FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 6290

FusionGeneSummary for CD99L2_ARHGAP36

check button Fusion gene summary
Fusion gene informationFusion gene name: CD99L2_ARHGAP36
Fusion gene ID: 6290
HgeneTgene
Gene symbol

CD99L2

ARHGAP36

Gene ID

83692

158763

Gene nameCD99 molecule like 2Rho GTPase activating protein 36
SynonymsCD99B|MIC2L1-
Cytomap

Xq28

Xq26.1

Type of geneprotein-codingprotein-coding
DescriptionCD99 antigen-like protein 2MIC2 like 1MIC2-like protein 1rho GTPase-activating protein 36
Modification date2018051920180519
UniProtAcc

Q8TCZ2

Q6ZRI8

Ensembl transtripts involved in fusion geneENST00000346693, ENST00000370377, 
ENST00000355149, ENST00000437787, 
ENST00000466436, ENST00000320893, 
ENST00000276211, ENST00000370922, 
ENST00000370921, 
Fusion gene scores* DoF score8 X 7 X 2=1121 X 1 X 1=1
# samples 81
** MAII scorelog2(8/112*10)=-0.485426827170242
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: CD99L2 [Title/Abstract] AND ARHGAP36 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-GI-A2C9-01ACD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5UTR-3CDSENST00000346693ENST00000276211CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
5UTR-3CDSENST00000346693ENST00000370922CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
5UTR-intronENST00000346693ENST00000370921CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
Frame-shitENST00000370377ENST00000276211CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
In-frameENST00000370377ENST00000370922CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
5CDS-intronENST00000370377ENST00000370921CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
Frame-shitENST00000355149ENST00000276211CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
In-frameENST00000355149ENST00000370922CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
5CDS-intronENST00000355149ENST00000370921CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
Frame-shitENST00000437787ENST00000276211CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
In-frameENST00000437787ENST00000370922CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
5CDS-intronENST00000437787ENST00000370921CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
Frame-shitENST00000466436ENST00000276211CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
In-frameENST00000466436ENST00000370922CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
5CDS-intronENST00000466436ENST00000370921CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
Frame-shitENST00000320893ENST00000276211CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
In-frameENST00000320893ENST00000370922CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+
5CDS-intronENST00000320893ENST00000370921CD99L2chrX

149999704

-ARHGAP36chrX

130215734

+

Top

FusionProtFeatures for CD99L2_ARHGAP36


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
CD99L2

Q8TCZ2

ARHGAP36

Q6ZRI8

GTPase activator for the Rho-type GTPases by convertingthem to an inactive GDP-bound state. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for CD99L2_ARHGAP36


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_CD99L2_ENST00000370377_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_560aa
MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKLSVLGGAPGHNPDRRTKMVSIHSLSELERLKLQETAYHELVARHFLS
EFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRRVFGRIRRFFSR
RRNEPTLPREFTRRGRRGAVSVDSLAELEDGALLLQTLQLSKISFPIGQRLLGSKRKMSLNPIAKQIPQVVEACCQFIEKHGLSAVGIFT
LEYSVQRVRQLREEFDQGLDVVLDDNQNVHDVAALLKEFFRDMKDSLLPDDLYMSFLLTATLKPQDQLSALQLLVYLMPPCHSDTLERLL
KALHKITENCEDSIGIDGQLVPGNRMTSTNLALVFGSALLKKGKFGKRESRKTKLGIDHTVASVNVVRAMIDNWDVLFQVPPHIQRQVAK
RVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNPPIPEQDRP

>In-frame_CD99L2_ENST00000355149_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_560aa
MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKLSVLGGAPGHNPDRRTKMVSIHSLSELERLKLQETAYHELVARHFLS
EFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRRVFGRIRRFFSR
RRNEPTLPREFTRRGRRGAVSVDSLAELEDGALLLQTLQLSKISFPIGQRLLGSKRKMSLNPIAKQIPQVVEACCQFIEKHGLSAVGIFT
LEYSVQRVRQLREEFDQGLDVVLDDNQNVHDVAALLKEFFRDMKDSLLPDDLYMSFLLTATLKPQDQLSALQLLVYLMPPCHSDTLERLL
KALHKITENCEDSIGIDGQLVPGNRMTSTNLALVFGSALLKKGKFGKRESRKTKLGIDHTVASVNVVRAMIDNWDVLFQVPPHIQRQVAK
RVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNPPIPEQDRP

>In-frame_CD99L2_ENST00000437787_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_560aa
MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKLSVLGGAPGHNPDRRTKMVSIHSLSELERLKLQETAYHELVARHFLS
EFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRRVFGRIRRFFSR
RRNEPTLPREFTRRGRRGAVSVDSLAELEDGALLLQTLQLSKISFPIGQRLLGSKRKMSLNPIAKQIPQVVEACCQFIEKHGLSAVGIFT
LEYSVQRVRQLREEFDQGLDVVLDDNQNVHDVAALLKEFFRDMKDSLLPDDLYMSFLLTATLKPQDQLSALQLLVYLMPPCHSDTLERLL
KALHKITENCEDSIGIDGQLVPGNRMTSTNLALVFGSALLKKGKFGKRESRKTKLGIDHTVASVNVVRAMIDNWDVLFQVPPHIQRQVAK
RVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNPPIPEQDRP

>In-frame_CD99L2_ENST00000466436_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_560aa
MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKLSVLGGAPGHNPDRRTKMVSIHSLSELERLKLQETAYHELVARHFLS
EFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRRVFGRIRRFFSR
RRNEPTLPREFTRRGRRGAVSVDSLAELEDGALLLQTLQLSKISFPIGQRLLGSKRKMSLNPIAKQIPQVVEACCQFIEKHGLSAVGIFT
LEYSVQRVRQLREEFDQGLDVVLDDNQNVHDVAALLKEFFRDMKDSLLPDDLYMSFLLTATLKPQDQLSALQLLVYLMPPCHSDTLERLL
KALHKITENCEDSIGIDGQLVPGNRMTSTNLALVFGSALLKKGKFGKRESRKTKLGIDHTVASVNVVRAMIDNWDVLFQVPPHIQRQVAK
RVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNPPIPEQDRP

