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+816706_800364803PLRG1
HgeneCDC5Lchr6:44376369chr6:43568725ENST00000371477+816260_606364803PPP1R8


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CDC5L_POLH


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CDC5L_POLH


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePOLHC1848410Xeroderma pigmentosum, variant type3CTD_human;ORPHANET;UNIPROT
TgenePOLHC0043346Xeroderma Pigmentosum1CTD_human