>In-frame_CD99L2_ENST00000320893_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_560aa
MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKLSVLGGAPGHNPDRRTKMVSIHSLSELERLKLQETAYHELVARHFLS
EFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKHLELTATMQVEEATGQAAGRRRGNVVRRVFGRIRRFFSR
RRNEPTLPREFTRRGRRGAVSVDSLAELEDGALLLQTLQLSKISFPIGQRLLGSKRKMSLNPIAKQIPQVVEACCQFIEKHGLSAVGIFT
LEYSVQRVRQLREEFDQGLDVVLDDNQNVHDVAALLKEFFRDMKDSLLPDDLYMSFLLTATLKPQDQLSALQLLVYLMPPCHSDTLERLL
KALHKITENCEDSIGIDGQLVPGNRMTSTNLALVFGSALLKKGKFGKRESRKTKLGIDHTVASVNVVRAMIDNWDVLFQVPPHIQRQVAK
RVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNPPIPEQDRP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_CD99L2_ENST00000370377_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_1680nt
ATGGTGGCCTGGCGCTCGGCGTTCCTTGTCTGCCTCGCTTTCTCCTTGGCCACCCTGGTCCAGCGAGGATCTGGGGACTTTGATGATTTT
AACCTGGAGGATGCAGTGAAAGAAACTTCCTCAGTAAAGCTGAGTGTCTTGGGAGGAGCCCCAGGACACAACCCCGACCGCAGGACGAAG
ATGGTATCGATACACAGCCTCTCTGAGCTGGAGCGTCTGAAGCTGCAAGAGACTGCTTACCACGAACTCGTGGCCAGACATTTCCTCTCC
GAATTCAAACCTGACAGAGCTCTGCCTATTGACCGTCCGAACACCTTGGATAAGTGGTTTCTGATTTTGAGAGGACAGCAGAGGGCTGTA
TCACACAAGACATTTGGCATTAGCCTGGAAGAGGTCCTGGTGAACGAGTTTACCCGCCGCAAGCATCTTGAACTGACAGCCACGATGCAG
GTTGAAGAAGCCACCGGTCAGGCTGCGGGCCGTCGTCGGGGAAACGTGGTGCGAAGGGTGTTTGGCCGCATCCGGCGCTTTTTCAGTCGC
AGGCGGAATGAGCCCACCTTGCCCCGGGAGTTCACTCGCCGTGGGCGTCGAGGTGCAGTGTCTGTGGATAGTCTGGCTGAGCTGGAAGAC
GGAGCCCTGCTGCTGCAGACCCTGCAGCTTTCAAAAATTTCCTTTCCAATTGGCCAACGACTTCTGGGATCCAAAAGGAAGATGAGTCTC
AATCCGATTGCGAAACAAATCCCCCAGGTTGTTGAGGCTTGCTGCCAATTCATTGAAAAACATGGCTTAAGCGCAGTGGGGATTTTTACC
CTTGAATACTCCGTGCAGCGAGTGCGTCAGCTCCGTGAAGAATTTGATCAAGGTCTGGATGTAGTGCTGGATGACAATCAGAATGTGCAT
GATGTGGCTGCACTCCTCAAGGAGTTTTTCCGTGACATGAAGGATTCTCTGCTGCCAGATGATCTGTACATGTCATTCCTCCTGACAGCA
ACTTTAAAGCCCCAGGATCAGCTTTCTGCCCTGCAGTTGCTGGTCTACCTGATGCCACCCTGCCACAGTGATACCCTGGAGCGTCTGCTG
AAGGCCCTGCATAAAATCACTGAGAACTGCGAGGACTCAATTGGCATTGATGGACAGTTGGTCCCAGGCAACCGTATGACTTCCACTAAC
TTGGCCTTGGTGTTTGGATCTGCTCTCCTGAAAAAAGGAAAGTTTGGCAAGAGAGAGTCCAGGAAAACAAAGCTGGGGATTGATCACTAT
GTTGCTTCTGTCAATGTGGTCCGTGCCATGATTGATAACTGGGATGTCCTCTTCCAGGTGCCTCCCCATATTCAGAGGCAGGTTGCTAAG
CGCGTGTGGAAGTCCAGCCCGGAAGCACTTGATTTTATCAGACGCAGGAACTTGAGGAAGATCCAGAGTGCACGCATAAAGATGGAAGAG
GATGCACTACTTTCTGATCCAGTGGAAACCTCTGCTGAAGCCCGGGCTGCTGTCCTTGCTCAAAGCAAGCCTTCTGATGAAGGTTCCTCT
GAGGAGCCAGCTGTGCCTTCCGGCACTGCCCGTTCCCATGACGATGAGGAAGGAGCGGGTAACCCTCCCATTCCGGAGCAAGACCGCCCA

>In-frame_CD99L2_ENST00000355149_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_1680nt
ATGGTGGCCTGGCGCTCGGCGTTCCTTGTCTGCCTCGCTTTCTCCTTGGCCACCCTGGTCCAGCGAGGATCTGGGGACTTTGATGATTTT
AACCTGGAGGATGCAGTGAAAGAAACTTCCTCAGTAAAGCTGAGTGTCTTGGGAGGAGCCCCAGGACACAACCCCGACCGCAGGACGAAG
ATGGTATCGATACACAGCCTCTCTGAGCTGGAGCGTCTGAAGCTGCAAGAGACTGCTTACCACGAACTCGTGGCCAGACATTTCCTCTCC
GAATTCAAACCTGACAGAGCTCTGCCTATTGACCGTCCGAACACCTTGGATAAGTGGTTTCTGATTTTGAGAGGACAGCAGAGGGCTGTA
TCACACAAGACATTTGGCATTAGCCTGGAAGAGGTCCTGGTGAACGAGTTTACCCGCCGCAAGCATCTTGAACTGACAGCCACGATGCAG
GTTGAAGAAGCCACCGGTCAGGCTGCGGGCCGTCGTCGGGGAAACGTGGTGCGAAGGGTGTTTGGCCGCATCCGGCGCTTTTTCAGTCGC
AGGCGGAATGAGCCCACCTTGCCCCGGGAGTTCACTCGCCGTGGGCGTCGAGGTGCAGTGTCTGTGGATAGTCTGGCTGAGCTGGAAGAC
GGAGCCCTGCTGCTGCAGACCCTGCAGCTTTCAAAAATTTCCTTTCCAATTGGCCAACGACTTCTGGGATCCAAAAGGAAGATGAGTCTC
AATCCGATTGCGAAACAAATCCCCCAGGTTGTTGAGGCTTGCTGCCAATTCATTGAAAAACATGGCTTAAGCGCAGTGGGGATTTTTACC
CTTGAATACTCCGTGCAGCGAGTGCGTCAGCTCCGTGAAGAATTTGATCAAGGTCTGGATGTAGTGCTGGATGACAATCAGAATGTGCAT
GATGTGGCTGCACTCCTCAAGGAGTTTTTCCGTGACATGAAGGATTCTCTGCTGCCAGATGATCTGTACATGTCATTCCTCCTGACAGCA
ACTTTAAAGCCCCAGGATCAGCTTTCTGCCCTGCAGTTGCTGGTCTACCTGATGCCACCCTGCCACAGTGATACCCTGGAGCGTCTGCTG
AAGGCCCTGCATAAAATCACTGAGAACTGCGAGGACTCAATTGGCATTGATGGACAGTTGGTCCCAGGCAACCGTATGACTTCCACTAAC
TTGGCCTTGGTGTTTGGATCTGCTCTCCTGAAAAAAGGAAAGTTTGGCAAGAGAGAGTCCAGGAAAACAAAGCTGGGGATTGATCACTAT
GTTGCTTCTGTCAATGTGGTCCGTGCCATGATTGATAACTGGGATGTCCTCTTCCAGGTGCCTCCCCATATTCAGAGGCAGGTTGCTAAG
CGCGTGTGGAAGTCCAGCCCGGAAGCACTTGATTTTATCAGACGCAGGAACTTGAGGAAGATCCAGAGTGCACGCATAAAGATGGAAGAG
GATGCACTACTTTCTGATCCAGTGGAAACCTCTGCTGAAGCCCGGGCTGCTGTCCTTGCTCAAAGCAAGCCTTCTGATGAAGGTTCCTCT
GAGGAGCCAGCTGTGCCTTCCGGCACTGCCCGTTCCCATGACGATGAGGAAGGAGCGGGTAACCCTCCCATTCCGGAGCAAGACCGCCCA

>In-frame_CD99L2_ENST00000437787_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_1680nt
ATGGTGGCCTGGCGCTCGGCGTTCCTTGTCTGCCTCGCTTTCTCCTTGGCCACCCTGGTCCAGCGAGGATCTGGGGACTTTGATGATTTT
AACCTGGAGGATGCAGTGAAAGAAACTTCCTCAGTAAAGCTGAGTGTCTTGGGAGGAGCCCCAGGACACAACCCCGACCGCAGGACGAAG
ATGGTATCGATACACAGCCTCTCTGAGCTGGAGCGTCTGAAGCTGCAAGAGACTGCTTACCACGAACTCGTGGCCAGACATTTCCTCTCC
GAATTCAAACCTGACAGAGCTCTGCCTATTGACCGTCCGAACACCTTGGATAAGTGGTTTCTGATTTTGAGAGGACAGCAGAGGGCTGTA
TCACACAAGACATTTGGCATTAGCCTGGAAGAGGTCCTGGTGAACGAGTTTACCCGCCGCAAGCATCTTGAACTGACAGCCACGATGCAG
GTTGAAGAAGCCACCGGTCAGGCTGCGGGCCGTCGTCGGGGAAACGTGGTGCGAAGGGTGTTTGGCCGCATCCGGCGCTTTTTCAGTCGC
AGGCGGAATGAGCCCACCTTGCCCCGGGAGTTCACTCGCCGTGGGCGTCGAGGTGCAGTGTCTGTGGATAGTCTGGCTGAGCTGGAAGAC
GGAGCCCTGCTGCTGCAGACCCTGCAGCTTTCAAAAATTTCCTTTCCAATTGGCCAACGACTTCTGGGATCCAAAAGGAAGATGAGTCTC
AATCCGATTGCGAAACAAATCCCCCAGGTTGTTGAGGCTTGCTGCCAATTCATTGAAAAACATGGCTTAAGCGCAGTGGGGATTTTTACC
CTTGAATACTCCGTGCAGCGAGTGCGTCAGCTCCGTGAAGAATTTGATCAAGGTCTGGATGTAGTGCTGGATGACAATCAGAATGTGCAT
GATGTGGCTGCACTCCTCAAGGAGTTTTTCCGTGACATGAAGGATTCTCTGCTGCCAGATGATCTGTACATGTCATTCCTCCTGACAGCA
ACTTTAAAGCCCCAGGATCAGCTTTCTGCCCTGCAGTTGCTGGTCTACCTGATGCCACCCTGCCACAGTGATACCCTGGAGCGTCTGCTG
AAGGCCCTGCATAAAATCACTGAGAACTGCGAGGACTCAATTGGCATTGATGGACAGTTGGTCCCAGGCAACCGTATGACTTCCACTAAC
TTGGCCTTGGTGTTTGGATCTGCTCTCCTGAAAAAAGGAAAGTTTGGCAAGAGAGAGTCCAGGAAAACAAAGCTGGGGATTGATCACTAT
GTTGCTTCTGTCAATGTGGTCCGTGCCATGATTGATAACTGGGATGTCCTCTTCCAGGTGCCTCCCCATATTCAGAGGCAGGTTGCTAAG
CGCGTGTGGAAGTCCAGCCCGGAAGCACTTGATTTTATCAGACGCAGGAACTTGAGGAAGATCCAGAGTGCACGCATAAAGATGGAAGAG
GATGCACTACTTTCTGATCCAGTGGAAACCTCTGCTGAAGCCCGGGCTGCTGTCCTTGCTCAAAGCAAGCCTTCTGATGAAGGTTCCTCT
GAGGAGCCAGCTGTGCCTTCCGGCACTGCCCGTTCCCATGACGATGAGGAAGGAGCGGGTAACCCTCCCATTCCGGAGCAAGACCGCCCA

>In-frame_CD99L2_ENST00000466436_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_1680nt
ATGGTGGCCTGGCGCTCGGCGTTCCTTGTCTGCCTCGCTTTCTCCTTGGCCACCCTGGTCCAGCGAGGATCTGGGGACTTTGATGATTTT
AACCTGGAGGATGCAGTGAAAGAAACTTCCTCAGTAAAGCTGAGTGTCTTGGGAGGAGCCCCAGGACACAACCCCGACCGCAGGACGAAG
ATGGTATCGATACACAGCCTCTCTGAGCTGGAGCGTCTGAAGCTGCAAGAGACTGCTTACCACGAACTCGTGGCCAGACATTTCCTCTCC
GAATTCAAACCTGACAGAGCTCTGCCTATTGACCGTCCGAACACCTTGGATAAGTGGTTTCTGATTTTGAGAGGACAGCAGAGGGCTGTA
TCACACAAGACATTTGGCATTAGCCTGGAAGAGGTCCTGGTGAACGAGTTTACCCGCCGCAAGCATCTTGAACTGACAGCCACGATGCAG
GTTGAAGAAGCCACCGGTCAGGCTGCGGGCCGTCGTCGGGGAAACGTGGTGCGAAGGGTGTTTGGCCGCATCCGGCGCTTTTTCAGTCGC
AGGCGGAATGAGCCCACCTTGCCCCGGGAGTTCACTCGCCGTGGGCGTCGAGGTGCAGTGTCTGTGGATAGTCTGGCTGAGCTGGAAGAC
GGAGCCCTGCTGCTGCAGACCCTGCAGCTTTCAAAAATTTCCTTTCCAATTGGCCAACGACTTCTGGGATCCAAAAGGAAGATGAGTCTC
AATCCGATTGCGAAACAAATCCCCCAGGTTGTTGAGGCTTGCTGCCAATTCATTGAAAAACATGGCTTAAGCGCAGTGGGGATTTTTACC
CTTGAATACTCCGTGCAGCGAGTGCGTCAGCTCCGTGAAGAATTTGATCAAGGTCTGGATGTAGTGCTGGATGACAATCAGAATGTGCAT
GATGTGGCTGCACTCCTCAAGGAGTTTTTCCGTGACATGAAGGATTCTCTGCTGCCAGATGATCTGTACATGTCATTCCTCCTGACAGCA
ACTTTAAAGCCCCAGGATCAGCTTTCTGCCCTGCAGTTGCTGGTCTACCTGATGCCACCCTGCCACAGTGATACCCTGGAGCGTCTGCTG
AAGGCCCTGCATAAAATCACTGAGAACTGCGAGGACTCAATTGGCATTGATGGACAGTTGGTCCCAGGCAACCGTATGACTTCCACTAAC
TTGGCCTTGGTGTTTGGATCTGCTCTCCTGAAAAAAGGAAAGTTTGGCAAGAGAGAGTCCAGGAAAACAAAGCTGGGGATTGATCACTAT
GTTGCTTCTGTCAATGTGGTCCGTGCCATGATTGATAACTGGGATGTCCTCTTCCAGGTGCCTCCCCATATTCAGAGGCAGGTTGCTAAG
CGCGTGTGGAAGTCCAGCCCGGAAGCACTTGATTTTATCAGACGCAGGAACTTGAGGAAGATCCAGAGTGCACGCATAAAGATGGAAGAG
GATGCACTACTTTCTGATCCAGTGGAAACCTCTGCTGAAGCCCGGGCTGCTGTCCTTGCTCAAAGCAAGCCTTCTGATGAAGGTTCCTCT
GAGGAGCCAGCTGTGCCTTCCGGCACTGCCCGTTCCCATGACGATGAGGAAGGAGCGGGTAACCCTCCCATTCCGGAGCAAGACCGCCCA

>In-frame_CD99L2_ENST00000320893_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_1680nt
ATGGTGGCCTGGCGCTCGGCGTTCCTTGTCTGCCTCGCTTTCTCCTTGGCCACCCTGGTCCAGCGAGGATCTGGGGACTTTGATGATTTT
AACCTGGAGGATGCAGTGAAAGAAACTTCCTCAGTAAAGCTGAGTGTCTTGGGAGGAGCCCCAGGACACAACCCCGACCGCAGGACGAAG
ATGGTATCGATACACAGCCTCTCTGAGCTGGAGCGTCTGAAGCTGCAAGAGACTGCTTACCACGAACTCGTGGCCAGACATTTCCTCTCC
GAATTCAAACCTGACAGAGCTCTGCCTATTGACCGTCCGAACACCTTGGATAAGTGGTTTCTGATTTTGAGAGGACAGCAGAGGGCTGTA
TCACACAAGACATTTGGCATTAGCCTGGAAGAGGTCCTGGTGAACGAGTTTACCCGCCGCAAGCATCTTGAACTGACAGCCACGATGCAG
GTTGAAGAAGCCACCGGTCAGGCTGCGGGCCGTCGTCGGGGAAACGTGGTGCGAAGGGTGTTTGGCCGCATCCGGCGCTTTTTCAGTCGC
AGGCGGAATGAGCCCACCTTGCCCCGGGAGTTCACTCGCCGTGGGCGTCGAGGTGCAGTGTCTGTGGATAGTCTGGCTGAGCTGGAAGAC
GGAGCCCTGCTGCTGCAGACCCTGCAGCTTTCAAAAATTTCCTTTCCAATTGGCCAACGACTTCTGGGATCCAAAAGGAAGATGAGTCTC
AATCCGATTGCGAAACAAATCCCCCAGGTTGTTGAGGCTTGCTGCCAATTCATTGAAAAACATGGCTTAAGCGCAGTGGGGATTTTTACC
CTTGAATACTCCGTGCAGCGAGTGCGTCAGCTCCGTGAAGAATTTGATCAAGGTCTGGATGTAGTGCTGGATGACAATCAGAATGTGCAT
GATGTGGCTGCACTCCTCAAGGAGTTTTTCCGTGACATGAAGGATTCTCTGCTGCCAGATGATCTGTACATGTCATTCCTCCTGACAGCA
ACTTTAAAGCCCCAGGATCAGCTTTCTGCCCTGCAGTTGCTGGTCTACCTGATGCCACCCTGCCACAGTGATACCCTGGAGCGTCTGCTG
AAGGCCCTGCATAAAATCACTGAGAACTGCGAGGACTCAATTGGCATTGATGGACAGTTGGTCCCAGGCAACCGTATGACTTCCACTAAC
TTGGCCTTGGTGTTTGGATCTGCTCTCCTGAAAAAAGGAAAGTTTGGCAAGAGAGAGTCCAGGAAAACAAAGCTGGGGATTGATCACTAT
GTTGCTTCTGTCAATGTGGTCCGTGCCATGATTGATAACTGGGATGTCCTCTTCCAGGTGCCTCCCCATATTCAGAGGCAGGTTGCTAAG
CGCGTGTGGAAGTCCAGCCCGGAAGCACTTGATTTTATCAGACGCAGGAACTTGAGGAAGATCCAGAGTGCACGCATAAAGATGGAAGAG
GATGCACTACTTTCTGATCCAGTGGAAACCTCTGCTGAAGCCCGGGCTGCTGTCCTTGCTCAAAGCAAGCCTTCTGATGAAGGTTCCTCT
GAGGAGCCAGCTGTGCCTTCCGGCACTGCCCGTTCCCATGACGATGAGGAAGGAGCGGGTAACCCTCCCATTCCGGAGCAAGACCGCCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_CD99L2_ENST00000370377_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_2896nt
GCTTTGGGCGGGACCCTGCAGAGGCGGCGGGGCTCCTCCTCCCGCTCCTCCTCGGCCTCCCCTTCGGGCGCTCTCGCGCTAACTGTGCTC
CTCCGGGGCCCTCCGCCTGCTCCCAGCCATGGTGGCCTGGCGCTCGGCGTTCCTTGTCTGCCTCGCTTTCTCCTTGGCCACCCTGGTCCA
GCGAGGATCTGGGGACTTTGATGATTTTAACCTGGAGGATGCAGTGAAAGAAACTTCCTCAGTAAAGCTGAGTGTCTTGGGAGGAGCCCC
AGGACACAACCCCGACCGCAGGACGAAGATGGTATCGATACACAGCCTCTCTGAGCTGGAGCGTCTGAAGCTGCAAGAGACTGCTTACCA
CGAACTCGTGGCCAGACATTTCCTCTCCGAATTCAAACCTGACAGAGCTCTGCCTATTGACCGTCCGAACACCTTGGATAAGTGGTTTCT
GATTTTGAGAGGACAGCAGAGGGCTGTATCACACAAGACATTTGGCATTAGCCTGGAAGAGGTCCTGGTGAACGAGTTTACCCGCCGCAA
GCATCTTGAACTGACAGCCACGATGCAGGTTGAAGAAGCCACCGGTCAGGCTGCGGGCCGTCGTCGGGGAAACGTGGTGCGAAGGGTGTT
TGGCCGCATCCGGCGCTTTTTCAGTCGCAGGCGGAATGAGCCCACCTTGCCCCGGGAGTTCACTCGCCGTGGGCGTCGAGGTGCAGTGTC
TGTGGATAGTCTGGCTGAGCTGGAAGACGGAGCCCTGCTGCTGCAGACCCTGCAGCTTTCAAAAATTTCCTTTCCAATTGGCCAACGACT
TCTGGGATCCAAAAGGAAGATGAGTCTCAATCCGATTGCGAAACAAATCCCCCAGGTTGTTGAGGCTTGCTGCCAATTCATTGAAAAACA
TGGCTTAAGCGCAGTGGGGATTTTTACCCTTGAATACTCCGTGCAGCGAGTGCGTCAGCTCCGTGAAGAATTTGATCAAGGTCTGGATGT
AGTGCTGGATGACAATCAGAATGTGCATGATGTGGCTGCACTCCTCAAGGAGTTTTTCCGTGACATGAAGGATTCTCTGCTGCCAGATGA
TCTGTACATGTCATTCCTCCTGACAGCAACTTTAAAGCCCCAGGATCAGCTTTCTGCCCTGCAGTTGCTGGTCTACCTGATGCCACCCTG
CCACAGTGATACCCTGGAGCGTCTGCTGAAGGCCCTGCATAAAATCACTGAGAACTGCGAGGACTCAATTGGCATTGATGGACAGTTGGT
CCCAGGCAACCGTATGACTTCCACTAACTTGGCCTTGGTGTTTGGATCTGCTCTCCTGAAAAAAGGAAAGTTTGGCAAGAGAGAGTCCAG
GAAAACAAAGCTGGGGATTGATCACTATGTTGCTTCTGTCAATGTGGTCCGTGCCATGATTGATAACTGGGATGTCCTCTTCCAGGTGCC
TCCCCATATTCAGAGGCAGGTTGCTAAGCGCGTGTGGAAGTCCAGCCCGGAAGCACTTGATTTTATCAGACGCAGGAACTTGAGGAAGAT
CCAGAGTGCACGCATAAAGATGGAAGAGGATGCACTACTTTCTGATCCAGTGGAAACCTCTGCTGAAGCCCGGGCTGCTGTCCTTGCTCA
AAGCAAGCCTTCTGATGAAGGTTCCTCTGAGGAGCCAGCTGTGCCTTCCGGCACTGCCCGTTCCCATGACGATGAGGAAGGAGCGGGTAA
CCCTCCCATTCCGGAGCAAGACCGCCCATTGCTCCGTGTGCCCCGGGAGAAGGAGGCCAAAACTGGCGTCAGCTACTTCTTTCCTTAGAT
GTTTTTCCTTCTATAAGGTGCCAGACAGGGGAAAAGGGTGGGGGTACATCTGGGATGTCACAGGAAACATTAAGGAGAGAGTTGAAGGTA
AAGATCTGAAGGTAAGAAGGAGTTCCACCTGATGCTCGGGTCAGGATGAGAATTCCAAACACACTGCCAGCCCCTTCACTGGGGATGCTT
GGTCTCTTCTGCTGGTAAAAGCAGAGATGTTTCTGTGTCATGCCCAAGCTCCCCGGTGCTACCTTGCCTTTCTCTTTTACCCCTGATCTT
GGCTTTCTCTCTCTCTCTGCAGACTTTCCTTTAATTGATGTGACATTTGTGGTAAACACCTTTCCCAGGGAACCTCACAAATCTTGAGAT
GCTTTCCCTTCCCCAGATGGGATTGCATGATTTCCCTGACTTTCCTACCCTCCTCCAGAGAGCTCAGTTGGAAAGGCCCTCAAGAGGCAT
GCTAGAACGTTAGGTCAGCCTACTGACAGCTGACAAACAATTAATGCGAAATCATGTCACACCAACCCATAGCCGTGTCCACGCAGCAAC
TCCACCACCTTAGGATTTCCCCCTCCAAATTATTCAGACCAATGGCTTGCCAAATGGCCTCTCCCAAAATTCTGTACAGTTTTGCTCAGG
TCACGCCAACAGGGAAACCTCAAGTGTAGGTCTAATTAGTGTTTCTGGGATCCAAAGTTAGAGGAAAATTTAGATTTTATTGCCTGGATC
TGCTTTAAAGACAATTGGTGTTTACACCCTCTTGTCAGCAAAACAGCTAGTTAGGTAAGGACATATAGTTCCAAGTAGGTAAAGTCACTT
GATTACAAATGTTCTTAACTATCGTCTCTGTAATTCCTTTATACAGGACAGTACAAAATTGTGGGACATGCTCTGGTAACACACAGATAT
GGGTTGCATATGATCCAGAATTACAGCTGATATTATGGATGACAACTGCTAAGGTCCATAAAATGAAGACTGTATTGTATTGAGGGATAG
AAATTGATCATTTAATGGGTAACAACTGCTGAGCTCAAAGATTTGTGATTGTTAAAACTTCTCTGGCATTTAATCATTAATAAACATCTG

>In-frame_CD99L2_ENST00000355149_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_3006nt
GCAGCCTCGCCCCGCCCCCCGGCCTAACCCCAGCCCAGGCGCCCTCAGGCGCCGGCTCTCTAGCGCGCCCGACCTCCATCTTCCCGGGGC
CGCGCCGCGCGCGCGCGCGGGCTTTGGGCGGGACCCTGCAGAGGCGGCGGGGCTCCTCCTCCCGCTCCTCCTCGGCCTCCCCTTCGGGCG
CTCTCGCGCTAACTGTGCTCCTCCGGGGCCCTCCGCCTGCTCCCAGCCATGGTGGCCTGGCGCTCGGCGTTCCTTGTCTGCCTCGCTTTC
TCCTTGGCCACCCTGGTCCAGCGAGGATCTGGGGACTTTGATGATTTTAACCTGGAGGATGCAGTGAAAGAAACTTCCTCAGTAAAGCTG
AGTGTCTTGGGAGGAGCCCCAGGACACAACCCCGACCGCAGGACGAAGATGGTATCGATACACAGCCTCTCTGAGCTGGAGCGTCTGAAG
CTGCAAGAGACTGCTTACCACGAACTCGTGGCCAGACATTTCCTCTCCGAATTCAAACCTGACAGAGCTCTGCCTATTGACCGTCCGAAC
ACCTTGGATAAGTGGTTTCTGATTTTGAGAGGACAGCAGAGGGCTGTATCACACAAGACATTTGGCATTAGCCTGGAAGAGGTCCTGGTG
AACGAGTTTACCCGCCGCAAGCATCTTGAACTGACAGCCACGATGCAGGTTGAAGAAGCCACCGGTCAGGCTGCGGGCCGTCGTCGGGGA
AACGTGGTGCGAAGGGTGTTTGGCCGCATCCGGCGCTTTTTCAGTCGCAGGCGGAATGAGCCCACCTTGCCCCGGGAGTTCACTCGCCGT
GGGCGTCGAGGTGCAGTGTCTGTGGATAGTCTGGCTGAGCTGGAAGACGGAGCCCTGCTGCTGCAGACCCTGCAGCTTTCAAAAATTTCC
TTTCCAATTGGCCAACGACTTCTGGGATCCAAAAGGAAGATGAGTCTCAATCCGATTGCGAAACAAATCCCCCAGGTTGTTGAGGCTTGC
TGCCAATTCATTGAAAAACATGGCTTAAGCGCAGTGGGGATTTTTACCCTTGAATACTCCGTGCAGCGAGTGCGTCAGCTCCGTGAAGAA
TTTGATCAAGGTCTGGATGTAGTGCTGGATGACAATCAGAATGTGCATGATGTGGCTGCACTCCTCAAGGAGTTTTTCCGTGACATGAAG
GATTCTCTGCTGCCAGATGATCTGTACATGTCATTCCTCCTGACAGCAACTTTAAAGCCCCAGGATCAGCTTTCTGCCCTGCAGTTGCTG
GTCTACCTGATGCCACCCTGCCACAGTGATACCCTGGAGCGTCTGCTGAAGGCCCTGCATAAAATCACTGAGAACTGCGAGGACTCAATT
GGCATTGATGGACAGTTGGTCCCAGGCAACCGTATGACTTCCACTAACTTGGCCTTGGTGTTTGGATCTGCTCTCCTGAAAAAAGGAAAG
TTTGGCAAGAGAGAGTCCAGGAAAACAAAGCTGGGGATTGATCACTATGTTGCTTCTGTCAATGTGGTCCGTGCCATGATTGATAACTGG
GATGTCCTCTTCCAGGTGCCTCCCCATATTCAGAGGCAGGTTGCTAAGCGCGTGTGGAAGTCCAGCCCGGAAGCACTTGATTTTATCAGA
CGCAGGAACTTGAGGAAGATCCAGAGTGCACGCATAAAGATGGAAGAGGATGCACTACTTTCTGATCCAGTGGAAACCTCTGCTGAAGCC
CGGGCTGCTGTCCTTGCTCAAAGCAAGCCTTCTGATGAAGGTTCCTCTGAGGAGCCAGCTGTGCCTTCCGGCACTGCCCGTTCCCATGAC
GATGAGGAAGGAGCGGGTAACCCTCCCATTCCGGAGCAAGACCGCCCATTGCTCCGTGTGCCCCGGGAGAAGGAGGCCAAAACTGGCGTC
AGCTACTTCTTTCCTTAGATGTTTTTCCTTCTATAAGGTGCCAGACAGGGGAAAAGGGTGGGGGTACATCTGGGATGTCACAGGAAACAT
TAAGGAGAGAGTTGAAGGTAAAGATCTGAAGGTAAGAAGGAGTTCCACCTGATGCTCGGGTCAGGATGAGAATTCCAAACACACTGCCAG
CCCCTTCACTGGGGATGCTTGGTCTCTTCTGCTGGTAAAAGCAGAGATGTTTCTGTGTCATGCCCAAGCTCCCCGGTGCTACCTTGCCTT
TCTCTTTTACCCCTGATCTTGGCTTTCTCTCTCTCTCTGCAGACTTTCCTTTAATTGATGTGACATTTGTGGTAAACACCTTTCCCAGGG
AACCTCACAAATCTTGAGATGCTTTCCCTTCCCCAGATGGGATTGCATGATTTCCCTGACTTTCCTACCCTCCTCCAGAGAGCTCAGTTG
GAAAGGCCCTCAAGAGGCATGCTAGAACGTTAGGTCAGCCTACTGACAGCTGACAAACAATTAATGCGAAATCATGTCACACCAACCCAT
AGCCGTGTCCACGCAGCAACTCCACCACCTTAGGATTTCCCCCTCCAAATTATTCAGACCAATGGCTTGCCAAATGGCCTCTCCCAAAAT
TCTGTACAGTTTTGCTCAGGTCACGCCAACAGGGAAACCTCAAGTGTAGGTCTAATTAGTGTTTCTGGGATCCAAAGTTAGAGGAAAATT
TAGATTTTATTGCCTGGATCTGCTTTAAAGACAATTGGTGTTTACACCCTCTTGTCAGCAAAACAGCTAGTTAGGTAAGGACATATAGTT
CCAAGTAGGTAAAGTCACTTGATTACAAATGTTCTTAACTATCGTCTCTGTAATTCCTTTATACAGGACAGTACAAAATTGTGGGACATG
CTCTGGTAACACACAGATATGGGTTGCATATGATCCAGAATTACAGCTGATATTATGGATGACAACTGCTAAGGTCCATAAAATGAAGAC
TGTATTGTATTGAGGGATAGAAATTGATCATTTAATGGGTAACAACTGCTGAGCTCAAAGATTTGTGATTGTTAAAACTTCTCTGGCATT

>In-frame_CD99L2_ENST00000437787_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_3006nt
GCAGCCTCGCCCCGCCCCCCGGCCTAACCCCAGCCCAGGCGCCCTCAGGCGCCGGCTCTCTAGCGCGCCCGACCTCCATCTTCCCGGGGC
CGCGCCGCGCGCGCGCGCGGGCTTTGGGCGGGACCCTGCAGAGGCGGCGGGGCTCCTCCTCCCGCTCCTCCTCGGCCTCCCCTTCGGGCG
CTCTCGCGCTAACTGTGCTCCTCCGGGGCCCTCCGCCTGCTCCCAGCCATGGTGGCCTGGCGCTCGGCGTTCCTTGTCTGCCTCGCTTTC
TCCTTGGCCACCCTGGTCCAGCGAGGATCTGGGGACTTTGATGATTTTAACCTGGAGGATGCAGTGAAAGAAACTTCCTCAGTAAAGCTG
AGTGTCTTGGGAGGAGCCCCAGGACACAACCCCGACCGCAGGACGAAGATGGTATCGATACACAGCCTCTCTGAGCTGGAGCGTCTGAAG
CTGCAAGAGACTGCTTACCACGAACTCGTGGCCAGACATTTCCTCTCCGAATTCAAACCTGACAGAGCTCTGCCTATTGACCGTCCGAAC
ACCTTGGATAAGTGGTTTCTGATTTTGAGAGGACAGCAGAGGGCTGTATCACACAAGACATTTGGCATTAGCCTGGAAGAGGTCCTGGTG
AACGAGTTTACCCGCCGCAAGCATCTTGAACTGACAGCCACGATGCAGGTTGAAGAAGCCACCGGTCAGGCTGCGGGCCGTCGTCGGGGA
AACGTGGTGCGAAGGGTGTTTGGCCGCATCCGGCGCTTTTTCAGTCGCAGGCGGAATGAGCCCACCTTGCCCCGGGAGTTCACTCGCCGT
GGGCGTCGAGGTGCAGTGTCTGTGGATAGTCTGGCTGAGCTGGAAGACGGAGCCCTGCTGCTGCAGACCCTGCAGCTTTCAAAAATTTCC
TTTCCAATTGGCCAACGACTTCTGGGATCCAAAAGGAAGATGAGTCTCAATCCGATTGCGAAACAAATCCCCCAGGTTGTTGAGGCTTGC
TGCCAATTCATTGAAAAACATGGCTTAAGCGCAGTGGGGATTTTTACCCTTGAATACTCCGTGCAGCGAGTGCGTCAGCTCCGTGAAGAA
TTTGATCAAGGTCTGGATGTAGTGCTGGATGACAATCAGAATGTGCATGATGTGGCTGCACTCCTCAAGGAGTTTTTCCGTGACATGAAG
GATTCTCTGCTGCCAGATGATCTGTACATGTCATTCCTCCTGACAGCAACTTTAAAGCCCCAGGATCAGCTTTCTGCCCTGCAGTTGCTG
GTCTACCTGATGCCACCCTGCCACAGTGATACCCTGGAGCGTCTGCTGAAGGCCCTGCATAAAATCACTGAGAACTGCGAGGACTCAATT
GGCATTGATGGACAGTTGGTCCCAGGCAACCGTATGACTTCCACTAACTTGGCCTTGGTGTTTGGATCTGCTCTCCTGAAAAAAGGAAAG
TTTGGCAAGAGAGAGTCCAGGAAAACAAAGCTGGGGATTGATCACTATGTTGCTTCTGTCAATGTGGTCCGTGCCATGATTGATAACTGG
GATGTCCTCTTCCAGGTGCCTCCCCATATTCAGAGGCAGGTTGCTAAGCGCGTGTGGAAGTCCAGCCCGGAAGCACTTGATTTTATCAGA
CGCAGGAACTTGAGGAAGATCCAGAGTGCACGCATAAAGATGGAAGAGGATGCACTACTTTCTGATCCAGTGGAAACCTCTGCTGAAGCC
CGGGCTGCTGTCCTTGCTCAAAGCAAGCCTTCTGATGAAGGTTCCTCTGAGGAGCCAGCTGTGCCTTCCGGCACTGCCCGTTCCCATGAC
GATGAGGAAGGAGCGGGTAACCCTCCCATTCCGGAGCAAGACCGCCCATTGCTCCGTGTGCCCCGGGAGAAGGAGGCCAAAACTGGCGTC
AGCTACTTCTTTCCTTAGATGTTTTTCCTTCTATAAGGTGCCAGACAGGGGAAAAGGGTGGGGGTACATCTGGGATGTCACAGGAAACAT
TAAGGAGAGAGTTGAAGGTAAAGATCTGAAGGTAAGAAGGAGTTCCACCTGATGCTCGGGTCAGGATGAGAATTCCAAACACACTGCCAG
CCCCTTCACTGGGGATGCTTGGTCTCTTCTGCTGGTAAAAGCAGAGATGTTTCTGTGTCATGCCCAAGCTCCCCGGTGCTACCTTGCCTT
TCTCTTTTACCCCTGATCTTGGCTTTCTCTCTCTCTCTGCAGACTTTCCTTTAATTGATGTGACATTTGTGGTAAACACCTTTCCCAGGG
AACCTCACAAATCTTGAGATGCTTTCCCTTCCCCAGATGGGATTGCATGATTTCCCTGACTTTCCTACCCTCCTCCAGAGAGCTCAGTTG
GAAAGGCCCTCAAGAGGCATGCTAGAACGTTAGGTCAGCCTACTGACAGCTGACAAACAATTAATGCGAAATCATGTCACACCAACCCAT
AGCCGTGTCCACGCAGCAACTCCACCACCTTAGGATTTCCCCCTCCAAATTATTCAGACCAATGGCTTGCCAAATGGCCTCTCCCAAAAT
TCTGTACAGTTTTGCTCAGGTCACGCCAACAGGGAAACCTCAAGTGTAGGTCTAATTAGTGTTTCTGGGATCCAAAGTTAGAGGAAAATT
TAGATTTTATTGCCTGGATCTGCTTTAAAGACAATTGGTGTTTACACCCTCTTGTCAGCAAAACAGCTAGTTAGGTAAGGACATATAGTT
CCAAGTAGGTAAAGTCACTTGATTACAAATGTTCTTAACTATCGTCTCTGTAATTCCTTTATACAGGACAGTACAAAATTGTGGGACATG
CTCTGGTAACACACAGATATGGGTTGCATATGATCCAGAATTACAGCTGATATTATGGATGACAACTGCTAAGGTCCATAAAATGAAGAC
TGTATTGTATTGAGGGATAGAAATTGATCATTTAATGGGTAACAACTGCTGAGCTCAAAGATTTGTGATTGTTAAAACTTCTCTGGCATT

>In-frame_CD99L2_ENST00000466436_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_2819nt
GCTAACTGTGCTCCTCCGGGGCCCTCCGCCTGCTCCCAGCCATGGTGGCCTGGCGCTCGGCGTTCCTTGTCTGCCTCGCTTTCTCCTTGG
CCACCCTGGTCCAGCGAGGATCTGGGGACTTTGATGATTTTAACCTGGAGGATGCAGTGAAAGAAACTTCCTCAGTAAAGCTGAGTGTCT
TGGGAGGAGCCCCAGGACACAACCCCGACCGCAGGACGAAGATGGTATCGATACACAGCCTCTCTGAGCTGGAGCGTCTGAAGCTGCAAG
AGACTGCTTACCACGAACTCGTGGCCAGACATTTCCTCTCCGAATTCAAACCTGACAGAGCTCTGCCTATTGACCGTCCGAACACCTTGG
ATAAGTGGTTTCTGATTTTGAGAGGACAGCAGAGGGCTGTATCACACAAGACATTTGGCATTAGCCTGGAAGAGGTCCTGGTGAACGAGT
TTACCCGCCGCAAGCATCTTGAACTGACAGCCACGATGCAGGTTGAAGAAGCCACCGGTCAGGCTGCGGGCCGTCGTCGGGGAAACGTGG
TGCGAAGGGTGTTTGGCCGCATCCGGCGCTTTTTCAGTCGCAGGCGGAATGAGCCCACCTTGCCCCGGGAGTTCACTCGCCGTGGGCGTC
GAGGTGCAGTGTCTGTGGATAGTCTGGCTGAGCTGGAAGACGGAGCCCTGCTGCTGCAGACCCTGCAGCTTTCAAAAATTTCCTTTCCAA
TTGGCCAACGACTTCTGGGATCCAAAAGGAAGATGAGTCTCAATCCGATTGCGAAACAAATCCCCCAGGTTGTTGAGGCTTGCTGCCAAT
TCATTGAAAAACATGGCTTAAGCGCAGTGGGGATTTTTACCCTTGAATACTCCGTGCAGCGAGTGCGTCAGCTCCGTGAAGAATTTGATC
AAGGTCTGGATGTAGTGCTGGATGACAATCAGAATGTGCATGATGTGGCTGCACTCCTCAAGGAGTTTTTCCGTGACATGAAGGATTCTC
TGCTGCCAGATGATCTGTACATGTCATTCCTCCTGACAGCAACTTTAAAGCCCCAGGATCAGCTTTCTGCCCTGCAGTTGCTGGTCTACC
TGATGCCACCCTGCCACAGTGATACCCTGGAGCGTCTGCTGAAGGCCCTGCATAAAATCACTGAGAACTGCGAGGACTCAATTGGCATTG
ATGGACAGTTGGTCCCAGGCAACCGTATGACTTCCACTAACTTGGCCTTGGTGTTTGGATCTGCTCTCCTGAAAAAAGGAAAGTTTGGCA
AGAGAGAGTCCAGGAAAACAAAGCTGGGGATTGATCACTATGTTGCTTCTGTCAATGTGGTCCGTGCCATGATTGATAACTGGGATGTCC
TCTTCCAGGTGCCTCCCCATATTCAGAGGCAGGTTGCTAAGCGCGTGTGGAAGTCCAGCCCGGAAGCACTTGATTTTATCAGACGCAGGA
ACTTGAGGAAGATCCAGAGTGCACGCATAAAGATGGAAGAGGATGCACTACTTTCTGATCCAGTGGAAACCTCTGCTGAAGCCCGGGCTG
CTGTCCTTGCTCAAAGCAAGCCTTCTGATGAAGGTTCCTCTGAGGAGCCAGCTGTGCCTTCCGGCACTGCCCGTTCCCATGACGATGAGG
AAGGAGCGGGTAACCCTCCCATTCCGGAGCAAGACCGCCCATTGCTCCGTGTGCCCCGGGAGAAGGAGGCCAAAACTGGCGTCAGCTACT
TCTTTCCTTAGATGTTTTTCCTTCTATAAGGTGCCAGACAGGGGAAAAGGGTGGGGGTACATCTGGGATGTCACAGGAAACATTAAGGAG
AGAGTTGAAGGTAAAGATCTGAAGGTAAGAAGGAGTTCCACCTGATGCTCGGGTCAGGATGAGAATTCCAAACACACTGCCAGCCCCTTC
ACTGGGGATGCTTGGTCTCTTCTGCTGGTAAAAGCAGAGATGTTTCTGTGTCATGCCCAAGCTCCCCGGTGCTACCTTGCCTTTCTCTTT
TACCCCTGATCTTGGCTTTCTCTCTCTCTCTGCAGACTTTCCTTTAATTGATGTGACATTTGTGGTAAACACCTTTCCCAGGGAACCTCA
CAAATCTTGAGATGCTTTCCCTTCCCCAGATGGGATTGCATGATTTCCCTGACTTTCCTACCCTCCTCCAGAGAGCTCAGTTGGAAAGGC
CCTCAAGAGGCATGCTAGAACGTTAGGTCAGCCTACTGACAGCTGACAAACAATTAATGCGAAATCATGTCACACCAACCCATAGCCGTG
TCCACGCAGCAACTCCACCACCTTAGGATTTCCCCCTCCAAATTATTCAGACCAATGGCTTGCCAAATGGCCTCTCCCAAAATTCTGTAC
AGTTTTGCTCAGGTCACGCCAACAGGGAAACCTCAAGTGTAGGTCTAATTAGTGTTTCTGGGATCCAAAGTTAGAGGAAAATTTAGATTT
TATTGCCTGGATCTGCTTTAAAGACAATTGGTGTTTACACCCTCTTGTCAGCAAAACAGCTAGTTAGGTAAGGACATATAGTTCCAAGTA
GGTAAAGTCACTTGATTACAAATGTTCTTAACTATCGTCTCTGTAATTCCTTTATACAGGACAGTACAAAATTGTGGGACATGCTCTGGT
AACACACAGATATGGGTTGCATATGATCCAGAATTACAGCTGATATTATGGATGACAACTGCTAAGGTCCATAAAATGAAGACTGTATTG
TATTGAGGGATAGAAATTGATCATTTAATGGGTAACAACTGCTGAGCTCAAAGATTTGTGATTGTTAAAACTTCTCTGGCATTTAATCAT

>In-frame_CD99L2_ENST00000320893_chrX_149999704_-_ARHGAP36_ENST00000370922_chrX_130215734_+_2896nt
GCTTTGGGCGGGACCCTGCAGAGGCGGCGGGGCTCCTCCTCCCGCTCCTCCTCGGCCTCCCCTTCGGGCGCTCTCGCGCTAACTGTGCTC
CTCCGGGGCCCTCCGCCTGCTCCCAGCCATGGTGGCCTGGCGCTCGGCGTTCCTTGTCTGCCTCGCTTTCTCCTTGGCCACCCTGGTCCA
GCGAGGATCTGGGGACTTTGATGATTTTAACCTGGAGGATGCAGTGAAAGAAACTTCCTCAGTAAAGCTGAGTGTCTTGGGAGGAGCCCC
AGGACACAACCCCGACCGCAGGACGAAGATGGTATCGATACACAGCCTCTCTGAGCTGGAGCGTCTGAAGCTGCAAGAGACTGCTTACCA
CGAACTCGTGGCCAGACATTTCCTCTCCGAATTCAAACCTGACAGAGCTCTGCCTATTGACCGTCCGAACACCTTGGATAAGTGGTTTCT
GATTTTGAGAGGACAGCAGAGGGCTGTATCACACAAGACATTTGGCATTAGCCTGGAAGAGGTCCTGGTGAACGAGTTTACCCGCCGCAA
GCATCTTGAACTGACAGCCACGATGCAGGTTGAAGAAGCCACCGGTCAGGCTGCGGGCCGTCGTCGGGGAAACGTGGTGCGAAGGGTGTT
TGGCCGCATCCGGCGCTTTTTCAGTCGCAGGCGGAATGAGCCCACCTTGCCCCGGGAGTTCACTCGCCGTGGGCGTCGAGGTGCAGTGTC
TGTGGATAGTCTGGCTGAGCTGGAAGACGGAGCCCTGCTGCTGCAGACCCTGCAGCTTTCAAAAATTTCCTTTCCAATTGGCCAACGACT
TCTGGGATCCAAAAGGAAGATGAGTCTCAATCCGATTGCGAAACAAATCCCCCAGGTTGTTGAGGCTTGCTGCCAATTCATTGAAAAACA
TGGCTTAAGCGCAGTGGGGATTTTTACCCTTGAATACTCCGTGCAGCGAGTGCGTCAGCTCCGTGAAGAATTTGATCAAGGTCTGGATGT
AGTGCTGGATGACAATCAGAATGTGCATGATGTGGCTGCACTCCTCAAGGAGTTTTTCCGTGACATGAAGGATTCTCTGCTGCCAGATGA
TCTGTACATGTCATTCCTCCTGACAGCAACTTTAAAGCCCCAGGATCAGCTTTCTGCCCTGCAGTTGCTGGTCTACCTGATGCCACCCTG
CCACAGTGATACCCTGGAGCGTCTGCTGAAGGCCCTGCATAAAATCACTGAGAACTGCGAGGACTCAATTGGCATTGATGGACAGTTGGT
CCCAGGCAACCGTATGACTTCCACTAACTTGGCCTTGGTGTTTGGATCTGCTCTCCTGAAAAAAGGAAAGTTTGGCAAGAGAGAGTCCAG
GAAAACAAAGCTGGGGATTGATCACTATGTTGCTTCTGTCAATGTGGTCCGTGCCATGATTGATAACTGGGATGTCCTCTTCCAGGTGCC
TCCCCATATTCAGAGGCAGGTTGCTAAGCGCGTGTGGAAGTCCAGCCCGGAAGCACTTGATTTTATCAGACGCAGGAACTTGAGGAAGAT
CCAGAGTGCACGCATAAAGATGGAAGAGGATGCACTACTTTCTGATCCAGTGGAAACCTCTGCTGAAGCCCGGGCTGCTGTCCTTGCTCA
AAGCAAGCCTTCTGATGAAGGTTCCTCTGAGGAGCCAGCTGTGCCTTCCGGCACTGCCCGTTCCCATGACGATGAGGAAGGAGCGGGTAA
CCCTCCCATTCCGGAGCAAGACCGCCCATTGCTCCGTGTGCCCCGGGAGAAGGAGGCCAAAACTGGCGTCAGCTACTTCTTTCCTTAGAT
GTTTTTCCTTCTATAAGGTGCCAGACAGGGGAAAAGGGTGGGGGTACATCTGGGATGTCACAGGAAACATTAAGGAGAGAGTTGAAGGTA
AAGATCTGAAGGTAAGAAGGAGTTCCACCTGATGCTCGGGTCAGGATGAGAATTCCAAACACACTGCCAGCCCCTTCACTGGGGATGCTT
GGTCTCTTCTGCTGGTAAAAGCAGAGATGTTTCTGTGTCATGCCCAAGCTCCCCGGTGCTACCTTGCCTTTCTCTTTTACCCCTGATCTT
GGCTTTCTCTCTCTCTCTGCAGACTTTCCTTTAATTGATGTGACATTTGTGGTAAACACCTTTCCCAGGGAACCTCACAAATCTTGAGAT
GCTTTCCCTTCCCCAGATGGGATTGCATGATTTCCCTGACTTTCCTACCCTCCTCCAGAGAGCTCAGTTGGAAAGGCCCTCAAGAGGCAT
GCTAGAACGTTAGGTCAGCCTACTGACAGCTGACAAACAATTAATGCGAAATCATGTCACACCAACCCATAGCCGTGTCCACGCAGCAAC
TCCACCACCTTAGGATTTCCCCCTCCAAATTATTCAGACCAATGGCTTGCCAAATGGCCTCTCCCAAAATTCTGTACAGTTTTGCTCAGG
TCACGCCAACAGGGAAACCTCAAGTGTAGGTCTAATTAGTGTTTCTGGGATCCAAAGTTAGAGGAAAATTTAGATTTTATTGCCTGGATC
TGCTTTAAAGACAATTGGTGTTTACACCCTCTTGTCAGCAAAACAGCTAGTTAGGTAAGGACATATAGTTCCAAGTAGGTAAAGTCACTT
GATTACAAATGTTCTTAACTATCGTCTCTGTAATTCCTTTATACAGGACAGTACAAAATTGTGGGACATGCTCTGGTAACACACAGATAT
GGGTTGCATATGATCCAGAATTACAGCTGATATTATGGATGACAACTGCTAAGGTCCATAAAATGAAGACTGTATTGTATTGAGGGATAG
AAATTGATCATTTAATGGGTAACAACTGCTGAGCTCAAAGATTTGTGATTGTTAAAACTTCTCTGGCATTTAATCATTAATAAACATCTG


Top

FusionGenePPI for CD99L2_ARHGAP36


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
CD99L2UBQLN1, TMEM216, ATM, MKNK2, KIF2A, LLGL2, VPS26A, FAN1, POLK, KIF21A, DNAJC11, CDCA5, KLC3, ARX, CEP170P1, CAPN1ARHGAP36CLN5, PREPL, TUBA3C, APOD, ATG2B, TTC19, PJA2, MAGED4B, CLU, PTPRD, STOM, MUCL1, CAND2, TARBP2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for CD99L2_ARHGAP36


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for CD99L2_ARHGAP36


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource